Your browser is old and dusty. Try Google Chrome!

Details for sll0864

ORF sll0864
Accession NP_440942.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -357 -338 -2.36049 0.286
NP_440694.1_6 Reverse -194 -213 9.0459 0.203
NP_440694.1_6 Forward -216 -197 4.22769 0.283
NP_442272.1_2 Reverse -151 -170 8.92807 0.298
NP_442151.1_6 Forward -213 -199 13.3726 0.0528
NP_440996.1_2 Forward -16 -7 16.5193 0.248
NP_442655.1_2 Reverse -99 -118 -0.4922 0.299
NP_441802.1_1 Reverse -298 -317 8.16093 0.224
NP_440304.1_4 Reverse -202 -212 7.55152 0.109
NP_440908.1_7 Forward -217 -207 17.9746 0.285
NP_441594.1_6 Forward -203 -184 4.42435 0.221
NP_441770.1_4 Forward -335 -316 -8.06369 0.242
NP_440053.1_2 Reverse -97 -116 12.9791 0.283
NP_440438.2_8 Forward -239 -220 3.6377 0.244
NP_440747.1_10 Forward -216 -204 -12.4491 0.282
NP_441130.1_10 Forward -215 -201 4.32615 0.295
NP_442848.1_5 Reverse -185 -203 -1.45582 0.276
NP_443018.1_3 Reverse -205 -212 4.07068 0.299
NP_441077.1_2 Reverse -119 -138 2.62561 0.266
NP_441846.1_10 Reverse -198 -217 -21.9284 0.257
NP_442658.1_1 Reverse -202 -212 5.28945 0.274
NP_442782.1_2 Forward -381 -367 0.0979218 0.296
NP_442953.1_3 Forward -137 -118 10.0284 0.218
NP_442486.1_6 Reverse -179 -198 -7.08038 0.298
NP_443001.1_7 Forward -212 -193 12.7825 0.166
NP_441580.1_6 Reverse -193 -212 -7.86702 0.247
NP_442064.1_4 Forward -217 -198 5.70185 0.267
NP_442002.1_1 Reverse -96 -114 -9.71562 0.283
NP_440147.1_4 Forward -215 -202 4.05085 0.173
NP_441041.1_4 Reverse -198 -217 -11.5053 0.248
NP_441041.1_7 Reverse -201 -213 5.27969 0.265
NP_440016.1_9 Forward -213 -194 9.53756 0.278
NP_441725.1_4 Reverse -83 -97 8.45543 0.2
NP_439966.1_7 Forward -215 -205 5.38779 0.226
NP_441678.1_6 Forward -372 -353 11.1109 0.235
NP_442281.1_1 Forward -218 -204 5.01387 0.172
NP_441079.1_7 Forward -301 -282 -7.08111 0.286
NP_442500.1_8 Forward -15 -1 15.0951 0.151
NP_441556.1_10 Forward -218 -204 10.6112 0.266
NP_441644.1_6 Forward -213 -203 4.99446 0.216
NP_442177.1_5 Reverse -105 -119 18.0925 0.182
NP_442029.1_10 Reverse -90 -109 8.55425 0.25
NP_441346.1_7 Reverse -297 -316 11.0125 0.238
NP_442554.1_8 Forward -212 -202 8.23984 0.0776
NP_442142.1_4 Forward -216 -203 8.47516 0.113
NP_442292.1_1 Forward -212 -203 4.71961 0.172
NP_442016.1_10 Reverse -96 -115 8.16093 0.259
NP_441448.1_1 Reverse -283 -302 5.80098 0.261
NP_441448.1_1 Forward -103 -84 3.24438 0.299
NP_440777.1_3 Forward -218 -199 11.8975 0.285
NP_440464.1_10 Reverse -89 -99 12.4352 0.225
NP_441468.1_1 Reverse -205 -212 10.9539 0.0726
NP_441015.1_10 Reverse -199 -218 -7.96535 0.272
NP_441826.1_2 Reverse -198 -212 -2.26202 0.269
NP_441826.1_5 Forward -212 -193 7.66927 0.221
NP_442719.1_2 Reverse -77 -95 -9.22465 0.261
NP_440051.1_5 Forward -159 -145 13.9634 0.285
NP_442808.1_1 Forward -214 -204 6.66608 0.102
NP_442808.1_1 Forward -117 -107 3.32285 0.244
NP_440145.1_4 Forward -212 -202 15.9091 0.178
NP_442542.1_9 Reverse -197 -211 9.14375 0.141
NP_442903.1_2 Forward -20 -1 2.62561 0.273
NP_441878.1_6 Reverse -203 -213 -7.98478 0.285
NP_442066.2_4 Forward -213 -194 -9.24366 0.296
NP_442777.1_10 Reverse -365 -384 14.6508 0.252
NP_441308.1_8 Reverse -202 -212 9.61647 0.226
NP_441458.1_10 Forward -222 -203 2.16274 0.273
NP_442183.1_3 Forward -114 -95 14.0599 0.249
NP_441819.1_5 Forward -165 -146 11.3154 0.261
NP_442347.1_2 Forward -221 -212 6.98123 0.138
NP_441037.1_4 Reverse -202 -212 11.0211 0.17
NP_442594.1_8 Reverse -98 -117 2.26107 0.295
NP_441728.2_4 Reverse -157 -176 11.8883 0.279
NP_441007.1_10 Reverse -199 -212 1.69091 0.203
NP_440256.1_1 Reverse -188 -207 -7.37537 0.234
NP_440087.1_1 Reverse -204 -223 -9.34199 0.296
NP_440456.1_7 Reverse -298 -312 9.83269 0.294
NP_441559.1_8 Forward -217 -203 -4.4253 0.223
NP_441270.1_5 Forward -326 -307 12.4087 0.237
NP_440915.1_6 Reverse -200 -214 2.2612 0.121
NP_442158.1_4 Forward -325 -315 13.353 0.234
NP_441866.1_6 Forward -169 -150 7.76679 0.265
NP_442069.1_7 Reverse -81 -100 12.6833 0.201
NP_441464.1_10 Forward -289 -275 8.25939 0.286
NP_441464.1_10 Reverse -105 -119 7.86607 0.287
NP_440306.1_8 Reverse -80 -99 4.62021 0.204
NP_442957.1_9 Reverse -358 -377 9.83255 0.189
NP_442386.1_9 Forward -117 -108 7.57079 0.219
NP_442386.1_9 Forward -214 -205 6.58748 0.219
NP_441340.1_9 Forward -18 -8 8.06241 0.256
NP_442484.1_2 Forward -211 -192 5.70265 0.163
NP_443051.1_1 Reverse -203 -212 0.0980582 0.226
NP_439984.1_5 Reverse -104 -123 16.7157 0.235
NP_439984.1_8 Reverse -140 -158 15.8504 0.265
NP_439937.1_8 Reverse -202 -221 -4.42544 0.284
NP_439937.1_9 Reverse -83 -100 -11.2699 0.248
NP_440398.1_6 Reverse -87 -106 3.14605 0.294
NP_442239.1_8 Reverse -197 -216 9.93088 0.249
NP_440316.1_10 Reverse -203 -213 5.78156 0.281
NP_441803.1_2 Forward -218 -199 6.58763 0.151
NP_441803.1_2 Reverse -192 -211 -1.37718 0.298
NP_439977.1_5 Forward -219 -200 5.50599 0.15
NP_441572.1_3 Forward -210 -191 10.2259 0.252
NP_441572.1_7 Reverse -198 -217 3.93269 0.108
NP_442384.1_10 Reverse -191 -204 4.05085 0.17
NP_440364.1_6 Forward -207 -194 14.7683 0.275
NP_441877.1_5 Forward -85 -66 -0.688862 0.279
NP_441877.1_9 Forward -87 -70 1.90713 0.292
NP_441018.1_7 Forward -204 -185 14.2574 0.125
NP_442262.1_10 Reverse -205 -212 9.47889 0.187
NP_442165.1_2 Forward -330 -317 17.8172 0.21
NP_440282.1_3 Reverse -361 -380 1.96607 0.275
NP_441592.1_4 Reverse -265 -284 5.30933 0.135
NP_440894.1_10 Forward -395 -376 3.44104 0.272
NP_440999.1_9 Forward -217 -203 9.04604 0.0683
NP_440888.1_2 Forward -213 -199 14.5519 0.0168
NP_442818.1_3 Forward -89 -72 -5.46769 0.284
NP_442807.1_10 Forward -157 -143 13.8643 0.238
NP_441543.1_2 Forward -212 -203 4.0313 0.293
NP_442845.1_2 Reverse -198 -212 4.32615 0.261
NP_441551.1_5 Forward -217 -201 7.33433 0.249
NP_440982.1_1 Forward -213 -194 3.34192 0.297
NP_441469.1_8 Forward -214 -205 5.3096 0.277
NP_442204.1_1 Reverse -200 -211 0.746988 0.281
NP_442204.1_5 Forward -391 -372 0.786102 0.252
NP_440516.1_8 Reverse -204 -213 -0.491928 0.262
NP_442428.1_5 Reverse -205 -212 4.66067 0.244
NP_441052.1_2 Reverse -137 -147 0.57002 0.256
NP_441004.1_1 Reverse -198 -217 -0.688862 0.124
NP_441004.1_9 Reverse -311 -329 14.6979 0.223
NP_442813.1_4 Forward -296 -277 -6.68705 0.299
NP_441851.1_10 Reverse -299 -309 5.5849 0.207
NP_441542.1_4 Forward -159 -145 4.42448 0.264
NP_441668.1_4 Reverse -291 -310 -0.000545616 0.248
NP_441668.1_5 Reverse -72 -91 9.24257 0.232
NP_440432.1_9 Forward -212 -197 -4.445 0.209
NP_442843.1_1 Reverse -99 -118 -9.34199 0.265
NP_440588.1_2 Forward -222 -203 -4.6221 0.223
NP_440483.1_1 Forward -292 -273 -1.96717 0.208
NP_441078.1_4 Reverse -204 -213 -2.06522 0.295
NP_442443.1_1 Reverse -196 -215 -4.91709 0.28
NP_440526.1_3 Forward -212 -201 2.6148 0.267
NP_441432.1_8 Reverse -203 -212 4.32629 0.223
NP_441432.1_9 Reverse -1 -14 15.0945 0.14
NP_441333.1_1 Reverse -10 -20 15.975 0.169
NP_441732.1_2 Reverse -375 -391 -16.0677 0.164
NP_440913.1_1 Forward -202 -184 5.42735 0.241
NP_440713.1_4 Forward -398 -379 5.80098 0.202
NP_442489.1_7 Reverse -204 -213 -1.57357 0.213
NP_440565.1_1 Forward -101 -82 16.8141 0.253
NP_440786.1_9 Forward -165 -146 14.9458 0.222
NP_441800.1_7 Forward -121 -103 -3.32411 0.275
NP_441185.1_6 Forward -392 -373 1.86774 0.209
NP_442346.1_5 Forward -201 -191 4.50326 0.286
NP_440352.1_2 Forward -71 -52 17.958 0.056
NP_440545.1_3 Reverse -200 -217 -6.746 0.287
NP_440459.1_2 Reverse -189 -206 9.18362 0.233
NP_441329.1_1 Forward -170 -151 5.39487 0.265
NP_441895.1_10 Reverse -148 -167 -19.1751 0.282
NP_442699.1_8 Reverse -208 -227 -10.1286 0.238
NP_442943.1_1 Forward -151 -136 11.5276 0.169
NP_442140.1_3 Reverse -205 -215 5.28991 0.216
NP_442021.1_3 Forward -375 -356 -6.58872 0.257
NP_441813.1_5 Forward -215 -205 -0.216628 0.237
NP_440590.1_4 Reverse -192 -205 -2.63565 0.247
NP_441239.1_9 Forward -215 -203 4.66053 0.248
NP_441239.1_9 Reverse -202 -214 3.2839 0.289
NP_442568.1_8 Reverse -361 -375 11.5043 0.257
NP_441892.1_1 Reverse -195 -212 3.0871 0.131
NP_441769.1_3 Forward -81 -62 -0.0996487 0.221
NP_442052.1_7 Forward -326 -312 16.8142 0.153
NP_442340.1_3 Reverse -61 -80 -2.75381 0.205
NP_440868.1_4 Forward -217 -205 1.21895 0.19
NP_441474.1_1 Forward -214 -195 1.47364 0.247
NP_442402.1_2 Reverse -85 -99 13.1753 0.263
NP_442402.1_4 Reverse -80 -99 17.0099 0.0585
NP_442402.1_4 Reverse -81 -100 -7.76943 0.278
NP_442402.1_10 Forward -80 -70 10.5993 0.287
NP_442402.1_10 Reverse -88 -98 10.4026 0.29
NP_441848.1_4 Forward -233 -217 7.07321 0.297
NP_441811.1_8 Forward -200 -186 7.57108 0.241
NP_441811.1_8 Forward -316 -302 6.88276 0.259
NP_442679.1_1 Forward -20 -1 -2.26216 0.24
NP_442829.1_2 Reverse -327 -343 8.04446 0.287
NP_442532.1_4 Reverse -282 -300 12.0371 0.223
NP_440914.1_1 Reverse -367 -377 7.24882 0.242
NP_441011.1_8 Forward -380 -371 8.84951 0.144
NP_441011.1_8 Forward -387 -378 8.06287 0.16
NP_442533.1_1 Reverse -98 -117 -3.63879 0.14
NP_442533.1_1 Reverse -97 -116 -13.8652 0.239
NP_442533.1_6 Reverse -210 -219 8.35786 0.0767
NP_440263.1_1 Forward -229 -216 16.0454 0.253
NP_439944.1_9 Forward -199 -189 10.5014 0.0887
NP_441028.1_6 Reverse -89 -99 5.78111 0.243
NP_441527.1_4 Reverse -337 -356 -1.95801 0.152
NP_441527.1_4 Forward -20 -1 -7.21006 0.231
NP_441527.1_4 Reverse -327 -346 -12.8441 0.294
NP_441527.1_4 Reverse -155 -174 -13.1306 0.298
NP_440007.1_9 Reverse -363 -377 1.76955 0.285
NP_441347.1_5 Reverse -299 -313 8.16044 0.298
NP_442492.1_2 Reverse -107 -126 -0.0988766 0.248
NP_441602.1_3 Forward -218 -199 -1.47551 0.227
NP_441602.1_3 Forward -393 -374 -4.42544 0.265
NP_441106.1_1 Reverse -203 -212 5.60459 0.141
NP_440429.1_9 Forward -113 -94 7.47261 0.211
NP_441705.1_3 Forward -111 -92 -5.70374 0.291
NP_440886.1_7 Forward -214 -204 15.6142 0.0243
NP_440828.1_4 Reverse -181 -200 -4.52452 0.246
NP_442072.1_9 Forward -214 -196 -13.7472 0.121
NP_442295.1_7 Forward -116 -98 12.998 0.289
NP_442211.1_3 Reverse -192 -211 15.4476 0.216
NP_441431.1_2 Forward -216 -202 10.422 0.159
NP_441836.1_2 Reverse -185 -204 -5.40875 0.279
NP_441993.1_1 Reverse -198 -217 1.4594 0.276
NP_442437.1_4 Reverse -186 -205 11.5042 0.231
NP_442833.1_2 Forward -347 -329 16.9313 0.235
NP_440766.1_4 Reverse -200 -214 6.98109 0.097
NP_442867.1_8 Forward -110 -91 9.83255 0.215
NP_440942.1_3 Forward -102 -83 21.2389 0.0271
NP_441332.1_6 Forward -117 -107 13.4862 0.184
NP_440554.1_4 Forward -212 -202 2.63497 0.258
NP_441173.1_9 Reverse -90 -98 12.0154 0.214
NP_441173.1_9 Forward -158 -150 11.0321 0.228
NP_441173.1_9 Reverse -149 -157 11.0321 0.228
NP_441173.1_9 Reverse -80 -88 9.75379 0.284
NP_440191.1_4 Forward -167 -157 12.6633 0.291
NP_440750.1_5 Reverse -156 -170 13.1759 0.159
NP_442513.1_5 Reverse -202 -221 6.29183 0.282
NP_441842.1_10 Reverse -197 -211 6.48943 0.286
NP_440091.1_1 Reverse -187 -199 -0.551008 0.278
NP_441902.1_3 Forward -99 -89 16.2857 0.159
NP_440679.1_10 Reverse -197 -216 -19.8634 0.283
NP_441359.1_5 Forward -216 -197 2.26107 0.272
NP_441207.1_7 Forward -15 -1 10.3203 0.263
NP_441105.1_3 Forward -224 -205 -4.32711 0.198
NP_441105.1_3 Reverse -193 -212 -10.0303 0.3
NP_442015.1_10 Reverse -15 -28 2.67422 0.187
NP_442015.1_10 Forward -38 -25 -0.669033 0.277
NP_441226.1_7 Forward -115 -108 5.34865 0.289
NP_441766.1_2 Forward -213 -204 4.62128 0.172
NP_443052.1_9 Forward -217 -198 3.53937 0.162
NP_440591.1_3 Reverse -27 -45 -2.73412 0.226
NP_440591.1_9 Forward -220 -202 6.41066 0.218
NP_442226.1_8 Forward -342 -332 15.6147 0.167
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCACCTGGGTTGCTATCCGTTATGGCTTTGCCTTTCAGTTAGTACCTGCTTTTACTTTGTTTGGCAGTATTGGTTTTACCGGGGCGGTATTGATTCGCCAAAGTTGCCATATTCTTTGGGGTCTATCCATTAAGGAAAGGAATAATCTCATTCGAGGTACGGCTAGAATTCGTAAAATTGGTCCCCGCCATCTCCTCTGGCGTTGGTTATTCCGTTAAAGCAGGCAGGATTTTTCAACCTTTTTGCAAAATTGTTGATAGTCTAAAAGCCTCTTTTAAAAGCCCCCAACCCACCCAACTTTGGGGAGAAACTGGGTAAAGTTTCCTCAGTATTACCGGAGTAATTTAGGGGCGGAATCAAACTTTCTGAAGACCTTCCAAAACGAAAAATTAGCAAAA

CDS

GTGGTCCAACTAAGTCTGAGTCAAGTTCACCAAGACCAAATTTATCGCCATGGGGAACGGTGTTATCCGGAGGAATGTTGTGGTCTTTTACTGGGGAAAATATTAATTGGAGAAAATGGTCATCGCCATTGGCAAGTAGTCGAAGTACAGCCAACGGAAAATTGCTGGGGTGATGTGGAAGAATTTCAGCAGAATAATCATCAGGGAAATAAGTTACATTACTTTGCCATTGACCCCAAAGTTTTGCTTTCCGCCCAAAAAGATTGCCGCCAAAAAGGGTTAAGCATTATCGGTATTTTCCATTCCCATCCCCATGGCCAGCCCATACCGTCAGAATTTGATCGGGCCATTGCTTGGCCAGAATATATTTACCTCATTGCTTCCGGTGAAAATGGAAGGTTCAATACCAGTAGAAGTTGGTACTTAAACGAAGCAGGAAACTTTATGGAAGTGGACTCAACGTTGTTGCTGTAA

Protein

MVQLSLSQVHQDQIYRHGERCYPEECCGLLLGKILIGENGHRHWQVVEVQPTENCWGDVEEFQQNNHQGNKLHYFAIDPKVLLSAQKDCRQKGLSIIGIFHSHPHGQPIPSEFDRAIAWPEYIYLIASGENGRFNTSRSWYLNEAGNFMEVDSTLLL