Your browser is old and dusty. Try Google Chrome!

Details for sll0869

ORF sll0869
Accession NP_440931.1
Symbol aat
Category Protein modification and translation factors
Definition Leu/Phe-tRNA-protein transferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -230 -223 14.6904 0.0123
NP_440795.1_7 Reverse -223 -230 14.6904 0.0123
NP_442291.1_5 Forward -232 -216 2.91013 0.117
NP_442291.1_5 Reverse -221 -237 1.33684 0.148
NP_441453.1_4 Reverse -222 -230 16.539 0.00633
NP_441453.1_4 Forward -231 -223 7.8859 0.0536
NP_442151.1_6 Reverse -222 -236 12.7826 0.0674
NP_441818.1_1 Reverse -223 -234 15.8894 0.0244
NP_441818.1_9 Forward -154 -135 -7.27704 0.271
NP_440226.1_1 Forward -231 -212 13.4708 0.0356
NP_440931.1_7 Forward -201 -183 20.0778 0.117
NP_440150.1_2 Forward -140 -121 7.17681 0.247
NP_442655.1_2 Forward -308 -289 7.86593 0.147
NP_442655.1_10 Forward -286 -267 -12.1936 0.261
NP_442173.1_1 Forward -230 -222 15.4574 0.00633
NP_442173.1_1 Reverse -223 -231 14.1791 0.0165
NP_442752.1_4 Reverse -222 -229 13.8055 0.0199
NP_443027.1_4 Forward -233 -223 14.1397 0.0452
NP_443027.1_4 Reverse -220 -230 13.2547 0.0521
NP_441812.1_3 Reverse -320 -334 7.86607 0.259
NP_442975.1_10 Forward -235 -221 3.04726 0.263
NP_440784.1_7 Forward -230 -223 15.9687 0.0123
NP_440784.1_7 Reverse -223 -230 15.9687 0.0123
NP_442909.1_7 Forward -103 -89 8.75042 0.163
NP_442861.1_1 Forward -316 -297 19.764 0.19
NP_442289.1_4 Reverse -214 -230 13.1366 0.219
NP_440061.1_9 Reverse -220 -234 11.7987 0.105
NP_440061.1_9 Reverse -125 -139 5.89884 0.266
NP_440110.1_8 Forward -233 -214 -3.24547 0.29
NP_441054.1_4 Reverse -212 -230 -1.35749 0.198
NP_442062.1_8 Reverse -222 -232 16.6963 0.00399
NP_440304.1_4 Reverse -220 -230 10.8948 0.051
NP_440304.1_4 Forward -24 -14 6.76487 0.146
NP_440304.1_4 Forward -138 -128 4.10993 0.272
NP_442242.1_4 Forward -230 -223 14.3954 0.0124
NP_442242.1_4 Reverse -223 -230 14.3954 0.0124
NP_440044.1_8 Reverse -223 -242 6.39097 0.0916
NP_442602.1_3 Reverse -118 -137 0.982764 0.197
NP_441208.1_9 Reverse -177 -191 6.88276 0.229
NP_441208.1_9 Forward -234 -220 6.09611 0.253
NP_441925.1_4 Reverse -283 -302 -7.86776 0.202
NP_441925.1_4 Reverse -282 -301 -8.45774 0.209
NP_440856.1_4 Reverse -134 -153 -4.91709 0.27
NP_440856.1_7 Forward -84 -65 -1.27885 0.182
NP_441083.1_5 Reverse -222 -232 10.5998 0.0192
NP_441083.1_5 Forward -231 -221 1.94665 0.197
NP_442827.1_8 Forward -239 -220 6.58682 0.105
NP_441434.1_7 Forward -229 -215 3.8345 0.225
NP_441738.1_2 Forward -229 -222 15.28 0.0102
NP_441738.1_2 Reverse -224 -231 11.5435 0.084
NP_441558.1_5 Forward -233 -214 7.86593 0.167
NP_441558.1_5 Reverse -220 -239 4.71934 0.271
NP_440209.1_1 Reverse -222 -230 18.1123 0.00295
NP_440209.1_1 Forward -231 -223 8.47588 0.0457
NP_442889.1_8 Reverse -219 -233 10.2254 0.0882
NP_440447.1_1 Reverse -217 -235 1.49411 0.3
NP_441713.1_1 Forward -237 -218 -14.4552 0.259
NP_440178.1_7 Forward -232 -213 -12.8819 0.127
NP_440178.1_7 Reverse -221 -240 -22.715 0.272
NP_440178.1_7 Reverse -255 -274 -22.9117 0.282
NP_442059.1_4 Forward -231 -212 5.11266 0.193
NP_441716.1_1 Reverse -222 -236 11.5043 0.0936
NP_440644.1_3 Forward -276 -257 8.94757 0.17
NP_442111.1_4 Forward -232 -218 19.5675 0.00405
NP_440906.1_4 Reverse -248 -267 14.0608 0.292
NP_440906.1_5 Forward -230 -223 15.8704 0.0124
NP_440906.1_5 Reverse -223 -230 15.8704 0.0124
NP_440747.1_10 Forward -234 -222 -2.32097 0.0331
NP_440747.1_10 Reverse -219 -231 -2.4193 0.0434
NP_440747.1_10 Reverse -10 -22 -2.81262 0.0713
NP_440747.1_10 Reverse -124 -136 -4.68091 0.115
NP_440747.1_10 Forward -25 -13 -12.1541 0.227
NP_441130.1_10 Reverse -220 -234 10.1277 0.117
NP_441130.1_10 Reverse -93 -107 4.52282 0.281
NP_441854.1_10 Forward -354 -335 2.75272 0.282
NP_441486.1_1 Forward -234 -220 -4.7203 0.205
NP_442634.1_4 Reverse -220 -234 5.50613 0.0561
NP_440842.1_10 Forward -293 -279 3.63784 0.255
NP_442848.1_1 Forward -237 -223 -4.22864 0.282
NP_443018.1_3 Forward -230 -223 14.8871 0.0123
NP_443018.1_3 Reverse -223 -230 14.8871 0.0123
NP_441634.1_8 Reverse -220 -234 6.3911 0.114
NP_440376.1_1 Reverse -222 -231 9.73449 0.0365
NP_440376.1_1 Forward -231 -222 9.63616 0.0385
NP_441857.1_5 Forward -238 -220 2.57575 0.266
NP_441857.1_6 Forward -125 -115 18.9579 0.139
NP_442730.1_8 Forward -197 -178 10.6184 0.185
NP_442687.1_7 Forward -285 -275 3.81494 0.286
NP_442485.1_3 Forward -106 -87 -6.09707 0.299
NP_441846.1_10 Forward -292 -273 -22.2233 0.257
NP_441846.1_10 Forward -393 -374 -23.305 0.282
NP_441013.1_2 Reverse -81 -99 0.117479 0.254
NP_441422.1_7 Reverse -220 -237 5.64371 0.0992
NP_441763.1_5 Reverse -261 -280 -6.29373 0.274
NP_442658.1_1 Reverse -220 -230 14.2375 0.0237
NP_442658.1_1 Forward -233 -223 7.74772 0.209
NP_442161.1_4 Forward -232 -213 19.5673 0.0195
NP_442205.1_9 Forward -237 -221 -0.0397962 0.264
NP_441414.1_9 Forward -231 -212 0.491109 0.0814
NP_441414.1_9 Forward -291 -272 -4.91709 0.164
NP_441256.1_8 Forward -144 -125 2.75272 0.285
NP_442937.1_5 Forward -242 -223 6.19431 0.286
NP_442321.1_1 Forward -156 -137 -5.50708 0.218
NP_442321.1_4 Reverse -118 -137 -5.99873 0.284
NP_441958.1_5 Reverse -221 -231 12.0747 0.00222
NP_441958.1_5 Forward -232 -222 2.43831 0.0422
NP_442057.1_4 Reverse -306 -325 13.6675 0.259
NP_442836.1_5 Forward -237 -218 16.8141 0.0511
NP_442836.1_10 Forward -125 -115 9.51814 0.274
NP_442836.1_10 Forward -251 -241 9.32148 0.277
NP_440203.1_5 Forward -133 -123 11.3859 0.195
NP_439905.1_1 Forward -230 -217 8.27909 0.234
NP_440995.1_8 Forward -241 -222 -0.295539 0.288
NP_441162.1_3 Forward -73 -54 7.86593 0.275
NP_442690.1_1 Reverse -44 -63 -16.6185 0.29
NP_442911.1_2 Forward -241 -222 -7.67036 0.216
NP_441580.1_6 Reverse -211 -230 -8.26035 0.254
NP_440153.1_5 Forward -230 -216 13.9626 0.0551
NP_440153.1_5 Reverse -223 -237 7.9644 0.149
NP_442064.1_1 Reverse -8 -27 -9.34199 0.259
NP_442064.1_1 Forward -236 -217 -9.93197 0.259
NP_442536.1_4 Reverse -124 -142 7.29564 0.299
NP_443055.1_6 Reverse -275 -293 0.805058 0.239
NP_440993.1_2 Reverse -217 -233 3.40179 0.259
NP_440602.1_2 Reverse -8 -27 0.392778 0.296
NP_440138.1_6 Reverse -223 -242 5.50519 0.23
NP_439975.1_3 Forward -273 -260 16.8339 0.201
NP_441099.1_5 Forward -241 -222 -9.047 0.212
NP_441099.1_5 Reverse -3 -22 -10.3253 0.25
NP_441294.1_7 Forward -235 -221 10.6905 0.177
NP_442438.1_10 Forward -236 -222 2.85119 0.168
NP_442566.1_2 Forward -80 -61 1.0811 0.289
NP_441000.1_6 Forward -232 -218 -2.85201 0.221
NP_441000.1_6 Reverse -221 -235 -5.60527 0.285
NP_440605.1_4 Forward -241 -222 13.2796 0.25
NP_440147.1_4 Reverse -220 -233 10.344 0.0355
NP_440147.1_4 Forward -191 -178 5.82081 0.112
NP_440147.1_4 Reverse -125 -138 5.62415 0.119
NP_440147.1_4 Forward -233 -220 -0.275709 0.279
NP_441550.1_8 Reverse -220 -230 15.8108 0.0132
NP_441550.1_8 Forward -233 -223 13.5492 0.0238
NP_441550.1_8 Reverse -93 -103 9.616 0.0898
NP_441550.1_8 Forward -106 -96 8.04271 0.135
NP_441916.1_7 Forward -231 -221 10.6981 0.0261
NP_441916.1_7 Reverse -222 -232 0.963343 0.297
NP_441041.1_1 Forward -289 -270 6.68596 0.267
NP_441041.1_4 Forward -136 -117 -5.60541 0.155
NP_441041.1_4 Reverse -180 -199 -9.63698 0.219
NP_441041.1_7 Forward -25 -13 6.543 0.206
NP_441041.1_7 Forward -107 -95 5.6684 0.245
NP_441725.1_5 Reverse -223 -233 7.74818 0.0843
NP_441725.1_5 Forward -230 -220 1.94665 0.115
NP_439966.1_7 Reverse -220 -230 14.3359 0.0203
NP_439966.1_7 Forward -233 -223 12.2709 0.0464
NP_439966.1_7 Reverse -93 -103 4.69947 0.263
NP_439966.1_9 Forward -233 -224 9.14451 0.253
NP_442941.1_3 Forward -230 -220 19.2529 0.00262
NP_442941.1_3 Reverse -223 -233 1.55333 0.15
NP_442941.1_3 Reverse -14 -24 -0.314959 0.256
NP_441678.1_9 Forward -303 -284 -0.0988766 0.225
NP_441334.1_7 Forward -233 -214 -12.1936 0.142
NP_442256.1_2 Forward -233 -215 -9.32229 0.261
NP_001035871.2_7 Forward -128 -118 12.6647 0.262
NP_440437.1_1 Reverse -216 -235 5.70265 0.0851
NP_441087.1_6 Reverse -376 -394 0.411736 0.258
NP_441087.1_6 Forward -328 -310 -4.2098 0.297
NP_441644.1_6 Reverse -222 -232 14.9258 0.00847
NP_441644.1_6 Forward -231 -221 9.71433 0.0705
NP_441644.1_6 Reverse -282 -292 6.66608 0.152
NP_441644.1_6 Reverse -13 -23 3.12618 0.297
NP_443049.1_6 Forward -277 -267 11.0554 0.282
NP_443049.1_6 Reverse -320 -330 11.0554 0.282
NP_442215.1_2 Reverse -93 -109 -4.46469 0.233
NP_442215.1_2 Forward -138 -122 -7.51295 0.297
NP_442029.1_1 Forward -303 -284 -11.1119 0.229
NP_440929.1_8 Forward -231 -222 17.4043 0.00289
NP_440929.1_8 Reverse -222 -231 17.4043 0.00289
NP_442933.1_10 Reverse -222 -231 9.04618 0.063
NP_442933.1_10 Forward -231 -222 8.94785 0.0643
NP_441751.2_8 Forward -230 -216 -2.26202 0.132
NP_441751.2_8 Reverse -223 -237 -4.62196 0.176
NP_442554.1_8 Forward -230 -220 17.2863 0.00543
NP_442554.1_8 Reverse -223 -233 14.7297 0.0116
NP_442075.1_3 Forward -380 -361 15.6341 0.232
NP_442970.1_1 Reverse -306 -320 11.2797 0.269
NP_441762.1_7 Reverse -221 -233 -4.58258 0.179
NP_442142.1_4 Reverse -10 -23 4.34528 0.223
NP_442142.1_4 Forward -98 -85 3.06699 0.268
NP_442292.1_1 Reverse -223 -232 17.896 0.00435
NP_442292.1_1 Forward -230 -221 17.5026 0.00435
NP_440919.1_1 Reverse -32 -51 -7.57203 0.278
NP_442476.1_6 Forward -230 -216 8.45605 0.101
NP_443009.1_5 Reverse -221 -232 9.10461 0.0965
NP_443009.1_5 Reverse -23 -34 7.23633 0.135
NP_443009.1_5 Forward -232 -221 4.77807 0.23
NP_441715.1_4 Forward -230 -220 16.7946 0.0106
NP_441715.1_4 Reverse -14 -24 4.50326 0.27
NP_440357.1_3 Forward -106 -87 -1.27885 0.299
NP_440730.1_4 Forward -22 -3 -4.6221 0.298
NP_441468.1_1 Forward -230 -223 15.8704 0.0124
NP_441468.1_1 Reverse -223 -230 15.8704 0.0124
NP_441015.1_10 Forward -236 -217 -4.6221 0.209
NP_441673.1_1 Reverse -222 -231 11.1111 0.0121
NP_441673.1_1 Forward -231 -222 11.0128 0.018
NP_441339.1_1 Reverse -305 -324 13.8895 0.28
NP_441876.1_9 Reverse -373 -383 12.2709 0.267
NP_441826.1_2 Reverse -89 -103 -3.93365 0.29
NP_441826.1_2 Reverse -216 -230 -4.22864 0.293
NP_441826.1_2 Forward -237 -223 -4.7203 0.299
NP_442868.1_6 Reverse -220 -230 10.4031 0.038
NP_442868.1_6 Forward -233 -223 8.53483 0.0555
NP_442868.1_6 Reverse -11 -21 5.87989 0.136
NP_442719.1_2 Reverse -47 -65 -8.92966 0.258
NP_442719.1_2 Reverse -120 -138 -11.5846 0.292
NP_443058.1_7 Forward -96 -77 1.76941 0.294
NP_441101.1_2 Reverse -266 -285 16.4199 0.176
NP_442050.1_1 Forward -284 -265 9.3409 0.247
NP_442050.1_5 Reverse -220 -230 15.9091 0.0091
NP_442050.1_5 Forward -233 -223 15.0242 0.0169
NP_442688.1_4 Reverse -277 -296 10.8159 0.248
NP_441878.1_6 Reverse -221 -231 0.766681 0.134
NP_441878.1_6 Forward -232 -222 0.57002 0.14
NP_441878.1_6 Forward -137 -127 -6.90313 0.198
NP_441036.1_8 Forward -232 -222 7.35486 0.201
NP_441036.1_8 Reverse -221 -231 6.07655 0.242
NP_442650.1_2 Reverse -222 -236 4.52282 0.169
NP_442721.1_4 Reverse -346 -365 16.2241 0.291
NP_441557.1_5 Forward -231 -222 17.4043 0.0023
NP_441557.1_5 Reverse -222 -231 10.8161 0.00464
NP_441739.1_2 Reverse -127 -143 12.4475 0.132
NP_441381.1_6 Reverse -39 -58 12.4875 0.199
NP_442183.1_1 Reverse -222 -236 5.21113 0.226
NP_441574.1_1 Forward -280 -261 -0.295539 0.205
NP_441574.1_1 Forward -268 -249 -7.96535 0.3
NP_441549.1_9 Forward -235 -217 -5.88071 0.198
NP_442347.1_2 Reverse -223 -232 10.1278 0.0622
NP_442347.1_2 Forward -329 -320 8.35786 0.0927
NP_442347.1_2 Forward -230 -221 3.34298 0.284
NP_442347.1_10 Forward -194 -180 15.6336 0.224
NP_442645.1_2 Reverse -214 -233 -21.6334 0.29
NP_442645.1_2 Reverse -183 -202 -22.8133 0.296
NP_441037.1_4 Forward -233 -223 8.48718 0.237
NP_441037.1_4 Reverse -178 -188 8.29227 0.237
NP_441037.1_4 Reverse -220 -230 7.22024 0.237
NP_442594.1_8 Forward -292 -273 4.52268 0.26
NP_441633.1_3 Reverse -125 -138 0.117615 0.132
NP_441633.1_3 Reverse -220 -233 -3.71729 0.177
NP_441633.1_3 Forward -233 -220 -4.30728 0.191
NP_442764.1_8 Reverse -116 -135 8.25926 0.173
NP_440136.1_2 Forward -230 -223 15.9687 0.0123
NP_440136.1_2 Reverse -223 -230 15.9687 0.0123
NP_442998.1_5 Reverse -310 -320 9.81313 0.233
NP_442998.1_5 Reverse -107 -117 7.84651 0.28
NP_442998.1_5 Forward -139 -129 7.05986 0.3
NP_442998.1_10 Forward -229 -222 15.5754 0.0102
NP_442998.1_10 Reverse -224 -231 5.84064 0.235
NP_440299.1_1 Forward -235 -222 8.37683 0.0945
NP_441799.1_1 Reverse -218 -232 11.7003 0.054
NP_441799.1_1 Forward -235 -221 5.99717 0.187
NP_441799.1_1 Forward -140 -126 3.8339 0.279
NP_441007.1_10 Reverse -217 -230 1.10092 0.209
NP_441007.1_10 Forward -236 -223 1.10092 0.209
NP_441435.1_4 Reverse -261 -280 8.94757 0.255
NP_440256.1_1 Forward -234 -215 -7.96535 0.248
NP_441559.1_8 Forward -27 -13 1.08123 0.156
NP_441559.1_8 Reverse -19 -33 0.589577 0.165
NP_441559.1_8 Forward -37 -23 -2.85201 0.195
NP_441559.1_8 Reverse -122 -136 -4.81863 0.238
NP_441559.1_8 Reverse -8 -22 -7.08024 0.283
NP_440915.1_6 Reverse -218 -232 -1.77037 0.246
NP_441866.1_6 Reverse -39 -58 8.75009 0.253
NP_441464.1_8 Reverse -222 -236 11.7993 0.178
NP_441464.1_8 Reverse -127 -141 8.35772 0.198
NP_440695.1_2 Reverse -197 -216 14.3558 0.195
NP_440695.1_6 Reverse -127 -141 12.9322 0.248
NP_439985.1_7 Forward -237 -218 8.94757 0.18
NP_442993.1_1 Forward -124 -108 -13.1178 0.286
NP_442386.1_9 Forward -232 -223 12.5856 0.058
NP_442386.1_9 Reverse -221 -230 6.39082 0.219
NP_440570.1_5 Reverse -117 -136 -0.4922 0.262
NP_441750.1_1 Forward -289 -270 -9.047 0.3
NP_441340.1_5 Forward -230 -223 15.6737 0.0124
NP_441340.1_5 Reverse -223 -230 15.6737 0.0124
NP_442484.1_2 Reverse -327 -346 3.73603 0.197
NP_440168.1_9 Reverse -84 -103 -5.31042 0.296
NP_442240.1_2 Forward -230 -211 -10.522 0.137
NP_440161.1_3 Reverse -11 -30 9.3409 0.249
NP_440586.1_8 Forward -230 -223 13.2151 0.026
NP_440586.1_8 Reverse -223 -230 13.2151 0.026
NP_442251.1_4 Reverse -13 -32 19.8623 0.232
NP_442251.1_6 Forward -230 -223 15.2804 0.0124
NP_442251.1_6 Reverse -223 -230 15.2804 0.0124
NP_440192.1_4 Forward -35 -16 9.30058 0.279
NP_441262.1_3 Forward -231 -224 14.8871 0.0223
NP_441262.1_3 Reverse -222 -229 14.7888 0.0223
NP_441262.1_3 Forward -104 -97 5.15232 0.265
NP_440027.1_3 Reverse -212 -230 9.55647 0.184
NP_443051.1_1 Reverse -221 -230 19.5676 0.00335
NP_443051.1_1 Forward -232 -223 8.35786 0.0371
NP_443051.1_1 Forward -105 -96 3.34298 0.118
NP_443051.1_1 Forward -23 -14 -0.000272808 0.245
NP_439996.1_6 Forward -247 -228 6.26128 0.296
NP_439937.1_9 Reverse -73 -90 -11.4665 0.256
NP_439937.1_9 Reverse -221 -238 -14.4164 0.287
NP_442294.1_3 Reverse -363 -377 14.6503 0.222
NP_440439.1_1 Forward -234 -221 0.707601 0.179
NP_439943.1_7 Forward -236 -217 9.93088 0.168
NP_440372.1_2 Forward -230 -223 16.3621 0.0124
NP_440372.1_2 Reverse -223 -230 16.3621 0.0124
NP_440372.1_2 Forward -103 -96 4.07068 0.262
NP_440316.1_10 Forward -292 -282 8.33817 0.24
NP_440316.1_10 Forward -23 -13 5.48657 0.295
NP_440267.1_2 Reverse -262 -276 5.21053 0.276
NP_442384.1_10 Forward -231 -218 9.2624 0.0557
NP_442262.1_10 Forward -230 -223 14.1988 0.0123
NP_442262.1_10 Reverse -223 -230 14.1988 0.0123
NP_441689.1_5 Reverse -220 -230 8.3377 0.132
NP_440562.1_3 Forward -202 -185 2.89044 0.256
NP_440297.1_9 Reverse -223 -233 0.0783647 0.282
NP_440297.1_9 Forward -230 -220 -0.216628 0.282
NP_441592.1_4 Reverse -102 -121 4.81767 0.144
NP_441679.1_1 Forward -289 -270 8.35759 0.105
YP_680420.1_1 Forward -233 -214 15.9291 0.129
NP_440999.1_1 Forward -197 -178 2.35861 0.249
NP_440999.1_9 Forward -235 -221 -1.47537 0.239
NP_440888.1_2 Forward -231 -217 8.65209 0.152
NP_440888.1_2 Reverse -222 -236 7.57046 0.19
NP_440600.1_4 Forward -239 -221 5.72234 0.105
NP_440600.1_4 Reverse -214 -232 -5.58572 0.28
NP_442033.1_7 Forward -281 -262 16.5608 0.277
NP_442033.1_10 Forward -243 -224 -12.0953 0.261
NP_441543.1_2 Forward -230 -221 15.9293 0.00518
NP_441543.1_2 Reverse -223 -232 7.37455 0.127
NP_442845.1_2 Forward -117 -103 8.94771 0.183
NP_442845.1_2 Forward -237 -223 4.71948 0.254
NP_440089.1_1 Forward -299 -281 12.1139 0.3
NP_441551.1_5 Forward -235 -219 8.02265 0.241
NP_441469.1_8 Forward -232 -223 6.8829 0.227
NP_441469.1_8 Reverse -221 -230 6.5879 0.227
NP_442578.1_7 Forward -230 -223 14.5921 0.026
NP_442578.1_7 Reverse -223 -230 14.5921 0.026
NP_440710.1_1 Reverse -214 -232 16.7354 0.0374
NP_441462.1_2 Forward -231 -221 10.4031 0.011
NP_441462.1_2 Reverse -222 -232 2.7333 0.0792
NP_441621.1_7 Forward -233 -219 -4.4253 0.223
NP_443062.1_1 Forward -231 -213 17.4191 0.0254
NP_443062.1_6 Reverse -119 -138 5.99764 0.191
NP_443062.1_6 Reverse -16 -35 4.71934 0.214
NP_440519.1_6 Reverse -8 -22 10.4227 0.29
NP_442204.1_1 Reverse -218 -229 1.92696 0.266
NP_440516.1_8 Reverse -222 -231 9.53783 0.0136
NP_440516.1_8 Forward -231 -222 7.07956 0.0867
NP_440516.1_8 Forward -104 -95 -0.590259 0.283
NP_440516.1_8 Forward -22 -13 -0.590259 0.283
NP_442428.1_5 Forward -230 -223 15.8704 0.0124
NP_442428.1_5 Reverse -223 -230 15.8704 0.0124
NP_441443.1_7 Forward -286 -267 -0.885524 0.248
NP_440673.1_3 Forward -229 -222 12.4288 0.0426
NP_440673.1_3 Reverse -224 -231 5.34899 0.298
NP_441052.1_2 Reverse -222 -232 10.2065 0.0295
NP_441052.1_2 Forward -231 -221 1.84832 0.225
NP_442219.1_9 Reverse -223 -232 10.2261 0.0547
NP_442219.1_9 Forward -230 -221 8.25953 0.0681
NP_442219.1_9 Forward -329 -320 2.35967 0.28
NP_440436.1_4 Forward -230 -221 9.24241 0.0871
NP_440436.1_4 Reverse -223 -232 8.06244 0.118
NP_440436.1_4 Forward -199 -190 6.78414 0.147
NP_441884.1_9 Forward -107 -88 -14.7502 0.138
NP_441719.1_4 Forward -230 -223 16.3621 0.0124
NP_441719.1_4 Reverse -223 -230 16.3621 0.0124
NP_441004.1_1 Forward -289 -270 -7.67036 0.199
NP_441004.1_1 Forward -142 -123 -9.047 0.206
NP_441004.1_1 Reverse -174 -193 -10.9153 0.229
NP_441004.1_5 Forward -305 -291 10.226 0.248
NP_440296.1_10 Reverse -177 -196 -6.09707 0.225
NP_441115.1_4 Reverse -221 -239 8.47483 0.247
NP_442854.1_6 Forward -231 -212 2.75272 0.272
NP_442586.1_9 Reverse -180 -199 14.2574 0.264
NP_441851.1_5 Reverse -74 -93 10.5209 0.23
NP_441851.1_10 Forward -232 -222 14.238 0.0196
NP_441851.1_10 Reverse -221 -231 8.33817 0.118
NP_442515.1_1 Reverse -221 -235 8.84938 0.0698
NP_442515.1_1 Reverse -126 -140 2.2612 0.14
NP_442515.1_1 Reverse -107 -121 -3.44199 0.29
NP_442709.1_6 Reverse -149 -168 15.1424 0.219
NP_442689.1_8 Reverse -48 -65 -2.22277 0.235
NP_441349.1_10 Forward -241 -222 1.17943 0.0845
NP_441409.1_6 Reverse -7 -26 3.93269 0.0422
NP_440432.1_9 Forward -230 -215 10.993 0.0364
NP_442843.1_1 Forward -103 -84 -10.0303 0.274
NP_440474.1_8 Reverse -223 -237 10.8154 0.126
NP_442006.1_2 Forward -292 -275 -9.3026 0.197
NP_442243.1_1 Forward -226 -208 -3.22649 0.299
NP_441570.1_1 Forward -231 -213 -6.66736 0.0813
NP_441570.1_1 Reverse -222 -240 -15.9105 0.236
NP_441078.1_4 Reverse -222 -231 9.93116 0.0203
NP_441078.1_4 Forward -231 -222 9.83282 0.0226
NP_442388.1_4 Reverse -117 -136 17.1082 0.197
NP_441539.1_1 Forward -213 -199 10.8154 0.294
NP_440707.1_9 Forward -279 -260 7.86593 0.219
NP_442443.1_1 Forward -279 -260 -5.80207 0.285
NP_440526.1_3 Reverse -223 -234 9.10461 0.0988
NP_441432.1_8 Reverse -221 -230 16.8143 0.00595
NP_441432.1_8 Forward -23 -14 8.1612 0.0815
NP_441432.1_8 Forward -232 -223 6.98123 0.112
NP_441732.1_2 Reverse -218 -234 -5.84132 0.0495
NP_441732.1_2 Reverse -123 -139 -16.4611 0.167
NP_440497.1_6 Forward -100 -81 10.2259 0.227
NP_442815.1_1 Forward -153 -134 11.3075 0.115
NP_440760.1_1 Forward -231 -212 -12.2919 0.0927
NP_441945.1_10 Forward -281 -262 12.8808 0.203
NP_440713.1_4 Forward -241 -222 5.01433 0.218
NP_442489.1_1 Reverse -138 -157 15.3382 0.292
NP_442489.1_7 Reverse -222 -231 10.4228 0.0151
NP_442489.1_7 Forward -231 -222 10.3245 0.0193
NP_442489.1_7 Forward -136 -127 -1.86856 0.259
NP_442489.1_7 Forward -22 -13 -1.86856 0.259
NP_442489.1_7 Reverse -127 -136 -1.96689 0.28
NP_442489.1_7 Reverse -13 -22 -1.96689 0.28
NP_441830.1_2 Reverse -58 -77 -4.72043 0.275
NP_440559.1_1 Reverse -223 -232 16.5193 0.00851
NP_440559.1_1 Forward -230 -221 8.65285 0.0586
NP_441659.2_8 Reverse -222 -232 14.828 0.00801
NP_441659.2_8 Forward -231 -221 11.3864 0.0184
NP_442749.1_8 Reverse -355 -373 15.3588 0.167
NP_442913.1_10 Reverse -213 -232 -0.885524 0.165
NP_440442.1_6 Reverse -373 -387 22.32 0.0127
NP_442776.1_1 Reverse -211 -230 5.30933 0.252
NP_442346.1_5 Reverse -221 -231 15.0247 0.00889
NP_442346.1_5 Forward -232 -222 7.25653 0.176
NP_440352.1_5 Forward -148 -129 13.3371 0.193
NP_440545.1_3 Forward -235 -218 9.47861 0.0393
NP_440545.1_3 Reverse -123 -140 -6.15601 0.27
NP_440486.1_6 Forward -298 -279 12.2908 0.207
NP_440010.1_10 Forward -295 -276 1.86774 0.292
NP_442603.1_7 Forward -104 -90 6.19383 0.253
NP_441585.1_5 Reverse -120 -139 4.12856 0.245
NP_441833.1_4 Forward -230 -223 15.9687 0.0124
NP_441833.1_4 Reverse -223 -230 15.9687 0.0124
NP_441329.1_6 Forward -66 -47 -3.10391 0.296
NP_441895.1_10 Forward -143 -124 -18.4868 0.282
NP_442162.1_9 Forward -230 -223 16.2637 0.0124
NP_442162.1_9 Reverse -223 -230 16.2637 0.0124
NP_442140.1_3 Reverse -223 -233 14.533 0.0486
NP_442140.1_3 Reverse -192 -202 4.99491 0.232
NP_442140.1_3 Forward -230 -220 4.69992 0.238
NP_442021.1_2 Forward -288 -269 8.65258 0.27
NP_440875.1_9 Forward -229 -219 7.69067 0.255
NP_441813.1_5 Reverse -220 -230 18.1713 0.00743
NP_441813.1_5 Forward -233 -223 7.94484 0.0517
NP_440594.1_8 Forward -230 -217 11.7201 0.152
NP_440590.1_4 Reverse -223 -236 3.75586 0.0686
NP_440590.1_4 Forward -230 -217 1.29759 0.127
NP_440567.1_1 Forward -230 -216 1.17956 0.214
NP_442497.1_10 Forward -230 -221 17.601 0.00813
NP_442497.1_10 Reverse -223 -232 8.55452 0.0294
NP_440821.1_4 Forward -233 -223 17.3846 0.0067
NP_440821.1_4 Reverse -220 -230 2.24165 0.131
NP_441239.1_9 Reverse -220 -232 8.88877 0.12
NP_441239.1_9 Forward -233 -221 7.11881 0.169
NP_441239.1_9 Reverse -84 -96 4.5622 0.251
NP_442082.1_8 Forward -340 -321 15.0441 0.228
NP_442629.1_5 Forward -386 -372 15.0442 0.279
NP_441874.1_1 Forward -295 -281 9.63603 0.277
NP_440876.1_5 Forward -229 -210 5.89931 0.283
NP_440354.1_5 Forward -192 -173 2.26107 0.264
NP_440546.1_4 Reverse -191 -201 8.39772 0.192
NP_440546.1_4 Forward -111 -101 7.81598 0.22
NP_441656.1_6 Forward -101 -82 5.60432 0.289
NP_440462.1_6 Reverse -220 -230 18.7612 0.00454
NP_440462.1_6 Forward -233 -223 1.65166 0.294
NP_440868.1_4 Forward -235 -223 8.6921 0.0582
NP_440868.1_4 Reverse -218 -230 8.00379 0.0602
NP_440868.1_4 Reverse -91 -103 1.12062 0.192
NP_441249.1_1 Reverse -358 -377 3.14605 0.197
NP_442402.1_4 Reverse -247 -266 9.24175 0.111
NP_442402.1_4 Reverse -259 -278 -0.00131823 0.186
NP_442402.1_4 Reverse -268 -287 -5.21283 0.238
NP_442402.1_4 Forward -327 -308 -9.14605 0.285
NP_442402.1_10 Reverse -131 -141 14.0409 0.182
NP_442402.1_10 Reverse -256 -266 12.8609 0.204
NP_442402.1_10 Reverse -130 -140 12.3692 0.212
NP_441848.1_4 Forward -63 -47 10.7974 0.241
NP_440653.1_10 Forward -346 -327 8.55425 0.198
NP_440696.1_3 Forward -231 -213 5.23069 0.198
NP_442039.1_4 Forward -230 -223 15.1821 0.0124
NP_442039.1_4 Reverse -223 -230 15.1821 0.0124
NP_442039.1_7 Forward -143 -133 8.23984 0.264
NP_441811.1_8 Forward -237 -223 6.6861 0.265
NP_442829.1_2 Forward -63 -47 9.68723 0.287
NP_441926.1_3 Reverse -13 -29 5.17175 0.174
NP_441926.1_3 Forward -231 -215 3.59845 0.215
NP_440825.1_7 Reverse -223 -233 13.3 0.152
NP_440825.1_7 Reverse -96 -106 13.0072 0.152
NP_442837.1_3 Forward -230 -223 15.7721 0.0124
NP_442837.1_3 Reverse -223 -230 15.7721 0.0124
NP_442837.1_3 Forward -329 -322 6.52896 0.2
NP_440160.1_1 Forward -64 -45 10.0549 0.249
NP_442053.1_1 Reverse -222 -231 9.34117 0.0666
NP_442053.1_1 Forward -231 -222 8.84951 0.072
NP_440505.1_3 Reverse -220 -230 17.188 0.00332
NP_440505.1_3 Forward -24 -14 12.4681 0.0506
NP_440505.1_3 Forward -233 -223 6.76487 0.169
NP_442532.1_7 Reverse -222 -236 5.40779 0.171
NP_440914.1_1 Reverse -222 -232 15.3489 0.00527
NP_440914.1_1 Forward -231 -221 7.24882 0.242
NP_441011.1_8 Forward -230 -221 16.6177 0.00602
NP_442533.1_1 Forward -301 -282 -17.1101 0.281
NP_442533.1_6 Reverse -222 -231 7.86621 0.0862
NP_442533.1_6 Forward -231 -222 7.37455 0.0898
NP_442533.1_6 Reverse -102 -111 1.76968 0.289
NP_442232.1_3 Forward -239 -220 -4.6221 0.163
NP_441482.1_7 Reverse -216 -230 4.81781 0.0442
NP_439944.1_9 Reverse -223 -233 16.893 0.00735
NP_439944.1_9 Forward -230 -220 9.12481 0.1
NP_439944.1_10 Forward -135 -116 10.9142 0.28
NP_442269.1_10 Forward -303 -284 8.75091 0.194
NP_441028.1_6 Reverse -372 -382 13.5492 0.158
NP_441028.1_6 Forward -42 -32 3.42118 0.296
NP_442664.1_8 Reverse -129 -148 12.585 0.233
NP_440116.1_8 Forward -230 -211 -1.47551 0.12
NP_440115.1_6 Forward -234 -224 8.73149 0.128
NP_440115.1_6 Reverse -219 -229 4.79825 0.282
NP_440007.1_9 Reverse -218 -232 7.86607 0.195
NP_441059.1_2 Forward -284 -265 6.78429 0.126
NP_441106.1_1 Reverse -221 -230 18.486 0.0028
NP_442588.1_6 Reverse -183 -202 -1.37718 0.268
NP_442306.1_10 Reverse -217 -236 -20.3551 0.208
NP_441286.1_1 Forward -232 -220 4.66053 0.031
NP_441286.1_1 Reverse -221 -233 3.08724 0.05
NP_441286.1_1 Reverse -126 -138 -5.17256 0.192
NP_442674.1_10 Forward -138 -119 10.5209 0.241
NP_440670.1_8 Reverse -222 -231 16.3227 0.00291
NP_440670.1_8 Forward -231 -222 15.1427 0.00768
NP_440670.1_8 Forward -189 -180 3.14632 0.296
NP_441705.1_3 Forward -152 -133 -4.91709 0.291
NP_442614.1_2 Reverse -222 -236 8.75105 0.248
NP_442717.1_2 Forward -135 -116 -9.44032 0.29
NP_440205.1_3 Reverse -58 -77 4.62101 0.282
NP_442072.1_9 Forward -232 -214 -13.5505 0.115
NP_440513.1_4 Forward -104 -85 17.0107 0.19
NP_442401.1_4 Forward -117 -107 15.7134 0.263
NP_440028.1_6 Forward -282 -264 14.2771 0.218
NP_440028.1_6 Forward -135 -117 14.0805 0.218
NP_440907.2_8 Forward -230 -220 9.616 0.103
NP_440907.2_8 Reverse -223 -233 9.02601 0.116
NP_439967.1_7 Forward -232 -214 9.85225 0.237
NP_441021.1_1 Reverse -223 -242 -9.83364 0.223
NP_441463.1_3 Forward -241 -222 -0.295539 0.132
NP_441463.1_5 Reverse -221 -235 11.0127 0.249
NP_441626.1_2 Forward -230 -223 15.7721 0.0124
NP_441626.1_2 Reverse -223 -230 15.7721 0.0124
NP_439958.1_5 Forward -133 -114 12.8808 0.288
NP_442615.1_1 Forward -240 -222 -7.25734 0.283
NP_440387.1_1 Forward -231 -215 -2.49807 0.148
NP_441488.1_8 Forward -109 -95 13.8636 0.146
NP_441488.1_8 Forward -194 -180 7.96378 0.214
NP_441993.1_1 Forward -237 -218 1.94669 0.267
NP_442805.1_5 Reverse -117 -136 -4.32786 0.266
NP_440114.1_5 Forward -290 -271 7.47261 0.291
NP_440114.1_10 Forward -231 -217 5.89945 0.292
NP_442437.1_8 Forward -242 -223 4.22769 0.264
NP_442698.1_10 Forward -143 -124 3.6377 0.279
NP_441237.1_9 Reverse -223 -233 14.4347 0.0376
NP_439998.1_6 Reverse -277 -296 16.7149 0.19
NP_440457.1_1 Reverse -218 -230 8.9871 0.0988
NP_440798.1_6 Forward -230 -217 3.65753 0.15
NP_440798.1_6 Reverse -223 -236 3.06754 0.153
NP_441801.1_4 Reverse -149 -159 3.02829 0.231
NP_441332.1_6 Reverse -376 -386 12.4212 0.23
NP_441436.1_8 Forward -285 -266 6.78429 0.297
NP_440473.1_1 Reverse -138 -157 11.643 0.267
NP_442509.1_9 Reverse -95 -105 7.0594 0.24
NP_442514.1_5 Forward -227 -208 -8.06442 0.284
NP_440554.1_4 Forward -230 -220 17.9746 0.0131
NP_440554.1_4 Reverse -223 -233 7.64985 0.101
NP_442862.1_3 Forward -135 -118 5.64371 0.268
NP_442862.1_3 Reverse -305 -322 5.05372 0.28
NP_441885.1_5 Reverse -222 -232 11.7798 0.00668
NP_441885.1_5 Forward -231 -221 1.55333 0.109
NP_442228.1_3 Reverse -272 -291 -1.18052 0.139
NP_442341.1_7 Reverse -126 -140 1.76955 0.281
NP_441173.1_9 Forward -316 -308 12.2121 0.21
NP_441173.1_9 Reverse -133 -141 11.3271 0.226
NP_441173.1_9 Reverse -132 -140 11.3271 0.226
NP_441173.1_9 Forward -315 -307 9.75379 0.284
NP_440750.1_4 Forward -379 -360 7.66927 0.29
NP_440423.1_6 Forward -394 -375 -21.24 0.284
NP_443000.1_7 Reverse -220 -230 20.3345 0.00223
NP_443000.1_7 Forward -233 -223 1.35667 0.251
NP_443000.1_7 Forward -24 -14 0.766681 0.29
NP_440076.1_9 Reverse -75 -88 22.5364 0.071
NP_440275.1_3 Forward -233 -223 17.7779 0.0102
NP_440275.1_3 Reverse -220 -230 16.1063 0.0155
NP_442932.1_9 Forward -142 -123 3.73603 0.294
NP_440091.1_1 Forward -235 -223 15.5753 0.018
NP_440175.1_10 Reverse -272 -291 10.2259 0.269
NP_440149.1_8 Forward -136 -117 -4.72043 0.213
NP_441105.1_3 Reverse -327 -346 -7.57203 0.255
NP_442373.1_2 Forward -280 -261 -6.29373 0.227
NP_440216.1_1 Forward -231 -217 16.1259 0.00307
NP_440216.1_1 Reverse -222 -236 -11.2101 0.169
NP_440172.1_1 Forward -22 -12 9.7148 0.0586
NP_440172.1_1 Reverse -222 -232 8.4365 0.0621
NP_440172.1_1 Reverse -127 -137 8.1415 0.0678
NP_440172.1_1 Forward -231 -221 7.74818 0.0738
NP_442015.1_3 Reverse -333 -352 11.2084 0.288
NP_442015.1_10 Forward -235 -222 5.13249 0.15
NP_442015.1_10 Reverse -285 -298 0.510939 0.224
NP_441226.1_7 Forward -230 -223 14.4934 0.0123
NP_441226.1_7 Reverse -223 -230 14.4934 0.0123
NP_441111.1_7 Forward -230 -222 18.7023 0.00294
NP_441111.1_7 Reverse -223 -231 8.96754 0.0463
NP_441766.1_2 Forward -231 -222 16.2243 0.0047
NP_441766.1_2 Reverse -222 -231 9.14451 0.0337
NP_443052.1_8 Forward -275 -256 -13.5702 0.29
NP_443052.1_9 Reverse -261 -280 -4.52377 0.258
NP_440072.1_5 Reverse -185 -203 -4.11075 0.292
NP_440591.1_9 Forward -238 -220 12.9005 0.0931
NP_442154.1_1 Forward -279 -261 -5.88071 0.127
NP_442154.1_1 Forward -156 -138 -19.1554 0.291
NP_440261.1_5 Forward -230 -217 -2.73398 0.0924
NP_440261.1_5 Reverse -223 -236 -4.89726 0.178
NP_440261.1_5 Reverse -128 -141 -4.89726 0.178
NP_440988.1_5 Reverse -124 -143 13.2508 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTACAGGGTAAAGTACGACGGGGGGCAAAATATCAACGCTCCTTAGATGTGTTGCGCTGGATAAAGGAATTTGATCCCGACATTTTCACCAAATCTGGGTTGATGTTGGGCCACGGGGAAACGGTGGATGAAGTGGTGGAAACCCTCAAGGATTTGCGCTCTGTAGGTTGCGATCGCCTGACGTTGGGACAATATATGCAACCATCCCTAGACCATCTGCCCGTGCAAAAATATTGGACTCCAGAGGAGTTTGATCAGTTGGGGGAAATTGCCAAGGATTTGGGTTTTAGCCATGTGCGATCAGGACCATTGGTGCGGAGTTCCTACCATGCCGGGGAAGATTAGCAAAAATAATGATTGACTCCCAGGAATTACCAGGCAATTGCGAGGAAATGAAGG

CDS

GTGAAAATTGATGTTGACTATGCCATTGCTCAATATGCCCAGGGTCTATTTTTAATGGCCGACGACCGCCATGGATTGGGCTGGTATTCCAGCGATCGCCATGCCCTAATTCCCCTGGATGATCAATTTCGTTATCCCAAATCTTTGCAACGGGTGCTCAATCAAAATCGTTTCCAAGTCAAAATTAATCAAGCTTTCACCGCCGTTTGTGAAGGGTGTGCCGCTCGCCCTGAAACTTGGATTTCTCAAGAATTAATTGAGGTTTACCATACTTTTCATGTGGCTGGTTGGGCCCACAGCTTTGAAACTTGGCATGGCGATCGCCTAGCAGGGGGAATTTTAGGCATTGCCATCCGGGGGGCTTTCATTGGAGAATCGATGTTTTATACCATTCCTGAAGCTTCCAAAGTTGCCATGGTTAAACTGGTGCAACATCTACGACAACGGAGCTATCAATTATTTGATGCCCAGCTACAAAATCCCCATCTAAAACGGTTTGGTGCCTACGAAGTGGAAGAAAAGGCCTATAAAAAGCAATTAGAAAAAGCGCTCAATTATCGTTGTCACTTTACTTCTGAACCTGATCTTTATGATTAG

Protein

MKIDVDYAIAQYAQGLFLMADDRHGLGWYSSDRHALIPLDDQFRYPKSLQRVLNQNRFQVKINQAFTAVCEGCAARPETWISQELIEVYHTFHVAGWAHSFETWHGDRLAGGILGIAIRGAFIGESMFYTIPEASKVAMVKLVQHLRQRSYQLFDAQLQNPHLKRFGAYEVEEKAYKKQLEKALNYRCHFTSEPDLYD