Your browser is old and dusty. Try Google Chrome!

Details for sll0868

ORF sll0868
Accession NP_440932.1
Symbol
Category Lipoate
Definition lipoic acid synthetase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -52 -38 11.8976 0.0505
NP_441061.1_2 Reverse -45 -59 2.16287 0.178
NP_440795.1_7 Forward -52 -45 14.6904 0.0123
NP_440795.1_7 Reverse -45 -52 14.6904 0.0123
NP_440694.1_6 Reverse -224 -243 8.35759 0.22
NP_441418.1_6 Reverse -44 -63 -11.9969 0.0586
NP_441418.1_6 Forward -291 -272 -22.8133 0.186
NP_441418.1_6 Forward -53 -34 -29.8932 0.245
NP_441480.1_5 Reverse -251 -270 9.3409 0.299
NP_442291.1_5 Forward -54 -38 -3.77637 0.252
NP_441453.1_4 Reverse -44 -52 16.539 0.00633
NP_441453.1_4 Forward -53 -45 16.539 0.00633
NP_441453.1_7 Forward -389 -382 12.9205 0.23
NP_442151.1_1 Forward -293 -274 9.3409 0.265
NP_442151.1_6 Forward -53 -39 13.2743 0.0554
NP_442151.1_6 Reverse -44 -58 10.4227 0.123
NP_441818.1_1 Forward -52 -41 10.1862 0.232
NP_441818.1_6 Forward -289 -275 11.3077 0.253
NP_440226.1_1 Forward -53 -34 8.55425 0.0849
NP_441465.1_8 Reverse -278 -296 7.68896 0.235
NP_441098.1_3 Reverse -361 -380 -4.01355 0.28
NP_442173.1_1 Forward -52 -44 15.4574 0.00633
NP_442173.1_1 Reverse -45 -53 15.4574 0.00633
NP_442752.1_4 Forward -53 -46 13.8055 0.0199
NP_442752.1_4 Reverse -44 -51 13.8055 0.0199
NP_443027.1_4 Forward -55 -45 14.828 0.0437
NP_443027.1_4 Reverse -42 -52 14.0414 0.0452
NP_441812.1_3 Forward -48 -34 9.83269 0.228
NP_441812.1_3 Reverse -43 -57 8.06273 0.254
NP_441812.1_3 Forward -54 -40 6.88276 0.287
NP_442975.1_10 Forward -57 -43 14.0603 0.0459
NP_442975.1_10 Forward -144 -130 1.86729 0.29
NP_440784.1_7 Forward -52 -45 15.9687 0.0123
NP_440784.1_7 Reverse -45 -52 15.9687 0.0123
NP_442909.1_7 Forward -52 -38 15.0436 0.117
NP_440061.1_9 Forward -55 -41 9.43874 0.145
NP_440110.1_8 Reverse -42 -61 0.58944 0.211
NP_441145.1_1 Reverse -272 -291 4.32602 0.265
NP_442062.1_8 Reverse -44 -54 19.4496 0.000558
NP_442062.1_8 Forward -53 -43 17.3846 0.00193
NP_442062.1_8 Reverse -282 -292 3.12662 0.285
NP_440761.1_4 Reverse -39 -58 -13.5702 0.257
NP_441900.1_2 Reverse -312 -330 -0.276578 0.266
NP_441859.1_3 Reverse -272 -291 4.32522 0.226
NP_441859.1_5 Forward -126 -107 0.786102 0.3
NP_440304.1_4 Forward -55 -45 10.8948 0.051
NP_440304.1_4 Reverse -42 -52 10.8948 0.051
NP_440304.1_4 Forward -293 -283 5.97822 0.185
NP_442242.1_4 Forward -52 -45 14.3954 0.0124
NP_442242.1_4 Reverse -45 -52 14.3954 0.0124
NP_440044.1_8 Forward -52 -33 -1.67217 0.248
NP_440044.1_8 Forward -235 -216 -2.65548 0.265
NP_440916.1_1 Reverse -87 -101 13.0776 0.206
NP_441208.1_1 Reverse -209 -228 -6.58872 0.287
NP_441208.1_9 Reverse -41 -55 5.80112 0.262
NP_441594.1_6 Forward -62 -43 1.27776 0.269
NP_440370.1_10 Reverse -35 -54 21.1406 0.0308
NP_442110.1_7 Reverse -44 -58 12.3893 0.0586
NP_442110.1_7 Forward -53 -39 9.63603 0.0715
NP_441083.1_5 Forward -53 -43 20.3345 0.00053
NP_441083.1_5 Reverse -44 -54 11.3864 0.0159
NP_441083.1_5 Forward -210 -200 5.38824 0.12
NP_442827.1_8 Forward -55 -36 2.45694 0.159
NP_442827.1_8 Forward -61 -42 -2.8529 0.29
NP_441434.1_1 Forward -95 -81 7.93745 0.26
NP_441738.1_2 Forward -51 -44 15.28 0.0102
NP_441738.1_2 Reverse -46 -53 15.28 0.0102
NP_440209.1_1 Reverse -44 -52 18.1123 0.00295
NP_440209.1_1 Forward -53 -45 18.1123 0.00295
NP_440655.1_2 Forward -281 -262 1.0811 0.293
NP_442889.1_8 Forward -56 -42 11.897 0.0729
NP_440447.1_1 Forward -58 -40 3.85406 0.245
NP_440447.1_5 Reverse -379 -389 14.4347 0.277
NP_441713.1_1 Reverse -38 -57 -15.4385 0.263
NP_440178.1_7 Forward -54 -35 -3.93378 0.0516
NP_440178.1_7 Reverse -111 -130 -23.1083 0.294
NP_440178.1_7 Reverse -43 -62 -23.2067 0.298
NP_442706.1_5 Forward -377 -358 15.5543 0.245
NP_441716.1_1 Forward -53 -39 4.52282 0.255
NP_441716.1_1 Reverse -44 -58 3.73617 0.259
NP_443013.1_3 Forward -115 -96 3.24438 0.297
NP_442111.1_4 Reverse -43 -57 19.6658 0.00373
NP_441163.1_1 Forward -61 -44 9.18288 0.226
NP_440906.1_5 Forward -52 -45 15.8704 0.0124
NP_440906.1_5 Reverse -45 -52 15.8704 0.0124
NP_440438.2_8 Forward -99 -80 2.45773 0.262
NP_440747.1_10 Reverse -41 -53 17.2469 0.000522
NP_440747.1_10 Forward -56 -44 7.70879 0.00236
NP_442973.1_5 Forward -62 -43 11.2092 0.251
NP_441486.1_1 Forward -56 -42 11.2093 0.0168
NP_441486.1_1 Reverse -41 -55 10.9143 0.018
NP_442634.1_4 Forward -55 -41 -1.5737 0.149
NP_442634.1_4 Reverse -42 -56 -1.5737 0.149
NP_440403.1_4 Reverse -273 -292 -8.85033 0.261
NP_441014.1_8 Forward -272 -253 18.6823 0.0335
NP_441014.1_8 Forward -280 -261 -9.63698 0.299
NP_441014.1_10 Forward -54 -35 2.85027 0.216
NP_441014.1_10 Reverse -239 -258 -2.06626 0.27
NP_442848.1_1 Reverse -38 -52 7.37441 0.0791
NP_442848.1_1 Forward -59 -45 -0.983719 0.263
NP_442848.1_4 Forward -276 -262 5.30946 0.299
NP_441012.1_4 Reverse -275 -288 14.7689 0.198
NP_441012.1_4 Forward -57 -44 7.19745 0.272
NP_441012.1_4 Forward -51 -38 5.52582 0.294
NP_443018.1_3 Forward -52 -45 14.8871 0.0123
NP_443018.1_3 Reverse -45 -52 14.8871 0.0123
NP_443018.1_3 Reverse -283 -290 10.7572 0.0907
NP_443018.1_3 Forward -290 -283 4.56234 0.241
NP_441316.1_7 Forward -55 -40 6.37141 0.107
NP_441634.1_8 Reverse -42 -56 3.63784 0.145
NP_441634.1_8 Forward -293 -279 -2.65535 0.295
NP_441634.1_8 Reverse -199 -213 -4.13031 0.295
NP_440376.1_1 Forward -53 -44 19.4693 0.000692
NP_440376.1_1 Reverse -44 -53 19.4693 0.000692
NP_440376.1_1 Reverse -386 -395 -0.491928 0.29
NP_442730.1_8 Forward -61 -42 6.98015 0.219
NP_442687.1_7 Forward -54 -44 15.8113 0.0125
NP_442687.1_7 Reverse -43 -53 8.92815 0.0994
NP_442687.1_7 Forward -267 -257 4.3066 0.255
NP_442191.1_4 Reverse -45 -59 16.4227 0.0378
NP_441077.1_6 Forward -95 -79 9.93598 0.164
NP_442485.1_3 Reverse -33 -52 -4.52377 0.282
NP_442485.1_3 Forward -247 -228 -6.1954 0.299
NP_441013.1_2 Forward -58 -40 5.03403 0.222
NP_441422.1_7 Forward -55 -38 7.61033 0.0992
NP_441950.1_8 Forward -286 -272 14.9459 0.11
NP_442658.1_1 Forward -55 -45 15.9091 0.00966
NP_442658.1_1 Forward -293 -283 12.3692 0.0569
NP_442658.1_1 Reverse -42 -52 6.76441 0.214
NP_442198.1_7 Reverse -279 -298 23.2047 0.0307
NP_442198.1_7 Forward -285 -266 8.65176 0.291
NP_440141.1_8 Forward -300 -281 9.63589 0.214
NP_440662.1_2 Forward -151 -132 2.65439 0.19
NP_442782.1_2 Reverse -44 -58 7.57108 0.202
NP_442782.1_2 Forward -242 -228 0.491246 0.289
NP_442544.1_2 Forward -299 -285 -1.5737 0.287
NP_441414.1_9 Forward -53 -34 0.0977854 0.0851
NP_441414.1_9 Reverse -44 -63 -4.42544 0.153
NP_441414.1_9 Forward -210 -191 -6.29373 0.192
NP_441487.1_6 Forward -386 -367 3.04771 0.254
NP_441478.1_3 Reverse -380 -399 14.8474 0.138
NP_442937.1_5 Forward -235 -216 5.89931 0.295
NP_441958.1_5 Forward -54 -44 12.2714 0.00183
NP_441958.1_5 Reverse -43 -53 12.2714 0.00183
NP_441127.1_1 Forward -291 -277 16.3225 0.1
NP_441127.1_1 Reverse -330 -344 8.65272 0.288
NP_440203.1_5 Forward -50 -40 13.3526 0.116
NP_439905.1_1 Forward -209 -196 7.39411 0.262
NP_440984.1_7 Reverse -196 -210 8.45605 0.144
NP_439990.1_5 Reverse -39 -52 7.98409 0.183
NP_442690.1_1 Forward -351 -332 -16.3235 0.287
NP_442911.1_2 Forward -63 -44 5.50599 0.0332
NP_442911.1_2 Reverse -34 -53 2.94938 0.0472
NP_440153.1_5 Reverse -45 -59 10.4227 0.0989
NP_442064.1_1 Reverse -39 -58 -13.3736 0.285
NP_443055.1_3 Reverse -274 -293 12.555 0.21
NP_440993.1_2 Reverse -268 -284 2.12349 0.269
NP_440496.1_6 Reverse -336 -355 6.39097 0.281
NP_442002.1_9 Forward -54 -47 10.7572 0.185
NP_442438.1_10 Forward -58 -44 19.0758 0.0137
NP_442438.1_10 Reverse -39 -53 11.3077 0.0463
NP_442771.1_1 Reverse -42 -60 -8.83064 0.208
NP_442771.1_1 Reverse -132 -150 -10.4039 0.258
NP_440147.1_4 Forward -55 -42 3.36254 0.188
NP_440147.1_4 Reverse -116 -129 1.49425 0.226
NP_440147.1_4 Reverse -42 -55 0.805932 0.244
NP_440147.1_4 Forward -293 -280 -0.275709 0.279
NP_441550.1_8 Reverse -42 -52 12.3692 0.0336
NP_441550.1_8 Forward -212 -202 7.74772 0.149
NP_441550.1_8 Forward -55 -45 6.0761 0.214
NP_441916.1_7 Reverse -44 -54 18.4663 0.00144
NP_441916.1_7 Forward -53 -43 10.3048 0.0261
NP_440206.1_9 Reverse -380 -399 9.3409 0.272
NP_440465.1_10 Reverse -270 -289 5.80098 0.211
NP_441041.1_4 Forward -53 -34 14.5524 0.0188
NP_441041.1_4 Reverse -44 -63 -0.000545616 0.0918
NP_441041.1_7 Forward -56 -44 7.61196 0.162
NP_442396.1_5 Reverse -40 -53 9.06573 0.134
NP_443063.1_2 Forward -314 -295 5.60432 0.286
NP_442004.1_6 Forward -53 -39 17.0108 0.0577
NP_441725.1_5 Forward -52 -42 11.2881 0.0247
NP_441725.1_5 Reverse -45 -55 11.2881 0.0247
NP_441725.1_5 Reverse -283 -293 7.64985 0.0904
NP_439966.1_7 Forward -55 -45 18.4657 0.00473
NP_439966.1_7 Reverse -42 -52 15.8108 0.0124
NP_439966.1_7 Reverse -280 -290 4.69947 0.263
NP_439966.1_9 Reverse -280 -289 6.98123 0.253
NP_439966.1_9 Forward -55 -46 0.983037 0.253
NP_440202.1_8 Reverse -274 -293 11.3625 0.282
NP_442941.1_3 Forward -52 -42 19.9412 0.00262
NP_442941.1_3 Reverse -45 -55 11.4848 0.0116
NP_440289.1_2 Forward -56 -43 11.819 0.0171
NP_440289.1_2 Reverse -41 -54 -2.93064 0.262
NP_441678.1_9 Reverse -327 -346 -4.42544 0.293
NP_441678.1_9 Reverse -216 -235 -5.60541 0.297
NP_442281.1_1 Forward -58 -44 19.7634 0.00247
NP_442281.1_1 Reverse -39 -53 15.0436 0.0144
NP_441079.1_7 Reverse -76 -95 -3.34455 0.233
NP_440437.1_1 Forward -59 -40 15.6341 0.0209
NP_440437.1_1 Forward -255 -236 -2.0655 0.21
NP_442012.1_1 Reverse -380 -399 1.27776 0.22
NP_442012.1_1 Reverse -38 -57 -0.197208 0.253
NP_441457.1_7 Reverse -271 -290 -1.27885 0.298
NP_441556.1_7 Reverse -272 -291 8.65176 0.171
NP_441556.1_10 Forward -297 -283 10.2218 0.273
NP_440498.1_1 Reverse -35 -53 -2.3408 0.241
NP_441644.1_6 Forward -53 -43 17.3841 0.00127
NP_441644.1_6 Reverse -44 -54 10.1076 0.0628
NP_441644.1_6 Reverse -282 -292 7.35439 0.129
NP_442215.1_2 Reverse -42 -58 7.04003 0.0699
NP_442215.1_2 Forward -55 -39 1.43517 0.134
NP_442215.1_2 Reverse -280 -296 -6.82463 0.28
NP_442029.1_6 Reverse -39 -58 7.27595 0.224
NP_442029.1_10 Reverse -114 -133 8.84924 0.249
NP_440253.1_2 Reverse -324 -342 2.47742 0.137
NP_440929.1_8 Forward -53 -44 19.2726 0.000701
NP_440929.1_8 Reverse -44 -53 19.2726 0.000701
NP_442933.1_10 Forward -53 -44 17.601 0.00325
NP_442933.1_10 Reverse -44 -53 17.601 0.00325
NP_442933.1_10 Reverse -250 -259 6.29291 0.128
NP_441751.2_8 Forward -52 -38 13.6676 0.0162
NP_442926.1_5 Forward -58 -39 21.337 0.0294
NP_442554.1_8 Forward -52 -42 15.9097 0.00747
NP_442554.1_8 Reverse -45 -55 13.8447 0.0145
NP_442554.1_8 Reverse -283 -293 3.91327 0.203
NP_442554.1_8 Forward -209 -199 2.92996 0.249
NP_442554.1_8 Forward -126 -116 2.14332 0.281
NP_441762.1_7 Forward -292 -280 3.57889 0.0676
NP_441762.1_7 Reverse -43 -55 2.89058 0.0676
NP_441762.1_7 Forward -54 -42 2.30059 0.0676
NP_442142.1_4 Reverse -41 -54 18.0132 0.0255
NP_442142.1_4 Forward -56 -43 17.1282 0.0264
NP_442142.1_4 Forward -262 -249 5.0336 0.204
NP_442142.1_4 Forward -50 -37 2.47701 0.29
NP_442292.1_1 Forward -52 -43 18.486 0.00229
NP_442292.1_1 Reverse -45 -54 9.63616 0.0183
NP_440919.1_7 Reverse -376 -394 5.64375 0.285
NP_441525.1_1 Reverse -269 -282 14.8673 0.21
NP_442476.1_5 Forward -192 -173 11.7008 0.256
NP_442476.1_6 Forward -52 -38 8.65272 0.0982
NP_442476.1_6 Reverse -45 -59 2.2612 0.188
NP_443009.1_5 Reverse -43 -54 18.3477 0.00265
NP_441715.1_4 Reverse -45 -55 16.303 0.0117
NP_441715.1_4 Forward -52 -42 14.828 0.0268
NP_440357.1_3 Reverse -280 -299 -1.27885 0.299
NP_441448.1_1 Reverse -48 -67 8.45592 0.206
NP_441448.1_2 Reverse -278 -297 3.9319 0.168
NP_440183.1_1 Forward -52 -33 10.4225 0.244
NP_440183.1_9 Reverse -275 -294 -18.1918 0.276
NP_441198.1_8 Forward -293 -283 10.6345 0.254
NP_440379.1_5 Reverse -279 -298 -9.63698 0.264
NP_441468.1_1 Forward -52 -45 15.8704 0.0124
NP_441468.1_1 Reverse -45 -52 15.8704 0.0124
NP_441468.1_1 Forward -290 -283 4.07068 0.263
NP_441020.2_6 Reverse -42 -59 14.0018 0.0632
NP_441020.2_6 Forward -55 -38 11.4452 0.12
NP_441015.1_10 Reverse -39 -58 12.7825 0.0617
NP_441015.1_10 Reverse -33 -52 -4.81876 0.212
NP_441673.1_1 Forward -53 -44 20.8459 0.000698
NP_441673.1_1 Reverse -44 -53 20.8459 0.000698
NP_441339.1_4 Reverse -276 -295 -5.99873 0.286
NP_441826.1_2 Forward -59 -45 21.1407 0.00562
NP_441826.1_2 Reverse -38 -52 4.12949 0.105
NP_441826.1_2 Reverse -276 -290 2.75286 0.12
NP_441764.1_8 Forward -317 -307 11.3107 0.284
NP_442868.1_6 Reverse -42 -52 9.91146 0.038
NP_442868.1_6 Forward -55 -45 0.963343 0.205
NP_442719.1_2 Forward -225 -207 -4.40646 0.211
NP_442719.1_2 Forward -21 -3 -7.06138 0.232
NP_442719.1_2 Reverse -80 -98 -8.04469 0.241
NP_442719.1_2 Reverse -296 -314 -10.6013 0.278
NP_442719.1_2 Reverse -333 -351 -11.8796 0.297
NP_441251.1_8 Reverse -340 -353 16.3909 0.254
NP_441056.1_1 Forward -53 -34 6.68596 0.104
NP_441612.1_2 Forward -53 -43 8.54929 0.21
NP_441612.1_2 Reverse -215 -225 8.25885 0.228
NP_441612.1_2 Forward -121 -111 8.06522 0.236
NP_443058.1_7 Reverse -288 -307 5.80098 0.237
NP_442361.1_3 Forward -59 -46 15.3589 0.0917
NP_442808.1_1 Forward -54 -44 18.4657 0.00201
NP_442808.1_1 Reverse -43 -53 8.63269 0.0481
NP_442808.1_1 Reverse -281 -291 6.96107 0.0921
NP_440145.1_3 Reverse -34 -53 12.9791 0.0255
NP_442542.1_2 Forward -55 -42 11.4257 0.114
NP_442542.1_2 Reverse -255 -268 5.23083 0.276
NP_442050.1_5 Reverse -42 -52 16.4991 0.00812
NP_442050.1_5 Forward -55 -45 9.12434 0.193
NP_441114.1_3 Reverse -284 -293 17.1093 0.113
NP_440558.1_2 Reverse -35 -54 8.06259 0.113
NP_440558.1_2 Reverse -279 -298 2.45773 0.168
NP_440558.1_2 Reverse -269 -288 -4.32711 0.244
NP_440558.1_2 Forward -285 -266 -6.09707 0.271
NP_440111.2_2 Reverse -39 -58 -3.24547 0.265
NP_441498.1_3 Reverse -86 -104 10.0481 0.214
NP_442792.1_5 Reverse -328 -345 9.67528 0.289
NP_441878.1_6 Forward -54 -44 10.4031 0.0176
NP_441878.1_6 Reverse -43 -53 10.4031 0.0176
NP_441878.1_6 Forward -292 -282 2.33998 0.0405
NP_441036.1_8 Forward -54 -44 17.7779 0.000554
NP_441036.1_8 Reverse -43 -53 8.33817 0.174
NP_442650.1_2 Forward -53 -39 6.6861 0.13
NP_442721.1_3 Forward -273 -254 15.3391 0.209
NP_441557.1_5 Forward -53 -44 19.9609 0.000699
NP_441557.1_5 Reverse -44 -53 19.9609 0.000699
NP_441557.1_8 Reverse -194 -204 10.796 0.275
NP_441445.1_1 Reverse -35 -54 16.1257 0.0398
NP_441445.1_1 Forward -62 -43 3.44104 0.213
NP_442066.2_4 Reverse -44 -63 0.687771 0.161
NP_442419.1_2 Forward -58 -39 0.58944 0.242
NP_440744.1_2 Forward -54 -35 15.6917 0.264
NP_441308.1_8 Forward -55 -45 10.1081 0.22
NP_441381.1_6 Reverse -213 -232 13.7658 0.199
NP_440101.1_3 Forward -58 -39 6.88262 0.181
NP_440101.1_3 Reverse -39 -58 5.50599 0.195
NP_440101.1_10 Forward -53 -34 7.47261 0.193
NP_441458.1_10 Forward -62 -43 13.6675 0.0856
NP_441458.1_10 Reverse -35 -54 6.78429 0.196
NP_442830.1_5 Forward -218 -204 12.5853 0.168
NP_442830.1_5 Reverse -281 -295 5.99717 0.22
NP_441564.1_2 Reverse -257 -276 -0.4922 0.217
NP_442183.1_1 Forward -53 -39 15.5359 0.0202
NP_442183.1_1 Reverse -44 -58 9.93102 0.0903
NP_442397.1_6 Forward -89 -75 15.2409 0.273
NP_442444.1_6 Reverse -265 -283 15.4355 0.208
NP_441549.1_9 Reverse -40 -58 3.46073 0.0925
NP_442347.1_2 Forward -52 -43 12.4878 0.056
NP_442347.1_2 Reverse -45 -54 11.1111 0.056
NP_442347.1_2 Forward -248 -239 4.81794 0.257
NP_442645.1_2 Reverse -36 -55 14.0608 0.00712
NP_442888.1_6 Reverse -190 -209 1.86774 0.275
NP_441037.1_4 Forward -55 -45 7.02532 0.237
NP_441037.1_4 Forward -293 -283 6.44058 0.263
NP_442594.1_8 Reverse -199 -218 5.50599 0.247
NP_442508.1_8 Forward -112 -95 13.2152 0.256
NP_440151.1_5 Reverse -380 -399 3.04771 0.289
NP_441633.1_3 Reverse -42 -55 1.29759 0.109
NP_441633.1_3 Forward -55 -42 -3.81562 0.177
NP_440136.1_1 Forward -234 -218 9.89093 0.238
NP_440136.1_2 Forward -52 -45 15.9687 0.0123
NP_440136.1_2 Reverse -45 -52 15.9687 0.0123
NP_442590.1_10 Reverse -38 -57 7.47261 0.226
NP_442590.1_10 Forward -288 -269 3.73603 0.286
NP_442590.1_10 Reverse -44 -63 3.44104 0.293
NP_442998.1_5 Forward -98 -88 12.7631 0.159
NP_442998.1_5 Forward -99 -89 11.8781 0.176
NP_442998.1_5 Forward -122 -112 10.9931 0.199
NP_442998.1_10 Forward -51 -44 15.5754 0.0102
NP_442998.1_10 Reverse -46 -53 15.5754 0.0102
NP_440299.1_1 Forward -57 -44 20.1765 0.00128
NP_440299.1_1 Reverse -40 -53 12.605 0.0362
NP_440299.1_1 Reverse -114 -127 5.52525 0.172
NP_441799.1_1 Reverse -40 -54 16.7152 0.0134
NP_441799.1_1 Forward -295 -281 5.60385 0.201
NP_441799.1_1 Forward -57 -43 4.03056 0.269
NP_441007.1_10 Reverse -39 -52 10.934 0.0646
NP_442333.2_1 Reverse -280 -299 -4.91709 0.25
NP_442333.2_5 Forward -64 -45 -12.1936 0.249
NP_440256.1_1 Reverse -41 -60 18.289 0.00463
NP_440256.1_1 Reverse -115 -134 -6.68705 0.217
NP_440087.1_1 Reverse -35 -54 -9.24366 0.292
NP_441559.1_8 Reverse -278 -292 11.996 0.0574
NP_441559.1_8 Forward -58 -44 2.45787 0.143
NP_441559.1_8 Reverse -263 -277 -7.76856 0.299
NP_440915.1_6 Forward -57 -43 5.70279 0.0879
NP_440915.1_6 Reverse -381 -395 -2.16369 0.26
NP_440915.1_6 Forward -271 -257 -3.34366 0.293
NP_442785.1_8 Reverse -193 -211 16.9321 0.269
NP_441704.1_8 Forward -64 -45 8.06178 0.213
NP_442866.1_1 Reverse -39 -58 -5.9004 0.245
NP_442866.1_1 Reverse -277 -296 -9.73531 0.298
NP_441464.1_1 Forward -67 -48 6.88262 0.277
NP_441464.1_10 Reverse -206 -220 12.4876 0.201
NP_440702.1_2 Reverse -42 -61 -0.983855 0.257
NP_440695.1_5 Forward -53 -34 24.8772 0.013
NP_440695.1_5 Reverse -44 -63 -1.7705 0.288
NP_441199.1_6 Forward -57 -38 -0.295539 0.265
NP_442993.1_1 Forward -285 -269 -8.98791 0.178
NP_442993.1_1 Forward -53 -37 -10.9545 0.231
NP_442386.1_9 Forward -54 -45 15.7322 0.0144
NP_442386.1_9 Reverse -43 -52 13.8639 0.0289
NP_442386.1_9 Reverse -281 -290 6.68581 0.219
NP_441750.1_1 Reverse -264 -283 -7.96535 0.274
NP_441340.1_5 Forward -52 -45 15.6737 0.0124
NP_441340.1_5 Reverse -45 -52 15.6737 0.0124
NP_441340.1_5 Reverse -283 -290 3.97235 0.274
NP_441340.1_9 Forward -99 -89 8.25522 0.256
NP_441271.1_1 Reverse -38 -56 11.6214 0.239
NP_441947.1_10 Forward -55 -37 -0.570838 0.276
NP_442791.1_5 Reverse -265 -284 -11.9969 0.29
NP_441254.1_1 Forward -379 -366 15.6533 0.241
NP_442240.1_2 Reverse -45 -64 -4.32711 0.0843
NP_440161.1_3 Reverse -280 -299 14.7491 0.118
NP_441134.1_10 Reverse -280 -298 12.4089 0.221
NP_440211.1_4 Forward -385 -375 14.1397 0.29
NP_440586.1_8 Forward -52 -45 13.2151 0.026
NP_440586.1_8 Reverse -45 -52 13.2151 0.026
NP_442251.1_6 Forward -52 -45 15.2804 0.0124
NP_442251.1_6 Reverse -45 -52 15.2804 0.0124
NP_440192.1_4 Forward -284 -265 12.4052 0.181
NP_440684.1_9 Forward -291 -277 9.5377 0.218
NP_441262.1_3 Reverse -44 -51 14.7888 0.0223
NP_441262.1_3 Forward -53 -46 14.7888 0.0223
NP_440027.1_3 Forward -69 -51 4.24662 0.262
NP_440027.1_3 Reverse -272 -290 3.45998 0.272
NP_443051.1_1 Reverse -43 -52 10.4228 0.00754
NP_443051.1_1 Forward -54 -45 10.4228 0.00754
NP_439984.1_7 Forward -51 -33 -4.99573 0.292
NP_439937.1_9 Reverse -281 -298 -11.9582 0.269
NP_440439.1_1 Forward -56 -43 8.37742 0.0537
NP_440439.1_1 Reverse -41 -54 7.29578 0.0664
NP_440439.1_1 Forward -177 -164 -1.65234 0.275
NP_440372.1_2 Forward -52 -45 16.3621 0.0124
NP_440372.1_2 Reverse -45 -52 16.3621 0.0124
NP_440819.1_5 Forward -99 -91 7.59091 0.272
NP_440316.1_10 Forward -292 -282 16.6963 0.153
NP_440316.1_10 Reverse -207 -217 7.84651 0.245
NP_441803.1_2 Reverse -39 -58 11.9958 0.0651
NP_439977.1_5 Reverse -38 -57 2.3594 0.174
NP_439977.1_5 Forward -273 -254 0.294447 0.211
NP_439977.1_10 Forward -282 -263 14.9458 0.218
NP_440144.1_1 Reverse -99 -118 18.9773 0.14
NP_441572.1_7 Forward -59 -40 4.81767 0.0925
NP_441572.1_7 Forward -272 -253 -4.03212 0.224
NP_441245.1_3 Reverse -341 -360 8.65258 0.275
NP_442384.1_10 Reverse -44 -57 15.7522 0.00946
NP_442384.1_10 Forward -53 -40 15.5556 0.00986
NP_440364.1_6 Forward -54 -41 14.375 0.275
NP_441877.1_5 Reverse -218 -237 4.03102 0.233
NP_441018.1_7 Reverse -40 -59 10.6192 0.201
NP_441018.1_7 Forward -234 -215 8.84924 0.239
NP_442262.1_10 Forward -52 -45 14.1988 0.0123
NP_442262.1_10 Reverse -45 -52 14.1988 0.0123
NP_442262.1_10 Reverse -283 -290 9.87221 0.164
NP_441689.1_5 Reverse -42 -52 15.3192 0.0403
NP_441689.1_5 Forward -55 -45 8.53436 0.132
NP_441689.1_5 Forward -176 -166 5.97777 0.197
NP_442244.1_6 Forward -285 -266 1.96607 0.291
NP_440163.1_10 Forward -56 -46 16.303 0.0762
NP_440163.1_10 Reverse -41 -51 12.4681 0.159
NP_440344.1_10 Forward -60 -43 4.26707 0.025
NP_440344.1_10 Reverse -251 -268 -13.8258 0.296
NP_440531.1_6 Reverse -274 -293 3.44104 0.145
NP_441060.1_1 Forward -291 -272 11.7915 0.294
NP_441060.1_6 Reverse -327 -343 11.3666 0.254
NP_441965.1_10 Forward -56 -40 12.5466 0.105
NP_440297.1_9 Forward -52 -42 9.32148 0.0917
NP_440297.1_9 Reverse -45 -55 9.32148 0.0917
NP_440297.1_9 Reverse -283 -293 7.35486 0.126
NP_441592.1_4 Forward -230 -211 4.71934 0.144
NP_442378.1_9 Forward -355 -336 13.47 0.246
NP_440894.1_10 Forward -58 -39 5.11266 0.238
NP_440894.1_10 Forward -221 -202 3.24438 0.276
NP_441778.1_8 Forward -132 -118 19.1735 0.178
NP_442067.1_4 Forward -64 -45 2.65439 0.289
NP_442067.1_4 Reverse -271 -290 2.45773 0.295
NP_440999.1_9 Forward -57 -43 13.1759 0.0329
NP_440999.1_9 Reverse -278 -292 4.32615 0.116
NP_440999.1_9 Forward -48 -34 -1.37704 0.236
NP_440888.1_2 Reverse -44 -58 17.6002 0.00354
NP_440888.1_2 Forward -53 -39 13.077 0.0339
NP_440888.1_2 Reverse -118 -132 7.17714 0.205
NP_440600.1_4 Forward -61 -43 -6.4707 0.285
NP_440491.1_1 Reverse -41 -60 7.30684 0.273
NP_440237.1_5 Reverse -114 -128 13.077 0.197
NP_442807.1_10 Forward -99 -85 12.4876 0.269
NP_441543.1_2 Reverse -45 -54 18.486 0.00236
NP_441543.1_2 Forward -52 -43 16.9127 0.00359
NP_442845.1_2 Reverse -38 -52 10.3243 0.154
NP_442845.1_2 Reverse -44 -58 7.47274 0.195
NP_442845.1_2 Forward -53 -39 6.88276 0.201
NP_442845.1_2 Forward -110 -96 3.93283 0.272
NP_441551.1_5 Reverse -40 -56 7.82599 0.241
NP_442710.1_7 Forward -95 -76 -4.91611 0.274
NP_442710.1_7 Reverse -75 -94 -6.64608 0.294
NP_441469.1_8 Forward -54 -45 16.126 0.00797
NP_441469.1_8 Forward -292 -283 9.63616 0.227
NP_441469.1_8 Reverse -43 -52 6.48957 0.227
NP_442315.1_2 Forward -296 -284 11.347 0.291
NP_443064.1_6 Forward -53 -43 12.5669 0.0796
NP_442337.1_6 Reverse -255 -274 13.3488 0.257
NP_442337.1_8 Forward -302 -283 -2.16383 0.295
NP_442578.1_7 Forward -52 -45 14.5921 0.026
NP_442578.1_7 Reverse -45 -52 14.5921 0.026
NP_441462.1_2 Forward -53 -43 11.5831 0.00406
NP_441462.1_2 Reverse -44 -54 11.5831 0.00406
NP_441621.1_7 Forward -55 -41 -3.24533 0.188
NP_441621.1_7 Reverse -42 -56 -3.34366 0.188
NP_441621.1_10 Reverse -266 -285 7.27595 0.231
NP_443062.1_1 Forward -53 -35 13.1288 0.0663
NP_443062.1_1 Reverse -44 -62 10.0085 0.122
NP_443062.1_6 Forward -299 -280 4.32602 0.221
NP_443062.1_6 Reverse -36 -55 0.491109 0.294
NP_440349.1_3 Forward -52 -33 17.5015 0.123
NP_440519.1_8 Reverse -54 -70 2.91013 0.254
NP_442204.1_1 Forward -57 -46 9.69511 0.0736
NP_442204.1_1 Reverse -40 -51 -0.137991 0.286
NP_442204.1_5 Forward -63 -44 10.0292 0.0939
NP_441560.1_8 Reverse -228 -247 15.3108 0.116
NP_441351.1_1 Reverse -51 -70 12.2908 0.24
NP_440516.1_6 Reverse -273 -287 10.6187 0.226
NP_440516.1_8 Forward -53 -44 16.9127 0.00442
NP_440516.1_8 Reverse -44 -53 16.9127 0.00442
NP_440516.1_8 Reverse -201 -210 7.17789 0.0754
NP_440516.1_8 Forward -291 -282 -0.491928 0.262
NP_442428.1_5 Forward -52 -45 15.8704 0.0124
NP_442428.1_5 Reverse -45 -52 15.8704 0.0124
NP_442428.1_5 Forward -290 -283 4.46401 0.267
NP_440673.1_2 Forward -292 -273 7.75569 0.292
NP_440673.1_3 Forward -51 -44 12.4288 0.0426
NP_440673.1_3 Reverse -46 -53 12.4288 0.0426
NP_440673.1_3 Reverse -284 -291 8.98723 0.203
NP_440865.1_9 Reverse -38 -57 -8.65367 0.268
NP_441052.1_2 Forward -53 -43 19.9412 0.00106
NP_441052.1_2 Reverse -44 -54 10.5014 0.0285
NP_442219.1_9 Forward -52 -43 17.7976 0.00718
NP_442219.1_9 Reverse -45 -54 8.35786 0.0681
NP_440436.1_4 Reverse -45 -54 18.1905 0.00233
NP_440436.1_4 Forward -52 -43 17.2072 0.00233
NP_440436.1_4 Reverse -283 -292 9.73406 0.0871
NP_441884.1_8 Reverse -43 -62 -6.29373 0.219
NP_441884.1_9 Forward -294 -275 -25.4683 0.29
NP_442086.1_4 Forward -281 -262 14.3777 0.268
NP_440314.1_9 Forward -52 -33 -8.85033 0.254
NP_441719.1_4 Forward -52 -45 16.3621 0.0124
NP_441719.1_4 Reverse -45 -52 16.3621 0.0124
NP_441733.1_10 Reverse -41 -54 7.49244 0.153
NP_441004.1_1 Reverse -252 -271 -4.03212 0.167
NP_441004.1_1 Reverse -38 -57 -13.4719 0.257
NP_441004.1_1 Forward -297 -278 -17.7985 0.294
NP_441004.1_1 Reverse -264 -283 -18.2901 0.299
NP_441004.1_4 Forward -294 -284 15.8113 0.154
NP_441004.1_5 Forward -295 -281 18.7808 0.14
NP_441004.1_5 Reverse -254 -268 7.9644 0.278
NP_442366.1_3 Reverse -43 -61 -1.45582 0.213
NP_442366.1_3 Forward -54 -36 -5.58572 0.289
NP_442366.1_5 Reverse -237 -247 14.8275 0.0375
NP_440129.1_10 Forward -60 -46 6.29277 0.177
NP_441115.1_4 Forward -260 -242 12.5064 0.102
NP_441115.1_4 Reverse -43 -61 10.7364 0.168
NP_442206.1_1 Forward -282 -263 -12.9802 0.241
NP_442206.1_10 Forward -53 -38 5.78142 0.178
NP_442206.1_10 Reverse -44 -59 2.14318 0.205
NP_440328.1_4 Forward -59 -40 -0.000545616 0.265
NP_440094.1_9 Reverse -43 -62 -2.95047 0.227
NP_443054.1_2 Reverse -42 -56 3.04785 0.24
NP_441966.1_7 Reverse -183 -202 -0.492971 0.268
NP_441851.1_10 Forward -54 -44 16.008 0.00552
NP_441851.1_10 Reverse -43 -53 15.8113 0.00552
NP_441851.1_10 Reverse -267 -277 6.17489 0.182
NP_442208.1_5 Forward -397 -378 -7.37537 0.271
NP_440611.1_6 Forward -299 -280 6.58763 0.29
NP_441501.1_6 Reverse -263 -282 11.7008 0.299
NP_442515.1_1 Forward -54 -40 2.06454 0.143
NP_442515.1_1 Reverse -43 -57 -4.81863 0.298
NP_442709.1_3 Reverse -37 -56 18.879 0.0254
NP_441046.1_2 Reverse -33 -52 4.12936 0.231
NP_441046.1_2 Reverse -328 -347 -1.27885 0.288
NP_441046.1_2 Forward -201 -182 -1.57384 0.292
NP_440338.1_4 Reverse -79 -98 8.65176 0.278
NP_441349.1_10 Forward -63 -44 -7.08038 0.242
NP_441349.1_10 Reverse -34 -53 -9.24366 0.287
NP_441409.1_6 Reverse -38 -57 -6.39206 0.124
NP_441409.1_6 Forward -59 -40 -7.37537 0.149
NP_442843.1_1 Reverse -51 -70 2.26107 0.161
NP_442843.1_1 Forward -290 -271 0.392778 0.17
NP_440396.1_10 Reverse -274 -290 9.39927 0.285
NP_440726.1_3 Reverse -326 -345 14.1591 0.158
NP_441477.1_10 Reverse -37 -55 -0.472507 0.291
NP_441124.1_5 Forward -99 -89 12.7217 0.215
NP_442450.1_5 Reverse -42 -52 9.32148 0.115
NP_442450.1_5 Forward -55 -45 9.32148 0.115
NP_442006.1_2 Forward -291 -274 -16.1858 0.243
NP_441570.1_1 Reverse -44 -62 1.59244 0.0299
NP_441570.1_1 Forward -53 -35 0.21581 0.0403
NP_441570.1_1 Reverse -240 -258 -10.6989 0.177
NP_441570.1_1 Reverse -201 -219 -11.7806 0.203
NP_440078.1_10 Forward -53 -34 12.5858 0.155
NP_440078.1_10 Reverse -44 -63 5.50599 0.226
NP_441078.1_4 Forward -53 -44 19.6659 0.0007
NP_441078.1_4 Reverse -44 -53 19.6659 0.0007
NP_441078.1_4 Forward -291 -282 -1.57357 0.266
NP_441078.1_10 Forward -219 -200 21.0414 0.0459
NP_442729.1_8 Reverse -40 -53 9.65572 0.125
NP_442729.1_8 Forward -57 -44 8.08242 0.125
NP_442388.1_3 Reverse -270 -289 12.8808 0.197
NP_442388.1_3 Forward -177 -158 5.30933 0.282
NP_441663.1_7 Reverse -41 -60 6.98095 0.209
NP_441663.1_8 Forward -59 -40 7.86593 0.0956
NP_440526.1_3 Forward -52 -41 7.92465 0.126
NP_441432.1_8 Reverse -43 -52 16.8143 0.00595
NP_441432.1_8 Forward -54 -45 8.25953 0.0755
NP_441432.1_8 Forward -292 -283 6.5879 0.112
NP_442320.1_8 Forward -59 -45 5.01447 0.0442
NP_442320.1_8 Reverse -38 -52 -3.147 0.11
NP_442344.1_7 Forward -52 -33 2.0644 0.0644
NP_441732.1_2 Forward -57 -41 1.92682 0.0254
NP_441732.1_2 Reverse -40 -56 -17.346 0.253
NP_440629.1_4 Forward -266 -247 7.47261 0.292
NP_440760.1_1 Forward -53 -34 -2.55715 0.0332
NP_442797.1_6 Reverse -189 -208 7.06155 0.294
NP_440199.1_10 Reverse -41 -51 7.64985 0.231
NP_441945.1_10 Forward -338 -319 7.86593 0.282
NP_441057.1_3 Reverse -378 -397 -12.8819 0.262
NP_442353.1_4 Forward -59 -40 3.83357 0.21
NP_440913.1_1 Reverse -199 -217 16.6371 0.0951
NP_442751.1_2 Forward -54 -35 3.73524 0.265
NP_440713.1_4 Forward -57 -38 2.0644 0.273
NP_440713.1_4 Forward -272 -253 1.76941 0.279
NP_442489.1_2 Forward -58 -39 7.07928 0.172
NP_442489.1_7 Forward -53 -44 20.1576 0.000695
NP_442489.1_7 Reverse -44 -53 20.1576 0.000695
NP_442489.1_7 Forward -291 -282 -1.57357 0.213
NP_442489.1_7 Reverse -282 -291 -2.06522 0.288
NP_442079.1_7 Forward -52 -33 0.786102 0.27
NP_440559.1_1 Forward -52 -43 17.4043 0.00658
NP_440559.1_1 Reverse -45 -54 8.75118 0.0586
NP_441659.2_8 Forward -53 -43 18.1713 0.00133
NP_441659.2_8 Reverse -44 -54 11.9764 0.0147
NP_441022.1_1 Forward -144 -135 11.2584 0.284
NP_442913.1_10 Reverse -29 -48 -2.55715 0.187
NP_441040.1_2 Reverse -42 -61 -15.7335 0.286
NP_441800.1_3 Reverse -39 -57 10.5406 0.279
NP_442776.1_6 Reverse -280 -299 6.68596 0.297
NP_442346.1_5 Reverse -43 -53 16.6963 0.00248
NP_442346.1_5 Forward -54 -44 9.02648 0.118
NP_442346.1_5 Forward -48 -38 7.05986 0.183
NP_442346.1_5 Forward -292 -282 5.97822 0.219
NP_442346.1_10 Forward -284 -265 -3.24547 0.294
NP_440352.1_5 Forward -326 -307 13.9211 0.172
NP_440545.1_3 Reverse -40 -57 4.56207 0.0691
NP_440545.1_3 Forward -57 -40 -2.41943 0.184
NP_440545.1_3 Reverse -269 -286 -4.38605 0.224
NP_440545.1_3 Forward -295 -278 -5.56602 0.253
NP_440831.1_3 Forward -275 -256 8.52284 0.223
NP_440831.1_3 Reverse -35 -54 6.77545 0.27
NP_441923.1_6 Reverse -223 -237 7.76774 0.298
NP_440459.1_2 Forward -300 -283 10.4619 0.198
NP_440459.1_2 Reverse -42 -59 9.77361 0.219
NP_440459.1_2 Reverse -255 -272 9.18362 0.233
NP_440010.1_4 Forward -57 -38 6.09517 0.199
NP_440010.1_4 Reverse -40 -59 -2.65624 0.288
NP_440010.1_4 Reverse -34 -53 -3.14789 0.294
NP_441943.1_2 Reverse -6 -25 12.5858 0.243
NP_440847.1_8 Reverse -248 -267 11.7992 0.281
NP_442603.1_7 Reverse -44 -58 11.602 0.114
NP_442603.1_7 Forward -210 -196 8.94708 0.161
NP_442603.1_7 Forward -53 -39 8.84875 0.162
NP_441585.1_5 Reverse -79 -98 1.08032 0.291
NP_441888.1_7 Forward -58 -44 3.8345 0.225
NP_441888.1_9 Reverse -333 -352 13.9702 0.282
NP_440946.1_6 Forward -293 -274 1.17943 0.294
NP_441948.1_4 Forward -298 -280 7.59063 0.0623
NP_441948.1_4 Forward -60 -42 -4.99573 0.25
NP_439970.1_4 Forward -245 -226 -5.01543 0.293
NP_441833.1_4 Forward -52 -45 15.9687 0.0124
NP_441833.1_4 Reverse -45 -52 15.9687 0.0124
NP_441895.1_10 Forward -102 -83 -18.9784 0.282
NP_441112.1_6 Forward -137 -118 4.62101 0.196
NP_442699.1_8 Reverse -262 -281 -12.8819 0.261
NP_442162.1_9 Forward -52 -45 16.2637 0.0124
NP_442162.1_9 Reverse -45 -52 16.2637 0.0124
NP_440671.1_4 Forward -59 -45 19.7641 0.00827
NP_440671.1_4 Reverse -38 -52 10.9143 0.145
NP_440671.1_6 Forward -219 -200 11.3067 0.255
NP_442943.1_1 Forward -93 -78 3.58414 0.264
NP_442199.1_7 Reverse -71 -90 2.06362 0.269
NP_442140.1_3 Forward -290 -280 8.63316 0.119
NP_442140.1_3 Reverse -45 -55 8.33817 0.119
NP_442140.1_3 Reverse -274 -284 4.79825 0.238
NP_442140.1_3 Forward -52 -42 4.40493 0.243
NP_442723.1_1 Forward -227 -208 7.27514 0.276
NP_441609.1_1 Reverse -111 -130 -0.0988766 0.226
NP_440951.1_5 Forward -355 -337 12.3105 0.274
NP_441671.1_1 Reverse -225 -244 7.47261 0.226
NP_441671.1_10 Reverse -262 -281 4.42435 0.219
NP_440875.1_9 Reverse -275 -285 11.0975 0.181
NP_440875.1_9 Reverse -46 -56 9.05339 0.233
NP_441813.1_3 Forward -305 -286 15.6917 0.238
NP_441813.1_5 Forward -55 -45 17.188 0.00979
NP_441813.1_5 Reverse -42 -52 15.9097 0.01
NP_440590.1_4 Reverse -45 -58 4.8375 0.0585
NP_440590.1_4 Forward -52 -39 -5.58558 0.283
NP_440567.1_1 Reverse -45 -59 6.78443 0.0803
NP_440567.1_1 Forward -52 -38 6.3911 0.0837
NP_442497.1_10 Forward -52 -43 10.4228 0.0087
NP_442497.1_10 Reverse -45 -54 10.4228 0.0087
NP_442497.1_10 Reverse -283 -292 0.196389 0.208
NP_440821.1_4 Forward -55 -45 19.0562 0.00399
NP_440821.1_4 Reverse -42 -52 18.2696 0.00448
NP_441239.1_9 Forward -55 -43 13.3137 0.037
NP_441239.1_9 Reverse -271 -283 12.232 0.0494
NP_441239.1_9 Reverse -280 -292 10.8554 0.0714
NP_441239.1_9 Reverse -42 -54 6.92215 0.173
NP_440156.1_4 Reverse -87 -97 12.9592 0.176
NP_441892.1_1 Forward -62 -45 9.38028 0.073
NP_440604.1_6 Reverse -44 -63 -4.03212 0.236
NP_442270.1_9 Forward -58 -39 3.24438 0.14
NP_441017.1_6 Forward -240 -226 11.012 0.285
NP_441526.1_3 Reverse -226 -245 17.9932 0.183
NP_440949.1_7 Forward -61 -42 8.94676 0.264
NP_442052.1_8 Forward -293 -283 15.3197 0.253
NP_440546.1_4 Reverse -44 -54 11.8882 0.0679
NP_440546.1_4 Forward -53 -43 10.046 0.109
NP_440546.1_4 Reverse -201 -211 8.97947 0.16
NP_440546.1_4 Forward -174 -164 8.00989 0.209
NP_440546.1_6 Reverse -34 -53 7.07928 0.278
NP_441230.1_5 Forward -58 -39 2.65439 0.212
NP_441656.1_8 Forward -243 -226 22.5566 0.0566
NP_440462.1_6 Forward -55 -45 15.418 0.0142
NP_440462.1_6 Reverse -42 -52 7.74818 0.0699
NP_440462.1_6 Forward -176 -166 1.84832 0.294
NP_442465.1_9 Reverse -70 -84 8.75105 0.298
NP_442340.1_3 Forward -280 -261 -7.57203 0.236
NP_440868.1_4 Reverse -40 -52 15.1819 0.0164
NP_440868.1_4 Forward -57 -45 8.6921 0.0582
NP_440868.1_4 Reverse -278 -290 3.18557 0.14
NP_440868.1_4 Forward -286 -274 -0.649339 0.28
NP_442479.1_5 Reverse -79 -98 8.92273 0.222
NP_442479.1_9 Reverse -331 -350 -12.2919 0.281
NP_442402.1_2 Reverse -372 -386 12.192 0.271
NP_442402.1_4 Reverse -83 -102 -9.53937 0.291
NP_442402.1_6 Forward -387 -378 15.7327 0.241
NP_442402.1_10 Reverse -90 -100 13.4509 0.202
NP_442402.1_10 Reverse -376 -386 12.2709 0.218
NP_442039.1_4 Forward -52 -45 15.1821 0.0124
NP_442039.1_4 Reverse -45 -52 15.1821 0.0124
NP_442039.1_7 Forward -289 -279 13.7464 0.211
NP_442039.1_7 Forward -388 -378 10.4031 0.257
NP_441811.1_4 Reverse -259 -278 5.60432 0.203
NP_441811.1_8 Reverse -38 -52 6.6861 0.265
NP_442380.1_10 Reverse -40 -58 13.9821 0.177
NP_442837.1_3 Forward -52 -45 15.7721 0.0124
NP_442837.1_3 Reverse -45 -52 15.7721 0.0124
NP_440160.1_9 Reverse -257 -276 7.86593 0.27
NP_442053.1_1 Forward -53 -44 18.3876 0.0007
NP_442053.1_1 Reverse -44 -53 18.3876 0.0007
NP_440505.1_3 Reverse -42 -52 16.303 0.00696
NP_440505.1_3 Forward -55 -45 13.8447 0.0247
NP_442360.1_5 Forward -389 -379 13.2547 0.28
NP_441959.1_9 Reverse -324 -343 15.7324 0.193
NP_441252.1_6 Forward -294 -287 14.3954 0.168
NP_441203.1_1 Reverse -45 -64 -10.817 0.137
NP_442532.1_7 Forward -291 -277 11.3077 0.13
NP_441576.1_10 Forward -96 -77 14.4541 0.234
NP_440914.1_1 Forward -53 -43 17.5935 0.000537
NP_440914.1_1 Reverse -201 -211 9.00547 0.186
NP_440914.1_1 Reverse -44 -54 8.6151 0.186
NP_441011.1_8 Reverse -45 -54 16.9127 0.00602
NP_441011.1_8 Forward -52 -43 8.25953 0.144
NP_442101.1_10 Forward -61 -42 -5.80207 0.177
NP_442533.1_1 Reverse -41 -60 -16.0285 0.262
NP_442533.1_6 Forward -53 -44 17.2076 0.00137
NP_442533.1_6 Reverse -44 -53 17.2076 0.00137
NP_442533.1_6 Forward -259 -250 2.55633 0.25
NP_442533.1_6 Forward -47 -38 2.06468 0.275
NP_443016.1_1 Forward -297 -278 -7.57203 0.277
NP_441219.1_6 Reverse -226 -244 8.67227 0.298
NP_441482.1_7 Forward -59 -45 10.1277 0.0135
NP_441482.1_7 Reverse -38 -52 9.73436 0.0155
NP_439944.1_9 Forward -52 -42 19.0562 0.00329
NP_439944.1_9 Reverse -45 -55 10.3048 0.0887
NP_441697.1_5 Forward -94 -75 -8.35597 0.258
NP_441697.1_5 Reverse -6 -25 -10.9342 0.287
NP_442202.1_10 Forward -292 -278 5.60446 0.255
NP_442202.1_10 Reverse -272 -286 5.01447 0.255
NP_440116.1_8 Forward -52 -33 -8.752 0.26
NP_440115.1_6 Reverse -41 -51 9.41981 0.115
NP_440007.1_9 Forward -57 -43 3.73617 0.267
NP_440007.1_9 Reverse -197 -211 1.86788 0.282
NP_439965.1_1 Reverse -35 -54 3.93269 0.0949
NP_439965.1_1 Forward -62 -43 -3.73712 0.182
NP_441680.1_4 Forward -398 -379 -0.39387 0.253
NP_443045.1_2 Forward -271 -252 16.6174 0.181
NP_441602.1_3 Forward -287 -268 5.40766 0.141
NP_441602.1_3 Reverse -39 -58 -0.000545616 0.219
NP_441106.1_1 Forward -54 -45 18.191 0.0028
NP_441106.1_1 Reverse -43 -52 9.63616 0.0311
NP_439903.1_6 Forward -56 -37 12.1917 0.0872
NP_439903.1_6 Forward -351 -332 3.63691 0.207
NP_439903.1_6 Reverse -35 -54 0.686995 0.258
NP_439903.1_6 Reverse -41 -60 -0.492971 0.282
NP_442588.1_1 Reverse -48 -67 6.78429 0.259
NP_442588.1_4 Forward -287 -268 23.1072 0.0485
NP_440797.1_2 Reverse -33 -52 12.9594 0.241
NP_441286.1_1 Reverse -43 -55 14.4936 0.00418
NP_441286.1_1 Forward -54 -42 11.8387 0.0114
NP_442674.1_3 Forward -61 -42 13.6666 0.174
NP_440670.1_8 Forward -53 -44 18.3876 0.000699
NP_440670.1_8 Reverse -44 -53 18.3876 0.000699
NP_441705.1_3 Reverse -353 -372 3.34271 0.228
NP_441930.1_2 Forward -292 -282 13.5497 0.24
NP_440886.1_7 Forward -54 -44 17.7774 0.0011
NP_440886.1_7 Reverse -43 -53 7.94438 0.0805
NP_440886.1_7 Reverse -281 -291 7.64939 0.0865
NP_440083.1_8 Forward -197 -178 6.09597 0.286
NP_442614.1_2 Forward -53 -39 17.3058 0.0588
NP_442072.1_1 Reverse -80 -98 7.4923 0.26
NP_442072.1_9 Reverse -43 -61 -14.9272 0.165
NP_440513.1_4 Reverse -201 -220 11.8975 0.224
NP_440513.1_4 Forward -291 -272 10.9142 0.254
NP_442401.1_2 Forward -283 -264 8.84842 0.226
NP_440907.2_8 Reverse -45 -55 7.84605 0.117
NP_442264.1_2 Reverse -34 -51 13.2152 0.155
NP_442264.1_2 Forward -63 -46 6.03703 0.267
NP_442264.1_2 Reverse -40 -57 5.54538 0.275
NP_442264.1_5 Forward -53 -39 11.8976 0.253
NP_440841.1_4 Forward -392 -373 -9.93197 0.267
NP_441463.1_3 Forward -63 -44 -9.44032 0.28
NP_441463.1_3 Reverse -34 -53 -10.522 0.296
NP_441463.1_6 Reverse -42 -56 15.113 0.152
NP_441463.1_6 Forward -55 -41 8.44524 0.25
NP_441626.1_2 Forward -52 -45 15.7721 0.0124
NP_441626.1_2 Reverse -45 -52 15.7721 0.0124
NP_442365.1_7 Reverse -40 -59 -6.1954 0.286
NP_440107.1_5 Forward -54 -35 5.30933 0.14
NP_442794.1_1 Forward -57 -45 10.1671 0.0721
NP_442794.1_1 Reverse -40 -52 9.87208 0.0772
NP_442615.1_1 Reverse -35 -53 -0.669169 0.12
NP_441962.1_4 Reverse -268 -287 -1.86883 0.127
NP_441962.1_4 Reverse -39 -58 -11.1119 0.238
NP_441962.1_4 Forward -296 -277 -13.9635 0.28
NP_440387.1_1 Forward -53 -37 17.4631 0.0044
NP_440387.1_1 Reverse -44 -60 4.3851 0.0426
NP_441431.1_2 Reverse -279 -293 17.0102 0.0303
NP_441431.1_2 Forward -285 -271 11.012 0.149
NP_441836.1_2 Reverse -215 -234 2.0644 0.179
NP_441836.1_2 Forward -133 -114 -6.29373 0.295
NP_441993.1_1 Reverse -44 -63 2.8238 0.25
NP_440467.1_3 Reverse -283 -302 13.4048 0.197
NP_440114.1_10 Forward -282 -268 8.35772 0.207
NP_440114.1_10 Forward -291 -277 7.37441 0.236
NP_442323.1_7 Forward -58 -39 6.09517 0.201
NP_442357.1_10 Reverse -233 -247 20.9434 0.103
NP_441510.2_7 Forward -59 -45 10.8154 0.28
NP_440293.1_3 Forward -299 -280 -4.6221 0.264
NP_440766.1_4 Forward -57 -43 8.25939 0.0871
NP_440766.1_4 Reverse -40 -54 7.66941 0.0884
NP_440766.1_5 Reverse -336 -348 8.51522 0.277
NP_441237.1_9 Reverse -283 -293 14.0414 0.0535
NP_442743.1_5 Reverse -39 -58 2.75272 0.29
NP_442930.1_1 Reverse -86 -96 9.51767 0.286
NP_440457.1_1 Forward -57 -45 8.29878 0.101
NP_440457.1_1 Reverse -40 -52 1.21895 0.244
NP_440798.1_6 Reverse -45 -58 3.85419 0.147
NP_441801.1_4 Reverse -377 -387 2.53664 0.292
NP_441332.1_6 Forward -217 -207 15.4224 0.121
NP_442509.1_9 Reverse -44 -54 16.2041 0.00739
NP_442509.1_9 Forward -53 -43 8.14104 0.192
NP_442514.1_5 Forward -218 -199 -6.49113 0.267
NP_440554.1_4 Reverse -45 -55 14.6313 0.02
NP_440554.1_4 Forward -52 -42 7.05986 0.106
NP_441885.1_5 Forward -53 -43 20.9245 0.000538
NP_441885.1_5 Reverse -44 -54 11.4848 0.00668
NP_442341.1_7 Reverse -43 -57 17.7975 0.0111
NP_442341.1_7 Forward -54 -40 12.3893 0.0454
NP_442341.1_7 Reverse -239 -253 1.17956 0.297
NP_442341.1_9 Forward -55 -41 16.1252 0.0386
NP_441173.1_9 Reverse -92 -100 10.9338 0.242
NP_442395.2_4 Reverse -43 -62 5.70185 0.155
NP_440191.1_4 Reverse -141 -151 13.439 0.282
NP_443000.1_7 Reverse -42 -52 17.0896 0.00865
NP_443000.1_7 Forward -55 -45 8.73149 0.0437
NP_440275.1_3 Forward -55 -45 8.4365 0.0602
NP_440275.1_3 Reverse -42 -52 8.1415 0.0602
NP_442932.1_9 Forward -328 -309 3.53937 0.298
NP_440091.1_1 Forward -57 -45 1.41561 0.197
NP_440091.1_1 Reverse -40 -52 -0.452677 0.273
NP_442451.1_2 Reverse -36 -55 -9.73531 0.259
NP_441207.1_7 Forward -382 -368 8.19046 0.293
NP_439962.1_4 Reverse -265 -284 7.37428 0.155
NP_440175.1_4 Reverse -36 -55 -13.7669 0.261
NP_440149.1_8 Reverse -44 -63 4.32602 0.084
NP_440149.1_8 Forward -53 -34 0.58944 0.134
NP_440149.1_8 Reverse -38 -57 -2.26216 0.166
NP_440149.1_8 Reverse -221 -240 -4.32711 0.206
NP_441105.1_3 Forward -64 -45 0.982764 0.118
NP_442373.1_2 Reverse -48 -67 -8.65367 0.249
NP_440216.1_1 Reverse -44 -58 7.57108 0.00935
NP_440216.1_1 Forward -53 -39 -10.4235 0.145
NP_440216.1_1 Reverse -250 -264 -12.6851 0.296
NP_440172.1_1 Forward -53 -43 15.0247 0.00945
NP_440172.1_1 Reverse -44 -54 8.73149 0.0586
NP_440172.1_1 Forward -291 -281 3.71661 0.219
NP_442371.1_1 Forward -100 -90 15.4175 0.146
NP_442290.1_8 Forward -292 -278 15.3392 0.288
NP_442015.1_10 Forward -57 -44 19.1938 0.00444
NP_442015.1_10 Reverse -40 -53 9.06573 0.0553
NP_441226.1_7 Forward -52 -45 14.4934 0.0123
NP_441226.1_7 Reverse -45 -52 14.4934 0.0123
NP_441226.1_7 Forward -209 -202 9.47853 0.147
NP_441226.1_7 Forward -266 -259 6.52862 0.253
NP_440198.1_3 Forward -271 -252 15.0432 0.253
NP_441111.1_7 Forward -52 -44 18.7023 0.00294
NP_441111.1_7 Reverse -45 -53 18.7023 0.00294
NP_442379.1_10 Reverse -37 -54 -1.33779 0.223
NP_441766.1_2 Forward -53 -44 17.5026 0.00297
NP_441766.1_2 Reverse -44 -53 17.5026 0.00297
NP_442417.1_5 Reverse -44 -58 19.4691 0.0165
NP_440416.1_9 Forward -60 -41 3.14605 0.0381
NP_440416.1_9 Reverse -37 -56 -8.26035 0.112
NP_440416.1_9 Forward -284 -265 -16.8151 0.223
NP_443052.1_8 Reverse -34 -53 -8.35868 0.173
NP_440072.1_5 Reverse -29 -47 -0.0791831 0.236
NP_442116.1_6 Forward -350 -333 5.68616 0.291
NP_440896.1_8 Forward -133 -114 19.0757 0.202
NP_440261.1_5 Forward -52 -39 -1.06236 0.0655
NP_440261.1_5 Reverse -45 -58 -1.06236 0.0655
NP_440261.1_7 Reverse -49 -68 6.09597 0.0911
NP_440988.1_10 Forward -212 -198 6.83508 0.231
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCGGAGCAGACCCCTGGGGAAATCAATATCCCTAAAATTCTCTGGCTTTATAATCTTTGCCAAAGCTTCGACCTGGTGGAGTACAGCAAAATGCGCTACAACCTGTTGGGCAATGGCGGCCATTGGTTCCCCGGCCAACCGGCCAGCAACTTTGATCGACAACAGCTCTGGCAATGTTTAGCCCCCAGTCCCCATCGGCAGAAGGTGTTGGAAGTTTTACAGGAAACGGATCGTTTGCTTAAAGGAGAAACGGTGCAAAGATTGTCCCGTCAAGAGGTGGCCAAAACTAGCTAGTGGTGCTGGGAAAAATTGTTAATGTTTTGGTGTGTCGACCAATACTACCCACGGCGATCGCCATGACTTCCAGTCCGATTTAATAAGATTGACCTATTTTGCCCT

CDS

GTGCCCCAACAATCATTTATGAATGGCTCTTCCTTGCCCCGTGAGTTCCCCCCACGCTTACCCAGTTGGTTGAAACGGCCCATTGGTAGAGCTAGTGAATTATCTACGGTTCAGCAGATTATTAAACAGCGCCAAATTCATACCATTTGCGAAGAAGGCCGCTGTCCCAATCGGGGGGAATGTTACGCCAACCGAACGGCAACTTTTTTATTAATGGGTCAAATTTGTACTAGGGCATGTGGTTTTTGTCAGGTGGAAAAGGGCCAGGCTCCCATGATGTTGGATCAGGATGAGCCGAGAAAAGTAGCGGAAGCAGTGCAATTGTTGGGTCTAAAATATGTGGTATTAACTTCCGTTGCTAGGGATGATTTAACCGATGGCGGTGCAGGCTGGTTTGTAGCGGTAATGGAGCGTATTCGCCAGGATAATCCTGCTACTCAAATAGAGGTTTTAACACCGGATTTTTGGGGCGGTATGGGTAGGGAAAGAAGCCAAAAAGAGCGAGTACTGACGGTGACTAAAGCCAAACCGGTTTGCTATAACCACAACTTGGAAACGGTGGCTAGATTACAGGGTAAAGTACGACGGGGGGCAAAATATCAACGCTCCTTAGATGTGTTGCGCTGGATAAAGGAATTTGATCCCGACATTTTCACCAAATCTGGGTTGATGTTGGGCCACGGGGAAACGGTGGATGAAGTGGTGGAAACCCTCAAGGATTTGCGCTCTGTAGGTTGCGATCGCCTGACGTTGGGACAATATATGCAACCATCCCTAGACCATCTGCCCGTGCAAAAATATTGGACTCCAGAGGAGTTTGATCAGTTGGGGGAAATTGCCAAGGATTTGGGTTTTAGCCATGTGCGATCAGGACCATTGGTGCGGAGTTCCTACCATGCCGGGGAAGATTAG

Protein

MPQQSFMNGSSLPREFPPRLPSWLKRPIGRASELSTVQQIIKQRQIHTICEEGRCPNRGECYANRTATFLLMGQICTRACGFCQVEKGQAPMMLDQDEPRKVAEAVQLLGLKYVVLTSVARDDLTDGGAGWFVAVMERIRQDNPATQIEVLTPDFWGGMGRERSQKERVLTVTKAKPVCYNHNLETVARLQGKVRRGAKYQRSLDVLRWIKEFDPDIFTKSGLMLGHGETVDEVVETLKDLRSVGCDRLTLGQYMQPSLDHLPVQKYWTPEEFDQLGEIAKDLGFSHVRSGPLVRSSYHAGED