Your browser is old and dusty. Try Google Chrome!

Details for sll0858

ORF sll0858
Accession NP_441111.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -117 -103 2.2612 0.178
NP_441061.1_2 Reverse -116 -130 0.294584 0.213
NP_441061.1_2 Reverse -170 -184 -0.393733 0.228
NP_440795.1_7 Forward -117 -110 14.6904 0.0123
NP_440795.1_7 Reverse -110 -117 14.6904 0.0123
NP_441418.1_6 Forward -118 -99 -19.0768 0.0844
NP_441418.1_6 Forward -281 -262 -21.1417 0.139
NP_441418.1_6 Reverse -97 -116 -29.1065 0.216
NP_442291.1_5 Reverse -108 -124 8.71166 0.0558
NP_440897.1_6 Reverse -109 -128 6.98015 0.0883
NP_440897.1_6 Reverse -272 -291 -3.04956 0.231
NP_441453.1_4 Reverse -109 -117 16.539 0.00633
NP_441453.1_4 Forward -118 -110 16.539 0.00633
NP_441453.1_4 Forward -281 -273 11.8191 0.0367
NP_441453.1_4 Reverse -169 -177 4.24765 0.259
NP_441453.1_7 Reverse -266 -273 12.9205 0.23
NP_441623.1_1 Forward -375 -357 -3.32411 0.258
NP_442151.1_6 Reverse -109 -123 10.0294 0.133
NP_442151.1_6 Forward -118 -104 8.25939 0.178
NP_442151.1_6 Forward -281 -267 5.30946 0.284
NP_441818.1_1 Reverse -110 -121 9.79292 0.232
NP_441818.1_9 Reverse -18 -37 -5.11376 0.248
NP_440226.1_1 Reverse -109 -128 3.04771 0.241
NP_440226.1_1 Forward -118 -99 2.55606 0.259
NP_442744.1_8 Reverse -250 -269 -0.787193 0.258
NP_442655.1_1 Forward -286 -267 -1.47551 0.272
NP_442173.1_1 Forward -117 -109 15.4574 0.00633
NP_442173.1_1 Reverse -110 -118 15.4574 0.00633
NP_442752.1_4 Forward -118 -111 13.8055 0.0199
NP_442752.1_4 Reverse -109 -116 13.8055 0.0199
NP_442752.1_4 Reverse -272 -279 10.8555 0.0846
NP_442752.1_4 Reverse -250 -257 8.20058 0.127
NP_443027.1_4 Reverse -107 -117 5.87989 0.294
NP_441745.1_3 Forward -150 -131 16.1249 0.215
NP_442975.1_10 Reverse -105 -119 20.3534 0.00216
NP_440784.1_7 Forward -117 -110 15.9687 0.0123
NP_440784.1_7 Reverse -110 -117 15.9687 0.0123
NP_442909.1_7 Reverse -255 -269 7.3738 0.219
NP_440061.1_9 Reverse -107 -121 12.192 0.0999
NP_440061.1_9 Reverse -365 -379 4.91554 0.3
NP_440110.1_4 Forward -129 -110 1.37609 0.288
NP_441054.1_2 Forward -376 -357 11.8975 0.254
NP_441476.1_5 Reverse -104 -123 4.62101 0.17
NP_440878.1_9 Forward -128 -109 -3.63879 0.299
NP_442062.1_8 Forward -118 -108 19.4496 0.000558
NP_442062.1_8 Reverse -109 -119 17.3846 0.00193
NP_442062.1_8 Reverse -169 -179 9.91146 0.0554
NP_442062.1_8 Forward -281 -271 4.50326 0.212
NP_441859.1_3 Forward -119 -100 5.50519 0.198
NP_440304.1_4 Forward -120 -110 1.84832 0.299
NP_440304.1_4 Reverse -107 -117 1.84832 0.299
NP_442242.1_4 Forward -117 -110 14.3954 0.0124
NP_442242.1_4 Reverse -110 -117 14.3954 0.0124
NP_440044.1_8 Reverse -110 -129 19.6656 0.0159
NP_440044.1_8 Forward -117 -98 13.2741 0.0358
NP_441781.1_7 Reverse -109 -128 -0.885524 0.267
NP_441781.1_7 Forward -118 -99 -2.95047 0.29
NP_439918.1_2 Forward -136 -117 -0.787193 0.236
NP_439918.1_2 Forward -184 -165 -3.24547 0.251
NP_441208.1_9 Forward -121 -107 6.78443 0.229
NP_441208.1_9 Forward -74 -60 5.40779 0.267
NP_442742.1_9 Forward -69 -50 -9.24366 0.269
NP_442276.1_2 Reverse -234 -253 3.73603 0.299
NP_442110.1_7 Reverse -97 -111 6.6861 0.136
NP_442110.1_7 Forward -118 -104 2.35953 0.222
NP_442110.1_7 Reverse -109 -123 -0.197071 0.276
NP_441925.1_4 Reverse -128 -147 -6.88445 0.185
NP_440856.1_4 Forward -276 -257 -3.14714 0.226
NP_441083.1_5 Reverse -109 -119 20.3345 0.00053
NP_441083.1_5 Forward -118 -108 11.3864 0.0159
NP_441083.1_5 Forward -281 -271 8.23984 0.0429
NP_441083.1_5 Reverse -272 -282 7.05986 0.067
NP_441083.1_5 Reverse -71 -81 -0.41329 0.267
NP_441738.1_2 Forward -116 -109 15.28 0.0102
NP_441738.1_2 Reverse -111 -118 15.28 0.0102
NP_441558.1_5 Forward -283 -264 14.8474 0.0467
NP_441955.1_8 Forward -84 -67 5.84037 0.287
NP_440209.1_1 Reverse -109 -117 18.1123 0.00295
NP_440209.1_1 Forward -118 -110 18.1123 0.00295
NP_442889.1_8 Reverse -106 -120 22.025 0.00162
NP_440447.1_6 Reverse -52 -70 0.0191479 0.299
NP_441713.1_1 Reverse -103 -122 0.982764 0.0778
NP_441713.1_1 Forward -287 -268 -16.9135 0.289
NP_442570.1_3 Forward -186 -167 -2.85214 0.215
NP_442570.1_3 Forward -181 -162 -6.58872 0.258
NP_441792.1_1 Reverse -162 -181 7.86593 0.176
NP_441716.1_1 Reverse -272 -286 9.83269 0.105
NP_441716.1_1 Reverse -109 -123 7.07942 0.181
NP_442111.1_4 Forward -119 -105 10.7177 0.0518
NP_442111.1_4 Forward -282 -268 6.98109 0.108
NP_441624.1_7 Reverse -164 -178 9.5377 0.218
NP_441624.1_7 Reverse -15 -29 5.99778 0.296
NP_441163.1_1 Reverse -114 -131 8.98622 0.226
NP_440851.1_6 Reverse -364 -381 2.10379 0.288
NP_440906.1_5 Forward -117 -110 15.8704 0.0124
NP_440906.1_5 Reverse -110 -117 15.8704 0.0124
NP_440747.1_10 Forward -121 -109 14.9853 0.00221
NP_440747.1_10 Reverse -106 -118 5.44718 0.0137
NP_440747.1_10 Reverse -269 -281 -4.18925 0.0817
NP_440747.1_10 Forward -181 -169 -4.58258 0.109
NP_440747.1_10 Forward -284 -272 -11.8591 0.161
NP_440747.1_10 Reverse -166 -178 -12.3507 0.27
NP_440747.1_10 Reverse -5 -17 -12.3507 0.27
NP_441486.1_1 Reverse -106 -120 22.9107 0.00162
NP_441486.1_1 Forward -121 -107 22.5174 0.00162
NP_441486.1_1 Forward -284 -270 -6.29359 0.288
NP_442634.1_4 Reverse -270 -284 -5.21195 0.241
NP_442634.1_4 Reverse -95 -109 -5.31028 0.246
NP_441265.1_1 Reverse -255 -274 -11.6036 0.229
NP_441014.1_10 Reverse -340 -359 -2.26292 0.274
NP_442848.1_1 Forward -124 -110 -2.45868 0.263
NP_442848.1_1 Reverse -103 -117 -3.24533 0.263
NP_442848.1_5 Reverse -162 -180 3.95239 0.276
NP_441012.1_4 Forward -257 -244 7.29578 0.272
NP_443018.1_3 Forward -117 -110 14.8871 0.0123
NP_443018.1_3 Reverse -110 -117 14.8871 0.0123
NP_443018.1_3 Reverse -170 -177 10.7572 0.0907
NP_443018.1_3 Forward -280 -273 10.4622 0.103
NP_443018.1_3 Forward -177 -170 4.56234 0.241
NP_443018.1_3 Reverse -273 -280 4.36568 0.254
NP_441634.1_8 Forward -120 -106 5.21113 0.114
NP_440376.1_1 Forward -118 -109 19.4693 0.000692
NP_440376.1_1 Reverse -109 -118 19.4693 0.000692
NP_440376.1_1 Reverse -272 -281 12.4878 0.0191
NP_440376.1_1 Forward -281 -272 -0.196935 0.285
NP_441588.1_4 Forward -116 -106 16.4996 0.0369
NP_441588.1_4 Reverse -111 -121 8.92815 0.14
NP_443065.1_6 Forward -274 -255 2.75272 0.221
NP_442687.1_7 Reverse -108 -118 15.8113 0.0125
NP_442687.1_7 Forward -119 -109 8.92815 0.0994
NP_442687.1_7 Forward -282 -272 7.15819 0.138
NP_442687.1_7 Reverse -271 -281 6.76487 0.154
NP_442191.1_4 Reverse -369 -383 10.9931 0.276
NP_441846.1_10 Forward -178 -159 -20.7484 0.256
NP_441846.1_10 Forward -179 -160 -21.7317 0.256
NP_441846.1_10 Reverse -261 -280 -22.8133 0.266
NP_441846.1_10 Reverse -262 -281 -23.1083 0.277
NP_440781.1_1 Reverse -243 -257 17.5025 0.167
NP_441013.1_2 Reverse -164 -182 2.0841 0.242
NP_441013.1_3 Forward -190 -171 5.50599 0.291
NP_441422.1_7 Reverse -167 -184 -1.63279 0.194
NP_441422.1_7 Reverse -95 -112 -2.02611 0.204
NP_441422.1_7 Forward -272 -255 -5.27103 0.247
NP_442735.1_2 Forward -123 -104 2.94938 0.279
NP_440533.1_9 Reverse -250 -269 8.35759 0.168
NP_440667.1_2 Forward -164 -145 -9.047 0.297
NP_442296.1_9 Reverse -110 -129 10.4225 0.0914
NP_441763.1_10 Reverse -98 -117 4.71854 0.3
NP_442658.1_1 Reverse -107 -117 15.9091 0.00966
NP_442658.1_1 Forward -120 -110 6.76441 0.214
NP_442198.1_3 Forward -130 -111 7.07928 0.251
NP_440662.1_2 Reverse -200 -219 2.3594 0.19
NP_442782.1_2 Forward -178 -164 15.2409 0.173
NP_442782.1_2 Reverse -261 -275 6.58777 0.222
NP_442496.1_4 Forward -97 -83 18.8841 0.27
NP_442205.1_9 Forward -167 -151 -1.90808 0.264
NP_441414.1_9 Reverse -109 -128 -3.54046 0.138
NP_441487.1_6 Reverse -264 -283 -2.16383 0.288
NP_442937.1_5 Reverse -104 -123 11.1109 0.145
NP_442937.1_5 Reverse -91 -110 6.09597 0.288
NP_441958.1_2 Reverse -199 -218 11.6025 0.218
NP_441958.1_5 Forward -119 -109 12.2714 0.00183
NP_441958.1_5 Reverse -108 -118 12.2714 0.00183
NP_441958.1_5 Reverse -271 -281 8.53483 0.0266
NP_441958.1_5 Forward -282 -272 0.865012 0.12
NP_440318.1_1 Reverse -8 -27 5.211 0.226
NP_442836.1_8 Reverse -84 -99 18.6628 0.181
NP_440203.1_5 Forward -278 -268 16.3025 0.0611
NP_440203.1_5 Reverse -172 -182 11.8776 0.171
NP_440203.1_5 Reverse -112 -122 9.71433 0.245
NP_439905.1_1 Forward -258 -245 9.65572 0.216
NP_439905.1_2 Forward -264 -250 17.4042 0.188
NP_440984.1_7 Forward -123 -109 11.701 0.122
NP_442376.1_2 Reverse -255 -274 -4.03212 0.234
NP_442911.1_2 Forward -128 -109 -4.13045 0.126
NP_441580.1_6 Reverse -98 -117 3.73603 0.117
NP_440153.1_5 Reverse -110 -124 3.93283 0.199
NP_441591.1_10 Reverse -187 -206 5.80098 0.295
NP_442064.1_4 Reverse -159 -178 7.27514 0.242
NP_443055.1_6 Forward -95 -77 0.116744 0.249
NP_442002.1_1 Forward -175 -157 -2.53746 0.205
NP_442002.1_9 Reverse -108 -115 10.7572 0.185
NP_441294.1_7 Reverse -105 -119 19.6174 0.00271
NP_441294.1_7 Reverse -112 -126 11.8423 0.124
NP_441294.1_7 Forward -122 -108 11.2664 0.15
NP_440411.1_10 Forward -138 -119 11.628 0.264
NP_441646.1_1 Reverse -102 -121 1.67108 0.23
NP_442438.1_10 Forward -123 -109 11.3077 0.0463
NP_442438.1_10 Reverse -104 -118 9.5377 0.0627
NP_441292.1_2 Forward -387 -368 -11.5053 0.296
NP_441000.1_6 Reverse -108 -122 3.24451 0.116
NP_441000.1_6 Forward -119 -105 -3.34366 0.221
NP_440147.1_4 Reverse -107 -120 12.704 0.0326
NP_440147.1_4 Forward -120 -107 10.1474 0.0355
NP_440147.1_4 Forward -180 -167 3.36254 0.188
NP_440147.1_4 Forward -219 -206 2.57589 0.207
NP_440147.1_4 Reverse -270 -283 1.9859 0.213
NP_441175.1_2 Forward -193 -174 7.96426 0.226
NP_441550.1_8 Forward -120 -110 14.6309 0.0132
NP_441550.1_8 Forward -283 -273 11.2876 0.052
NP_441550.1_8 Reverse -107 -117 8.3377 0.124
NP_441550.1_8 Reverse -270 -280 6.66608 0.198
NP_441916.1_7 Forward -118 -108 18.4663 0.00144
NP_441916.1_7 Reverse -109 -119 10.3048 0.0261
NP_441916.1_7 Reverse -272 -282 4.40493 0.178
NP_441916.1_7 Forward -178 -168 3.91327 0.198
NP_441041.1_4 Forward -118 -99 5.30933 0.0518
NP_441041.1_4 Forward -281 -262 -8.45701 0.203
NP_441041.1_4 Reverse -97 -116 -10.7186 0.236
NP_441041.1_7 Reverse -106 -118 18.9817 0.00435
NP_441041.1_7 Reverse -269 -281 5.08534 0.278
NP_442396.1_5 Forward -122 -109 10.7374 0.106
NP_441547.1_2 Forward -129 -111 7.59063 0.215
NP_442004.1_6 Reverse -109 -123 8.35772 0.142
NP_442004.1_6 Forward -269 -255 2.94952 0.254
NP_441725.1_4 Forward -274 -260 3.93223 0.278
NP_441725.1_5 Forward -117 -107 2.04498 0.115
NP_441725.1_5 Reverse -273 -283 2.04498 0.115
NP_441725.1_5 Reverse -110 -120 2.04498 0.115
NP_441725.1_5 Forward -280 -270 -0.609952 0.265
NP_439966.1_7 Reverse -107 -117 9.91099 0.0968
NP_439966.1_7 Forward -120 -110 7.25606 0.15
NP_439966.1_7 Forward -283 -273 4.50281 0.269
NP_439966.1_9 Reverse -107 -116 0.884706 0.253
NP_442941.1_3 Reverse -110 -120 11.0914 0.0116
NP_442941.1_3 Forward -117 -107 2.63497 0.14
NP_440289.1_2 Reverse -106 -119 12.6056 0.0139
NP_440289.1_2 Forward -20 -7 3.65753 0.0754
NP_440289.1_2 Forward -284 -271 -3.71729 0.267
NP_440983.1_5 Forward -111 -92 -7.37537 0.288
NP_440260.1_8 Forward -134 -116 -3.91409 0.26
NP_440260.1_8 Reverse -263 -281 -7.15901 0.295
NP_441678.1_9 Forward -179 -160 7.37428 0.17
NP_441678.1_9 Forward -136 -117 -2.55715 0.26
NP_442281.1_1 Reverse -104 -118 19.0751 0.00329
NP_442281.1_1 Reverse -267 -281 8.55376 0.0798
NP_442281.1_1 Reverse -164 -178 7.66879 0.0949
NP_442281.1_1 Forward -183 -169 6.0955 0.136
NP_442012.1_1 Forward -124 -105 8.65258 0.0986
NP_442012.1_2 Forward -251 -232 5.89931 0.211
NP_442012.1_5 Forward -179 -160 -0.197208 0.288
NP_441556.1_4 Reverse -263 -282 9.81228 0.293
NP_441556.1_10 Reverse -164 -178 10.1245 0.275
NP_441556.1_10 Forward -123 -109 9.44312 0.298
NP_440375.1_8 Forward -177 -158 2.26107 0.23
NP_441644.1_6 Reverse -109 -119 17.3841 0.00127
NP_441644.1_6 Forward -281 -271 13.6475 0.0181
NP_441644.1_6 Forward -118 -108 10.1076 0.0628
NP_441644.1_6 Reverse -169 -179 9.321 0.0799
NP_441644.1_6 Reverse -272 -282 4.40448 0.239
NP_442215.1_2 Reverse -107 -123 14.7098 0.0195
NP_442215.1_2 Forward -120 -104 9.49831 0.0565
NP_442215.1_2 Forward -283 -267 0.156866 0.156
NP_442215.1_2 Forward -290 -274 -2.49807 0.198
NP_442177.1_5 Reverse -100 -114 15.8309 0.22
NP_442029.1_6 Forward -183 -164 11.6025 0.158
NP_440929.1_8 Forward -118 -109 19.2726 0.000701
NP_440929.1_8 Reverse -109 -118 19.2726 0.000701
NP_440929.1_8 Forward -281 -272 6.68623 0.0887
NP_442933.1_10 Forward -118 -109 17.601 0.00325
NP_442933.1_10 Reverse -109 -118 17.601 0.00325
NP_442933.1_10 Reverse -272 -281 4.62128 0.227
NP_442933.1_10 Forward -178 -169 4.52295 0.24
NP_441751.2_8 Reverse -273 -287 -4.4253 0.173
NP_442926.1_1 Forward -255 -236 -5.9004 0.278
NP_442554.1_8 Reverse -110 -120 15.3197 0.00882
NP_442554.1_8 Forward -117 -107 13.2547 0.0187
NP_442554.1_8 Reverse -273 -283 11.3864 0.0365
NP_442554.1_8 Reverse -170 -180 4.99491 0.163
NP_442554.1_8 Forward -280 -270 3.32329 0.23
NP_441762.1_7 Forward -119 -107 10.1671 0.0142
NP_441762.1_7 Reverse -108 -120 9.57708 0.0142
NP_442142.1_4 Reverse -106 -119 12.605 0.0434
NP_442142.1_4 Forward -121 -108 5.62358 0.187
NP_442142.1_4 Reverse -166 -179 4.54195 0.217
NP_442142.1_4 Forward -181 -168 3.06699 0.268
NP_442142.1_4 Forward -90 -77 2.28034 0.295
NP_442292.1_1 Reverse -110 -119 18.486 0.00229
NP_442292.1_1 Forward -117 -108 9.63616 0.0183
NP_442292.1_1 Reverse -170 -179 5.70292 0.135
NP_442476.1_6 Reverse -110 -124 12.586 0.0469
NP_443009.1_5 Forward -119 -108 18.3477 0.00265
NP_443009.1_5 Forward -179 -168 6.64635 0.154
NP_443009.1_5 Forward -282 -271 6.44969 0.161
NP_441715.1_4 Forward -117 -107 9.41981 0.097
NP_441715.1_4 Reverse -110 -120 7.94484 0.107
NP_440357.1_6 Forward -42 -23 10.1275 0.272
NP_440881.1_4 Reverse -49 -68 7.66927 0.226
NP_443034.1_3 Reverse -219 -238 13.8641 0.209
NP_440730.1_4 Forward -72 -53 1.76941 0.237
NP_440183.1_9 Reverse -369 -388 -12.0953 0.256
NP_440464.1_10 Reverse -110 -120 13.0082 0.169
NP_441468.1_1 Forward -117 -110 15.8704 0.0124
NP_441468.1_1 Reverse -110 -117 15.8704 0.0124
NP_441468.1_1 Reverse -273 -280 4.07068 0.263
NP_441468.1_1 Forward -177 -170 4.07068 0.263
NP_441020.2_6 Forward -120 -103 5.9387 0.284
NP_441015.1_10 Forward -183 -164 8.25926 0.0897
NP_441015.1_10 Reverse -104 -123 -6.29373 0.245
NP_441015.1_10 Forward -177 -158 -9.34199 0.282
NP_441673.1_1 Forward -118 -109 20.8459 0.000698
NP_441673.1_1 Reverse -109 -118 20.8459 0.000698
NP_441673.1_1 Reverse -272 -281 1.37636 0.114
NP_441673.1_1 Forward -281 -272 1.1797 0.163
NP_441876.1_9 Forward -197 -187 11.1893 0.28
NP_441826.1_2 Forward -124 -110 3.8345 0.105
NP_441826.1_2 Reverse -103 -117 -4.4253 0.296
NP_441826.1_5 Reverse -241 -260 2.0644 0.276
NP_441330.1_1 Reverse -164 -183 -8.16202 0.183
NP_441330.1_1 Forward -123 -104 -10.6203 0.183
NP_442868.1_6 Forward -120 -110 9.81313 0.038
NP_442868.1_6 Reverse -107 -117 0.865012 0.205
NP_441251.1_8 Reverse -320 -333 14.3856 0.254
NP_441612.1_2 Reverse -109 -119 8.54929 0.21
NP_441612.1_2 Forward -17 -7 6.61303 0.283
NP_442227.1_2 Reverse -128 -147 6.98095 0.198
NP_442808.1_1 Reverse -108 -118 18.4657 0.00201
NP_442808.1_1 Forward -119 -109 8.63269 0.0481
NP_442808.1_1 Forward -282 -272 6.76441 0.0982
NP_442808.1_1 Reverse -366 -376 5.09279 0.173
NP_442808.1_1 Reverse -259 -269 2.73286 0.256
NP_442542.1_2 Reverse -270 -283 10.4424 0.126
NP_442542.1_3 Forward -299 -280 19.8614 0.225
NP_442050.1_5 Forward -120 -110 7.64939 0.243
NP_441114.1_3 Forward -279 -270 7.57121 0.231
NP_441114.1_3 Reverse -171 -180 7.37455 0.239
NP_440558.1_2 Reverse -166 -185 -2.45882 0.227
NP_440558.1_2 Forward -268 -249 -7.67036 0.298
NP_441878.1_6 Reverse -271 -281 11.4848 0.0176
NP_441878.1_6 Forward -119 -109 10.4031 0.0176
NP_441878.1_6 Reverse -108 -118 10.4031 0.0176
NP_441878.1_6 Forward -282 -272 9.41981 0.0266
NP_441878.1_6 Forward -260 -250 -1.10161 0.191
NP_441878.1_6 Forward -179 -169 -7.59145 0.245
NP_441036.1_8 Reverse -108 -118 17.7779 0.000554
NP_441036.1_8 Forward -119 -109 8.33817 0.174
NP_441557.1_5 Forward -118 -109 19.9609 0.000699
NP_441557.1_5 Reverse -109 -118 19.9609 0.000699
NP_441557.1_5 Reverse -272 -281 0.491382 0.144
NP_441557.1_5 Forward -281 -272 0.29472 0.174
NP_441557.1_5 Forward -178 -169 -0.786921 0.239
NP_441445.1_1 Reverse -100 -119 8.06259 0.122
NP_441445.1_1 Forward -290 -271 4.62101 0.191
NP_441445.1_1 Forward -127 -108 2.26107 0.238
NP_441445.1_1 Forward -187 -168 1.96607 0.245
NP_442066.2_4 Forward -178 -159 -8.752 0.296
NP_441433.1_8 Forward -381 -362 -4.42544 0.294
NP_440101.1_3 Forward -123 -104 11.6025 0.0998
NP_440101.1_3 Forward -183 -164 5.01433 0.205
NP_441458.1_10 Reverse -100 -119 16.0274 0.0723
NP_441458.1_10 Forward -187 -168 6.39097 0.2
NP_442183.1_1 Forward -118 -104 10.1277 0.0888
NP_441574.1_1 Reverse -97 -116 -6.88371 0.281
NP_442347.1_2 Reverse -110 -119 12.4878 0.056
NP_442347.1_2 Forward -117 -108 11.1111 0.056
NP_442645.1_2 Forward -126 -107 -2.55715 0.0487
NP_442645.1_2 Forward -133 -114 -18.2901 0.27
NP_442645.1_2 Reverse -101 -120 -22.125 0.29
NP_442645.1_2 Forward -95 -76 -22.8133 0.296
NP_441037.1_4 Reverse -107 -117 14.7245 0.028
NP_441037.1_4 Forward -120 -110 7.9999 0.237
NP_441037.1_4 Reverse -270 -280 7.02532 0.237
NP_442594.1_7 Forward -129 -110 8.75009 0.186
NP_442594.1_8 Forward -180 -161 2.26107 0.295
NP_441633.1_3 Forward -120 -107 8.57408 0.0377
NP_441633.1_3 Reverse -107 -120 3.46087 0.0699
NP_440136.1_2 Forward -117 -110 15.9687 0.0123
NP_440136.1_2 Reverse -110 -117 15.9687 0.0123
NP_442590.1_9 Reverse -14 -33 5.11266 0.273
NP_442590.1_10 Forward -118 -99 4.22769 0.278
NP_442998.1_5 Reverse -30 -40 9.02648 0.256
NP_442998.1_10 Forward -116 -109 15.5754 0.0102
NP_442998.1_10 Reverse -111 -118 15.5754 0.0102
NP_442998.1_10 Forward -279 -272 6.13563 0.181
NP_440299.1_1 Forward -122 -109 16.2433 0.0109
NP_440299.1_1 Reverse -105 -118 11.9167 0.0427
NP_440299.1_1 Forward -285 -272 4.44361 0.207
NP_440299.1_1 Reverse -165 -178 3.7553 0.232
NP_441799.1_1 Forward -122 -108 21.1401 0.0036
NP_441799.1_1 Forward -182 -168 8.45543 0.114
NP_441799.1_1 Reverse -105 -119 5.70218 0.197
NP_441799.1_1 Forward -285 -271 3.93223 0.274
NP_442802.1_2 Forward -33 -14 14.5516 0.212
NP_441007.1_10 Reverse -18 -31 0.805932 0.216
NP_441007.1_10 Forward -183 -170 0.117615 0.25
NP_441007.1_10 Forward -123 -110 -0.570702 0.287
NP_442201.1_10 Reverse -261 -280 -6.39206 0.184
NP_442201.1_10 Forward -129 -110 -14.9469 0.295
NP_442333.2_5 Reverse -133 -152 -14.6519 0.278
NP_440256.1_1 Forward -121 -102 4.62101 0.0429
NP_440256.1_1 Reverse -106 -125 -2.95047 0.125
NP_440256.1_1 Forward -181 -162 -3.24547 0.129
NP_440087.1_1 Forward -376 -357 -8.26035 0.278
NP_441512.1_4 Forward -285 -266 10.6192 0.237
NP_441559.1_8 Forward -274 -260 3.93283 0.136
NP_441559.1_8 Forward -210 -196 -4.52363 0.227
NP_441559.1_8 Reverse -165 -179 -6.29359 0.276
NP_441559.1_8 Reverse -104 -118 -6.29359 0.276
NP_441559.1_8 Reverse -164 -178 -6.68692 0.279
NP_441559.1_8 Forward -275 -261 -6.88358 0.281
NP_441270.1_5 Reverse -240 -259 12.1159 0.248
NP_441270.1_5 Reverse -17 -36 10.8472 0.296
NP_440915.1_6 Reverse -268 -282 12.6843 0.0208
NP_440915.1_6 Reverse -105 -119 6.29277 0.0828
NP_440915.1_6 Forward -273 -259 1.76955 0.131
NP_440717.1_1 Forward -117 -98 8.16093 0.265
NP_440717.1_3 Reverse -160 -174 14.2569 0.221
NP_440306.1_5 Forward -308 -289 0.982764 0.212
NP_442993.1_1 Forward -118 -102 -8.88958 0.176
NP_442993.1_1 Forward -342 -326 -12.5278 0.274
NP_442386.1_9 Reverse -108 -117 15.7322 0.0144
NP_442386.1_9 Forward -119 -110 13.8639 0.0289
NP_442386.1_9 Reverse -366 -375 8.75075 0.184
NP_442386.1_9 Forward -179 -170 8.06244 0.209
NP_442386.1_9 Reverse -168 -177 5.70251 0.241
NP_441340.1_5 Forward -117 -110 15.6737 0.0124
NP_441340.1_5 Reverse -110 -117 15.6737 0.0124
NP_441340.1_5 Reverse -273 -280 4.07068 0.239
NP_441340.1_5 Reverse -170 -177 3.97235 0.274
NP_441947.1_4 Reverse -98 -117 10.7175 0.283
NP_442484.1_2 Reverse -98 -117 10.7175 0.113
NP_442484.1_2 Forward -189 -170 0.294447 0.25
NP_440327.1_6 Forward -129 -110 3.53937 0.284
NP_440146.1_4 Forward -188 -169 10.0292 0.129
NP_440586.1_8 Forward -117 -110 13.2151 0.026
NP_440586.1_8 Reverse -110 -117 13.2151 0.026
NP_440586.1_8 Forward -316 -309 8.88855 0.205
NP_440586.1_8 Forward -280 -273 7.61025 0.227
NP_442251.1_6 Forward -117 -110 15.2804 0.0124
NP_442251.1_6 Reverse -110 -117 15.2804 0.0124
NP_440684.1_9 Reverse -103 -117 8.45605 0.23
NP_441262.1_3 Reverse -109 -116 14.7888 0.0223
NP_441262.1_3 Forward -118 -111 14.7888 0.0223
NP_441262.1_3 Reverse -272 -279 5.25066 0.215
NP_440027.1_3 Reverse -193 -211 5.52492 0.24
NP_440027.1_3 Reverse -367 -385 4.93494 0.249
NP_440027.1_8 Reverse -106 -125 6.78348 0.27
NP_440027.1_8 Reverse -160 -179 5.50519 0.279
NP_443051.1_1 Reverse -108 -117 10.4228 0.00754
NP_443051.1_1 Forward -119 -110 10.4228 0.00754
NP_443051.1_1 Reverse -271 -280 5.40793 0.0926
NP_441232.1_10 Forward -129 -110 8.45592 0.142
NP_439937.1_9 Reverse -108 -125 2.88973 0.0798
NP_439937.1_9 Forward -43 -26 -1.7318 0.129
NP_439937.1_9 Reverse -271 -288 -5.66502 0.157
NP_439937.1_9 Forward -119 -102 -8.71327 0.177
NP_439937.1_9 Reverse -366 -383 -12.2532 0.27
NP_440408.1_7 Reverse -109 -128 7.47261 0.288
NP_440439.1_1 Forward -121 -108 2.57589 0.131
NP_442239.1_8 Reverse -266 -285 4.62101 0.296
NP_440372.1_2 Forward -117 -110 16.3621 0.0124
NP_440372.1_2 Reverse -110 -117 16.3621 0.0124
NP_440372.1_2 Reverse -273 -280 4.07068 0.262
NP_441789.1_7 Forward -40 -21 3.63691 0.194
NP_440316.1_10 Forward -377 -367 8.04317 0.24
NP_440316.1_10 Reverse -271 -281 7.45319 0.251
NP_441803.1_2 Forward -123 -104 5.01433 0.171
NP_441803.1_2 Reverse -104 -123 3.14605 0.197
NP_439977.1_5 Reverse -103 -122 -2.0655 0.27
NP_440139.1_1 Forward -124 -105 3.24359 0.211
NP_441572.1_7 Reverse -103 -122 6.39097 0.0804
NP_441572.1_7 Reverse -266 -285 6.09597 0.0842
NP_440267.1_2 Reverse -122 -136 4.71887 0.296
NP_442384.1_10 Reverse -109 -122 18.0139 0.00545
NP_442384.1_10 Forward -118 -105 8.37742 0.0656
NP_442384.1_10 Reverse -272 -285 6.50913 0.0995
NP_442384.1_10 Forward -281 -268 5.03416 0.139
NP_441604.1_4 Reverse -264 -283 -4.32711 0.224
NP_441018.1_7 Forward -182 -163 13.7658 0.132
NP_441018.1_7 Reverse -92 -111 7.57094 0.269
NP_442262.1_10 Forward -117 -110 14.1988 0.0123
NP_442262.1_10 Reverse -110 -117 14.1988 0.0123
NP_442262.1_10 Forward -280 -273 10.6589 0.14
NP_442262.1_10 Reverse -170 -177 9.87221 0.164
NP_441689.1_5 Forward -120 -110 5.78111 0.197
NP_440344.1_10 Reverse -102 -119 29.9315 0.000175
NP_440344.1_10 Forward -125 -108 -9.10594 0.139
NP_440282.1_10 Reverse -117 -136 -9.047 0.269
NP_440531.1_6 Forward -126 -107 -1.7705 0.239
NP_440531.1_6 Reverse -161 -180 -2.95047 0.26
NP_440531.1_8 Forward -297 -278 2.94938 0.279
NP_442910.1_1 Reverse -102 -121 2.26107 0.118
NP_442910.1_1 Forward -125 -106 -7.17871 0.254
NP_441965.1_3 Forward -128 -109 6.68596 0.149
NP_440297.1_9 Reverse -273 -283 9.02648 0.0943
NP_440297.1_9 Forward -280 -270 0.0783647 0.282
NP_440297.1_9 Forward -117 -107 -0.118297 0.282
NP_440297.1_9 Reverse -110 -120 -0.118297 0.282
NP_441778.1_8 Forward -275 -261 18.0918 0.214
NP_440999.1_9 Reverse -105 -119 14.0609 0.0277
NP_440999.1_9 Reverse -165 -179 8.16106 0.0788
NP_440888.1_2 Reverse -109 -123 11.897 0.0562
NP_440888.1_2 Forward -118 -104 10.3237 0.0974
NP_440179.1_6 Forward -216 -197 2.94938 0.289
NP_440052.1_5 Reverse -98 -117 7.57094 0.102
NP_440052.1_5 Forward -129 -110 -3.3438 0.234
NP_440052.1_5 Reverse -82 -101 -4.42544 0.257
NP_439969.1_3 Reverse -267 -286 4.62101 0.214
NP_439969.1_3 Reverse -104 -123 -0.983855 0.271
NP_442277.1_2 Forward -260 -246 17.1092 0.158
NP_442033.1_10 Reverse -248 -267 -12.7836 0.277
NP_441543.1_2 Forward -117 -108 18.486 0.00236
NP_441543.1_2 Reverse -110 -119 16.9127 0.00359
NP_441543.1_2 Reverse -170 -179 5.01461 0.209
NP_442845.1_2 Forward -124 -110 14.5526 0.0796
NP_442845.1_2 Forward -184 -170 6.98109 0.199
NP_442845.1_2 Reverse -103 -117 4.91614 0.249
NP_442845.1_2 Reverse -109 -123 4.81781 0.251
NP_441551.1_5 Forward -269 -253 5.85938 0.293
NP_441178.1_6 Reverse -364 -383 5.50519 0.268
NP_440982.1_1 Reverse -157 -176 3.24359 0.297
NP_441469.1_8 Reverse -108 -117 16.126 0.00797
NP_441469.1_8 Forward -119 -110 6.48957 0.227
NP_442315.1_5 Forward -140 -130 16.4013 0.3
NP_443064.1_6 Reverse -109 -119 12.5669 0.0796
NP_442578.1_7 Forward -117 -110 14.5921 0.026
NP_442578.1_7 Reverse -110 -117 14.5921 0.026
NP_440071.1_6 Forward -141 -127 14.8714 0.241
NP_441462.1_2 Forward -118 -108 11.5831 0.00406
NP_441462.1_2 Reverse -109 -119 11.5831 0.00406
NP_441462.1_2 Reverse -272 -282 8.63316 0.0339
NP_441462.1_2 Forward -281 -271 0.471689 0.148
NP_443062.1_1 Forward -118 -100 12.7387 0.0744
NP_443062.1_1 Reverse -308 -326 8.44842 0.153
NP_443062.1_1 Forward -178 -160 5.6207 0.224
NP_443062.1_6 Forward -186 -167 7.57094 0.164
NP_443062.1_6 Forward -126 -107 1.86774 0.266
NP_440519.1_6 Forward -286 -272 10.6193 0.29
NP_442204.1_1 Reverse -268 -279 9.79344 0.0736
NP_442204.1_5 Reverse -99 -118 13.1758 0.0596
NP_442204.1_5 Reverse -250 -269 0.0977854 0.272
NP_440504.1_5 Forward -114 -96 8.7706 0.188
NP_442487.1_6 Forward -131 -112 13.3716 0.196
NP_440516.1_2 Reverse -103 -121 11.1305 0.0787
NP_440516.1_2 Forward -211 -193 2.0841 0.18
NP_440516.1_8 Forward -118 -109 16.9127 0.00442
NP_440516.1_8 Reverse -109 -118 16.9127 0.00442
NP_440516.1_8 Reverse -272 -281 7.17789 0.0754
NP_440516.1_8 Forward -281 -272 5.01461 0.118
NP_441033.1_2 Reverse -99 -118 -7.57203 0.293
NP_442428.1_5 Forward -117 -110 15.8704 0.0124
NP_442428.1_5 Reverse -110 -117 15.8704 0.0124
NP_442428.1_5 Reverse -273 -280 4.46401 0.267
NP_442428.1_5 Forward -177 -170 4.46401 0.267
NP_442120.1_10 Forward -241 -222 -13.2752 0.282
NP_441867.1_2 Forward -88 -69 -13.9635 0.277
NP_440673.1_3 Forward -116 -109 12.4288 0.0426
NP_440673.1_3 Reverse -111 -118 12.4288 0.0426
NP_440673.1_3 Forward -279 -272 11.6422 0.0724
NP_440673.1_3 Reverse -171 -178 8.98723 0.203
NP_441052.1_2 Reverse -109 -119 19.9412 0.00106
NP_441052.1_2 Forward -118 -108 10.5014 0.0285
NP_442219.1_9 Reverse -110 -119 17.7976 0.00718
NP_442219.1_9 Forward -117 -108 8.35786 0.0681
NP_440436.1_4 Forward -117 -108 18.1905 0.00233
NP_440436.1_4 Reverse -110 -119 17.2072 0.00233
NP_440436.1_4 Reverse -170 -179 11.0124 0.0655
NP_441884.1_8 Forward -179 -160 -7.96535 0.255
NP_441884.1_9 Reverse -106 -125 -13.0786 0.138
NP_442086.1_6 Reverse -208 -227 11.7008 0.255
NP_441719.1_4 Forward -117 -110 16.3621 0.0124
NP_441719.1_4 Reverse -110 -117 16.3621 0.0124
NP_441004.1_1 Forward -184 -165 -4.72043 0.173
NP_441004.1_1 Forward -111 -92 -11.3086 0.237
NP_441004.1_1 Reverse -191 -210 -17.0118 0.288
NP_442366.1_3 Forward -119 -101 9.16393 0.0578
NP_442366.1_3 Reverse -168 -186 2.37909 0.131
NP_442366.1_3 Reverse -108 -126 -2.53746 0.229
NP_442366.1_5 Forward -121 -111 17.2858 0.0141
NP_442366.1_5 Reverse -106 -116 12.7626 0.108
NP_440296.1_4 Reverse -349 -368 15.5316 0.287
NP_441115.1_4 Reverse -108 -126 13.9813 0.0645
NP_442854.1_6 Forward -274 -255 3.53937 0.256
NP_440094.1_9 Forward -179 -160 -0.197208 0.199
NP_443054.1_2 Forward -120 -106 11.2093 0.0761
NP_443054.1_2 Forward -272 -258 2.5562 0.244
NP_443054.1_2 Forward -283 -269 1.37622 0.247
NP_441966.1_7 Forward -291 -272 -1.96793 0.297
NP_441851.1_10 Reverse -108 -118 16.008 0.00552
NP_441851.1_10 Forward -119 -109 15.8113 0.00552
NP_441851.1_10 Reverse -271 -281 6.37155 0.172
NP_441851.1_10 Forward -179 -169 5.78156 0.2
NP_442208.1_5 Reverse -18 -37 -9.34199 0.293
NP_442622.1_1 Reverse -5 -24 -7.08038 0.257
NP_441501.1_4 Forward -140 -121 19.0757 0.148
NP_442856.1_7 Reverse -100 -119 -2.0655 0.233
NP_441668.1_4 Forward -188 -169 6.09597 0.163
NP_441668.1_4 Reverse -262 -281 -0.0988766 0.248
NP_440593.1_3 Forward -123 -104 7.66927 0.109
NP_440593.1_3 Reverse -104 -123 -6.29373 0.272
NP_441349.1_10 Forward -128 -109 20.649 0.00739
NP_441349.1_10 Reverse -99 -118 -1.57384 0.105
NP_441349.1_10 Forward -291 -272 -9.73531 0.297
NP_441394.1_2 Forward -148 -129 13.7658 0.293
NP_439960.1_10 Reverse -237 -255 5.72234 0.147
NP_441477.1_5 Reverse -129 -148 11.4058 0.268
NP_441124.1_5 Reverse -225 -235 11.7668 0.245
NP_440431.1_3 Reverse -168 -187 -1.37718 0.156
NP_440431.1_3 Forward -70 -51 -11.7019 0.29
NP_442450.1_5 Reverse -107 -117 7.55152 0.13
NP_442450.1_5 Forward -120 -110 7.55152 0.13
NP_442450.1_5 Forward -283 -273 6.76487 0.155
NP_440588.1_2 Forward -127 -108 23.9922 0.00766
NP_440588.1_2 Forward -290 -271 11.0125 0.0352
NP_440588.1_2 Reverse -100 -119 -2.85214 0.174
NP_440195.1_5 Reverse -103 -122 2.45773 0.276
NP_442006.1_2 Forward -87 -70 -7.92597 0.189
NP_441003.1_9 Forward -284 -265 3.6377 0.291
NP_443047.1_7 Forward -269 -250 3.73603 0.287
NP_441570.1_1 Forward -184 -166 -11.8789 0.204
NP_441570.1_1 Reverse -109 -127 -16.1071 0.238
NP_441570.1_1 Forward -269 -251 -16.5005 0.247
NP_441078.1_4 Forward -118 -109 19.6659 0.0007
NP_441078.1_4 Reverse -109 -118 19.6659 0.0007
NP_441078.1_4 Reverse -272 -281 7.66954 0.052
NP_441078.1_4 Forward -281 -272 0.491382 0.188
NP_441078.1_4 Forward -178 -169 -1.6719 0.266
NP_441663.1_8 Reverse -163 -182 0.58944 0.218
NP_441663.1_8 Reverse -266 -285 -3.63879 0.294
NP_440707.1_6 Reverse -352 -371 12.4867 0.214
NP_440707.1_6 Reverse -161 -180 11.405 0.27
NP_442443.1_1 Reverse -352 -371 5.11266 0.157
NP_442443.1_1 Reverse -25 -44 -2.45882 0.256
NP_442443.1_1 Reverse -245 -264 -5.9004 0.287
NP_440526.1_3 Forward -117 -106 2.02482 0.267
NP_440526.1_3 Reverse -110 -121 0.943182 0.267
NP_441432.1_8 Forward -119 -110 16.8143 0.00595
NP_441432.1_8 Forward -179 -170 15.0444 0.0182
NP_441432.1_8 Reverse -108 -117 8.25953 0.0755
NP_441432.1_8 Reverse -271 -280 2.85133 0.281
NP_442320.1_8 Reverse -103 -117 17.0108 0.00635
NP_442320.1_8 Forward -124 -110 -3.44199 0.122
NP_442344.1_7 Forward -117 -98 -4.32711 0.168
NP_441732.1_2 Reverse -105 -121 3.00846 0.0141
NP_441732.1_2 Forward -122 -106 -17.2477 0.247
NP_442003.1_4 Reverse -110 -129 10.4225 0.288
NP_440760.1_1 Forward -118 -99 -22.0267 0.248
NP_442797.1_7 Reverse -366 -384 3.3624 0.234
NP_442797.1_7 Reverse -108 -126 0.21581 0.278
NP_440461.1_3 Reverse -246 -265 13.6675 0.297
NP_441945.1_10 Forward -154 -135 9.63589 0.258
NP_442298.1_10 Reverse -110 -129 13.6675 0.219
NP_442353.1_4 Reverse -103 -122 6.78348 0.17
NP_440713.1_4 Forward -279 -260 7.27595 0.182
NP_442489.1_7 Forward -118 -109 20.1576 0.000695
NP_442489.1_7 Reverse -109 -118 20.1576 0.000695
NP_442489.1_7 Reverse -272 -281 8.1612 0.0294
NP_442489.1_7 Forward -281 -272 0.688044 0.152
NP_442489.1_7 Forward -178 -169 -1.6719 0.235
NP_442489.1_7 Reverse -169 -178 -1.96689 0.28
NP_440559.1_1 Reverse -110 -119 17.4043 0.00658
NP_440559.1_1 Forward -117 -108 8.75118 0.0586
NP_440559.1_1 Reverse -273 -282 4.81794 0.193
NP_441659.2_8 Reverse -109 -119 18.1713 0.00133
NP_441659.2_8 Forward -281 -271 14.1397 0.00992
NP_441659.2_8 Forward -118 -108 11.9764 0.0147
NP_441659.2_8 Reverse -169 -179 4.0116 0.146
NP_441659.2_8 Reverse -272 -282 0.0783647 0.277
NP_442913.1_10 Forward -127 -108 -3.44213 0.21
NP_442913.1_10 Reverse -100 -119 -3.54046 0.212
NP_442008.1_2 Reverse -257 -276 7.96426 0.203
NP_442008.1_2 Forward -284 -265 2.75272 0.277
NP_440708.1_6 Forward -263 -244 -5.80207 0.234
NP_442346.1_5 Forward -119 -109 16.6963 0.00248
NP_442346.1_5 Forward -179 -169 12.6647 0.0375
NP_442346.1_5 Reverse -108 -118 9.02648 0.118
NP_442346.1_5 Reverse -271 -281 8.04317 0.149
NP_442346.1_5 Forward -282 -272 6.96153 0.187
NP_440352.1_7 Forward -263 -250 18.0132 0.194
NP_440545.1_3 Reverse -268 -285 8.7903 0.0426
NP_440545.1_3 Forward -122 -105 5.34871 0.0623
NP_440545.1_3 Forward -285 -268 -2.02611 0.179
NP_440545.1_5 Forward -122 -105 10.6586 0.21
NP_441856.1_8 Forward -266 -247 13.7658 0.219
NP_440025.1_1 Reverse -2 -21 6.19431 0.271
NP_440831.1_3 Reverse -247 -266 6.29006 0.275
NP_441126.1_5 Reverse -253 -272 6.39097 0.249
NP_441126.1_8 Forward -177 -164 11.1307 0.291
NP_440459.1_2 Reverse -107 -124 8.39697 0.264
NP_440459.1_2 Reverse -94 -111 7.70866 0.283
NP_441653.1_2 Reverse -261 -280 6.13873 0.235
NP_441888.1_7 Reverse -164 -178 11.5043 0.0846
NP_441888.1_7 Reverse -104 -118 2.5562 0.225
NP_441050.1_5 Forward -139 -121 18.0137 0.0358
NP_440449.1_6 Reverse -101 -119 8.15857 0.206
NP_441948.1_4 Forward -125 -107 -0.177514 0.139
NP_441948.1_4 Forward -387 -369 -3.32411 0.19
NP_441948.1_9 Forward -176 -158 13.7855 0.249
NP_441502.1_3 Forward -180 -161 6.98095 0.248
NP_441833.1_4 Forward -117 -110 15.9687 0.0124
NP_441833.1_4 Reverse -110 -117 15.9687 0.0124
NP_441895.1_3 Forward -27 -8 -16.9135 0.277
NP_441112.1_8 Forward -366 -347 14.8474 0.106
NP_442162.1_9 Forward -117 -110 16.2637 0.0124
NP_442162.1_9 Reverse -110 -117 16.2637 0.0124
NP_442796.1_2 Forward -311 -292 14.3036 0.269
NP_440671.1_4 Reverse -103 -117 9.5377 0.18
NP_440671.1_5 Reverse -157 -171 14.3553 0.292
NP_440224.1_1 Forward -129 -110 3.44104 0.132
NP_442546.1_4 Reverse -25 -43 15.8504 0.227
NP_442199.1_5 Reverse -101 -120 -3.93378 0.216
NP_442140.1_3 Forward -117 -107 16.2046 0.0255
NP_442140.1_3 Reverse -110 -120 12.2714 0.0632
NP_442140.1_3 Forward -280 -270 7.64985 0.133
NP_440875.1_9 Forward -176 -166 9.54007 0.233
NP_440875.1_9 Forward -116 -106 8.46937 0.233
NP_441813.1_3 Forward -370 -351 16.1765 0.238
NP_441813.1_5 Reverse -107 -117 9.91146 0.021
NP_441813.1_5 Forward -120 -110 8.63316 0.0367
NP_441813.1_5 Forward -283 -273 3.12662 0.174
NP_440594.1_6 Reverse -103 -122 6.58682 0.258
NP_440590.1_4 Forward -117 -104 19.8821 0.0064
NP_440590.1_4 Reverse -110 -123 9.65572 0.0341
NP_440590.1_4 Reverse -197 -210 1.49425 0.122
NP_440567.1_1 Reverse -110 -124 18.9775 0.0136
NP_440567.1_1 Forward -117 -103 16.7159 0.0166
NP_442497.1_10 Forward -117 -108 10.4228 0.0087
NP_442497.1_10 Reverse -110 -119 10.4228 0.0087
NP_442497.1_10 Reverse -273 -282 0.393051 0.175
NP_442497.1_10 Forward -280 -271 0.196389 0.208
NP_440821.1_4 Reverse -107 -117 10.2065 0.0163
NP_440821.1_4 Forward -120 -110 9.41981 0.0286
NP_440821.1_4 Forward -283 -273 0.176696 0.198
NP_441239.1_9 Forward -283 -271 14.592 0.0271
NP_441239.1_9 Reverse -107 -119 12.3303 0.0477
NP_441239.1_9 Reverse -365 -377 10.5604 0.076
NP_441239.1_9 Forward -120 -108 5.93884 0.202
NP_441239.1_9 Forward -261 -249 5.15219 0.227
NP_441239.1_9 Reverse -167 -179 4.16888 0.26
NP_441239.1_9 Reverse -270 -282 4.07055 0.264
NP_441239.1_9 Reverse -263 -275 3.97222 0.269
NP_441239.1_9 Reverse -125 -137 3.38223 0.285
NP_441009.1_4 Forward -178 -159 15.9291 0.158
NP_441727.1_3 Reverse -102 -121 5.211 0.256
NP_441727.1_8 Forward -240 -221 1.96607 0.205
NP_441892.1_1 Reverse -24 -41 -1.53445 0.208
NP_441892.1_1 Reverse -100 -117 -3.40274 0.239
NP_441892.1_1 Reverse -247 -264 -5.95935 0.294
NP_442193.1_1 Forward -179 -161 7.39397 0.291
NP_442270.1_9 Reverse -98 -117 2.0644 0.14
NP_442643.1_7 Reverse -91 -110 7.47261 0.287
NP_442629.1_1 Forward -111 -97 18.0925 0.259
NP_441874.1_1 Forward -176 -162 8.45605 0.298
NP_440354.1_7 Reverse -17 -35 12.4089 0.224
NP_441782.1_5 Reverse -15 -34 6.78429 0.287
NP_442809.1_6 Forward -368 -349 0.786102 0.282
NP_440546.1_4 Reverse -272 -282 13.2456 0.0557
NP_440546.1_4 Forward -118 -108 11.8882 0.0679
NP_440546.1_4 Reverse -109 -119 10.046 0.109
NP_440546.1_4 Forward -281 -271 8.59164 0.181
NP_441230.1_5 Reverse -164 -183 5.99764 0.182
NP_440462.1_6 Reverse -107 -117 9.02648 0.0498
NP_440462.1_6 Forward -120 -110 1.35667 0.294
NP_442340.1_3 Reverse -242 -261 -7.67036 0.238
NP_440868.1_4 Forward -122 -110 15.7719 0.0164
NP_440868.1_4 Reverse -105 -117 1.7106 0.174
NP_441249.1_3 Forward -283 -264 1.86774 0.278
NP_441582.1_5 Reverse -107 -126 10.2251 0.164
NP_442402.1_4 Forward -277 -258 -5.80282 0.248
NP_442402.1_10 Forward -68 -58 11.6809 0.241
NP_440653.1_10 Forward -280 -261 3.93269 0.259
NP_442460.1_7 Reverse -97 -116 23.8939 0.00379
NP_440696.1_3 Forward -122 -104 -3.02911 0.282
NP_440696.1_6 Forward -123 -104 3.93269 0.288
NP_442039.1_4 Forward -117 -110 15.1821 0.0124
NP_442039.1_4 Reverse -110 -117 15.1821 0.0124
NP_442039.1_7 Forward -85 -75 9.32148 0.257
NP_440825.1_7 Reverse -110 -120 12.9096 0.152
NP_440825.1_7 Forward -117 -107 12.4217 0.155
NP_442837.1_3 Forward -117 -110 15.7721 0.0124
NP_442837.1_3 Reverse -110 -117 15.7721 0.0124
NP_442053.1_1 Forward -118 -109 18.3876 0.0007
NP_442053.1_1 Reverse -109 -118 18.3876 0.0007
NP_442053.1_1 Forward -281 -272 6.78456 0.115
NP_440505.1_3 Forward -120 -110 9.22315 0.122
NP_440505.1_3 Reverse -107 -117 6.76487 0.169
NP_440505.1_7 Forward -205 -186 1.47442 0.249
NP_441102.1_10 Forward -144 -125 9.63589 0.199
NP_441203.1_1 Forward -280 -261 -12.3902 0.143
NP_440914.1_1 Reverse -109 -119 17.5935 0.000537
NP_440914.1_1 Forward -118 -108 8.6151 0.186
NP_441011.1_8 Forward -117 -108 16.9127 0.00602
NP_441011.1_8 Reverse -110 -119 8.25953 0.144
NP_441011.1_8 Reverse -273 -282 7.27622 0.179
NP_441011.1_8 Forward -177 -168 5.11294 0.283
NP_442101.1_10 Reverse -264 -283 0.687771 0.0913
NP_442533.1_6 Forward -118 -109 17.2076 0.00137
NP_442533.1_6 Reverse -109 -118 17.2076 0.00137
NP_442533.1_6 Forward -281 -272 14.5527 0.0116
NP_442533.1_6 Reverse -272 -281 6.48957 0.109
NP_442533.1_6 Forward -178 -169 5.60459 0.137
NP_442533.1_6 Forward -136 -127 2.06468 0.275
NP_442533.1_6 Reverse -128 -137 1.86802 0.284
NP_440263.1_3 Reverse -91 -110 1.37609 0.295
NP_442232.1_3 Forward -126 -107 -13.0786 0.282
NP_442232.1_4 Reverse -140 -159 15.0441 0.17
NP_442322.1_4 Reverse -119 -136 -0.846829 0.226
NP_442322.1_4 Reverse -161 -178 -9.10659 0.287
NP_442229.1_1 Forward -120 -106 17.7968 0.0734
NP_443016.1_1 Reverse -361 -380 -5.31042 0.245
NP_441482.1_7 Reverse -103 -117 -8.45687 0.193
NP_441482.1_7 Forward -287 -273 -11.1118 0.237
NP_439944.1_9 Reverse -110 -120 10.5014 0.0887
NP_439944.1_9 Reverse -273 -283 5.5849 0.239
NP_441697.1_5 Forward -305 -286 -11.3162 0.295
NP_441028.1_6 Forward -67 -57 12.6642 0.183
NP_441028.1_6 Forward -197 -187 10.6976 0.197
NP_441028.1_6 Reverse -160 -170 4.01116 0.278
NP_442202.1_10 Forward -260 -246 6.6861 0.255
NP_440116.1_8 Forward -117 -98 0.0977854 0.103
NP_440116.1_8 Reverse -110 -129 -8.45701 0.253
NP_441527.1_4 Reverse -320 -339 -9.31089 0.256
NP_440115.1_6 Forward -121 -111 8.33817 0.13
NP_440007.1_9 Reverse -166 -180 7.17775 0.213
NP_439965.1_1 Forward -127 -108 2.45773 0.112
NP_439965.1_1 Reverse -100 -119 -3.83545 0.182
NP_441059.1_2 Reverse -261 -280 -4.81876 0.242
NP_441961.1_4 Forward -243 -224 3.04771 0.281
NP_441972.1_5 Reverse -110 -129 2.26107 0.121
NP_441972.1_5 Forward -117 -98 0.392778 0.152
NP_441972.1_5 Forward -280 -261 -6.49039 0.231
NP_441106.1_1 Reverse -108 -117 18.191 0.0028
NP_441106.1_1 Forward -119 -110 9.63616 0.0311
NP_441106.1_1 Reverse -249 -258 2.55633 0.28
NP_440429.1_2 Forward -117 -98 10.2259 0.267
NP_441825.1_4 Forward -132 -122 18.5646 0.158
NP_442306.1_10 Forward -123 -104 -20.4534 0.21
NP_441286.1_1 Forward -119 -107 6.03717 0.0258
NP_441286.1_1 Reverse -108 -120 3.38223 0.0467
NP_441286.1_1 Reverse -271 -283 -4.68091 0.168
NP_440670.1_8 Forward -118 -109 18.3876 0.000699
NP_440670.1_8 Reverse -109 -118 18.3876 0.000699
NP_440670.1_8 Reverse -272 -281 8.55452 0.066
NP_440670.1_8 Forward -281 -272 5.99792 0.13
NP_440886.1_7 Reverse -108 -118 17.7774 0.0011
NP_440886.1_7 Forward -119 -109 7.94438 0.0805
NP_440886.1_7 Forward -282 -272 6.46942 0.123
NP_440886.1_7 Forward -33 -23 4.50281 0.232
NP_440886.1_7 Forward -262 -252 3.51951 0.279
NP_440083.1_9 Reverse -56 -75 15.029 0.278
NP_442614.1_2 Reverse -272 -286 14.0609 0.106
NP_442614.1_2 Reverse -109 -123 13.4709 0.124
NP_442072.1_9 Forward -282 -264 -21.9087 0.215
NP_442072.1_9 Forward -119 -101 -23.0886 0.277
NP_442963.1_7 Forward -283 -264 13.4708 0.204
NP_440907.2_8 Forward -117 -107 14.2375 0.0312
NP_440907.2_8 Reverse -110 -120 7.64939 0.117
NP_440907.2_8 Forward -280 -270 4.7978 0.243
NP_442264.1_5 Reverse -169 -183 16.5192 0.222
NP_439967.1_7 Reverse -108 -126 11.0322 0.205
NP_441021.1_1 Reverse -209 -228 -10.522 0.24
NP_441021.1_8 Reverse -104 -122 1.69077 0.259
NP_441021.1_8 Forward -123 -105 1.19912 0.278
NP_441021.1_10 Forward -263 -244 17.0099 0.254
NP_440841.1_4 Forward -120 -101 -8.55534 0.25
NP_441463.1_3 Reverse -99 -118 -1.08219 0.135
NP_441626.1_2 Forward -117 -110 15.7721 0.0124
NP_441626.1_2 Reverse -110 -117 15.7721 0.0124
NP_441626.1_6 Reverse -105 -123 18.1112 0.0852
NP_442211.1_3 Reverse -197 -216 8.25011 0.275
NP_442211.1_3 Reverse -244 -263 8.15285 0.275
NP_442365.1_9 Forward -251 -232 14.3558 0.279
NP_442209.1_10 Reverse -252 -271 18.5831 0.198
NP_442794.1_1 Forward -182 -170 7.02048 0.152
NP_442794.1_1 Reverse -105 -117 2.89058 0.286
NP_442794.1_1 Forward -122 -110 2.69391 0.286
NP_442615.1_1 Reverse -100 -118 17.5221 0.00646
NP_442615.1_1 Forward -127 -109 15.0638 0.00922
NP_442615.1_1 Forward -187 -169 4.6407 0.0444
NP_442615.1_1 Forward -290 -272 -4.99573 0.201
NP_441962.1_4 Forward -123 -104 -11.5053 0.241
NP_440387.1_1 Forward -118 -102 -1.41643 0.142
NP_440387.1_1 Reverse -109 -125 -2.5964 0.148
NP_441431.1_2 Reverse -166 -180 17.7968 0.0246
NP_441431.1_2 Reverse -106 -120 14.7486 0.0588
NP_441431.1_2 Forward -121 -107 7.86545 0.231
NP_441431.1_2 Forward -284 -270 6.58715 0.266
NP_441431.1_2 Reverse -262 -276 6.0955 0.28
NP_441488.1_7 Reverse -27 -46 1.76941 0.285
NP_441836.1_1 Forward -189 -170 12.1811 0.263
NP_441993.1_1 Reverse -15 -34 9.15853 0.136
NP_441993.1_1 Forward -184 -165 1.4594 0.276
NP_440114.1_10 Forward -118 -104 8.84938 0.192
NP_440114.1_10 Reverse -109 -123 6.6861 0.26
NP_441817.1_10 Reverse -198 -217 12.4875 0.24
NP_442437.1_8 Reverse -98 -117 3.6377 0.288
NP_440754.1_10 Reverse -322 -336 19.6658 0.113
NP_440287.1_5 Forward -268 -249 6.88182 0.286
NP_440293.1_3 Forward -186 -167 1.27776 0.209
NP_440293.1_3 Forward -174 -155 -5.99873 0.285
NP_440293.1_10 Forward -147 -128 -0.39387 0.251
NP_439988.1_3 Reverse -363 -377 3.53951 0.298
NP_441237.1_9 Reverse -110 -120 14.828 0.0242
NP_441237.1_9 Reverse -170 -180 11.6814 0.164
NP_442743.1_5 Forward -123 -104 10.3242 0.144
NP_442743.1_5 Forward -117 -98 7.07928 0.168
NP_439910.1_2 Reverse -101 -118 -21.9873 0.202
NP_442867.1_8 Reverse -130 -149 11.9958 0.197
NP_442867.1_8 Reverse -129 -148 4.22769 0.287
NP_440457.1_1 Reverse -268 -280 9.08543 0.0967
NP_440457.1_1 Forward -122 -110 2.69391 0.205
NP_440457.1_1 Reverse -250 -262 1.31728 0.241
NP_440457.1_1 Forward -285 -273 1.02229 0.248
NP_440457.1_1 Forward -380 -368 0.628964 0.25
NP_440798.1_6 Reverse -110 -123 15.3589 0.0423
NP_440798.1_6 Forward -280 -267 1.9859 0.188
NP_441984.1_3 Reverse -261 -279 9.65558 0.204
NP_441436.1_8 Forward -179 -160 15.5357 0.215
NP_442509.1_9 Forward -118 -108 16.2041 0.00739
NP_442509.1_9 Reverse -109 -119 8.14104 0.192
NP_442509.1_9 Forward -106 -96 7.15773 0.234
NP_440554.1_4 Forward -117 -107 7.35486 0.103
NP_440554.1_4 Reverse -209 -219 4.0116 0.205
NP_442862.1_3 Reverse -219 -236 5.15205 0.28
NP_441885.1_5 Reverse -109 -119 20.9245 0.000538
NP_441885.1_5 Forward -118 -108 11.4848 0.00668
NP_441885.1_5 Reverse -272 -282 -0.609952 0.215
NP_440478.1_4 Forward -110 -91 13.5691 0.19
NP_440478.1_10 Reverse -107 -121 10.6193 0.193
NP_440478.1_10 Reverse -91 -105 8.35772 0.257
NP_442341.1_7 Forward -119 -105 19.7641 0.00702
NP_442341.1_7 Forward -282 -268 12.291 0.0455
NP_442341.1_7 Reverse -108 -122 7.9644 0.0956
NP_442341.1_9 Reverse -107 -121 14.7486 0.062
NP_442341.1_9 Forward -283 -269 6.29216 0.233
NP_442534.1_7 Forward -282 -263 5.89931 0.29
NP_443000.1_7 Forward -120 -110 10.3048 0.0345
NP_443000.1_7 Reverse -107 -117 1.94665 0.226
NP_441842.1_1 Reverse -111 -124 19.0949 0.0142
NP_441842.1_10 Reverse -102 -116 17.6008 0.0215
NP_441842.1_10 Forward -125 -111 15.3392 0.044
NP_440275.1_3 Reverse -107 -117 8.33817 0.0602
NP_440275.1_3 Forward -120 -110 8.04317 0.0602
NP_440091.1_1 Forward -122 -110 8.29878 0.0653
NP_440091.1_1 Reverse -105 -117 3.18557 0.166
NP_443060.1_5 Forward -126 -107 10.52 0.175
NP_443060.1_5 Reverse -101 -120 5.2102 0.271
NP_441122.1_1 Forward -122 -107 4.89645 0.28
NP_441122.1_1 Forward -129 -114 3.12649 0.285
NP_439962.1_4 Forward -258 -239 -7.67036 0.29
NP_439962.1_4 Reverse -128 -147 -8.26035 0.292
NP_441105.1_3 Reverse -98 -117 11.7008 0.0363
NP_441105.1_3 Reverse -158 -177 1.47442 0.114
NP_441105.1_3 Forward -123 -104 -6.88371 0.243
NP_441105.1_3 Forward -189 -170 -7.96535 0.263
NP_440216.1_1 Reverse -109 -123 9.63603 0.00589
NP_440216.1_1 Forward -118 -104 -1.47537 0.0328
NP_440216.1_1 Forward -281 -267 -4.4253 0.111
NP_440216.1_1 Forward -178 -164 -11.8985 0.228
NP_440216.1_1 Reverse -272 -286 -12.4884 0.274
NP_440216.1_9 Reverse -177 -186 6.78456 0.289
NP_440216.1_9 Reverse -222 -231 5.80125 0.289
NP_440216.1_9 Reverse -171 -180 5.50626 0.292
NP_440216.1_9 Forward -110 -101 5.40793 0.294
NP_440172.1_1 Reverse -109 -119 15.0247 0.00945
NP_440172.1_1 Forward -118 -108 8.73149 0.0586
NP_440172.1_1 Forward -178 -168 4.99491 0.157
NP_440172.1_1 Reverse -272 -282 3.81494 0.216
NP_440172.1_1 Forward -281 -271 3.71661 0.219
NP_442015.1_10 Reverse -105 -118 11.6223 0.0372
NP_442015.1_10 Forward -122 -109 10.5407 0.0391
NP_442015.1_10 Reverse -268 -281 8.67241 0.062
NP_441226.1_7 Forward -117 -110 14.4934 0.0123
NP_441226.1_7 Reverse -110 -117 14.4934 0.0123
NP_441226.1_7 Forward -280 -273 11.2485 0.0971
NP_441226.1_7 Reverse -116 -123 6.52862 0.253
NP_441111.1_1 Forward -67 -48 22.3206 0.0409
NP_441111.1_7 Forward -117 -109 18.7023 0.00294
NP_441111.1_7 Reverse -110 -118 18.7023 0.00294
NP_441111.1_8 Forward -157 -139 20.8653 0.0699
NP_441766.1_2 Forward -118 -109 17.5026 0.00297
NP_441766.1_2 Reverse -109 -118 17.5026 0.00297
NP_441766.1_2 Forward -281 -272 4.12963 0.194
NP_440416.1_9 Reverse -102 -121 -4.42544 0.0776
NP_440416.1_9 Reverse -162 -181 -6.88371 0.0951
NP_440416.1_9 Reverse -265 -284 -8.85033 0.122
NP_440416.1_9 Forward -185 -166 -11.0136 0.148
NP_440416.1_9 Forward -113 -94 -11.0136 0.148
NP_440416.1_9 Forward -125 -106 -11.1119 0.148
NP_440416.1_9 Forward -276 -257 -14.8485 0.18
NP_440416.1_9 Forward -288 -269 -17.7001 0.245
NP_443052.1_8 Reverse -99 -118 -10.227 0.206
NP_443052.1_9 Forward -257 -238 9.93088 0.108
NP_443052.1_9 Forward -40 -21 2.75272 0.168
NP_443052.1_9 Forward -260 -241 -3.63879 0.251
NP_443052.1_9 Forward -34 -15 -7.17871 0.294
NP_440072.1_5 Forward -172 -154 -3.32411 0.277
NP_442154.1_1 Reverse -13 -31 -14.1405 0.217
NP_440261.1_5 Reverse -110 -123 -2.63565 0.0924
NP_440261.1_5 Reverse -273 -286 -4.60227 0.158
NP_440261.1_5 Forward -280 -267 -10.8955 0.221
NP_440261.1_5 Forward -105 -92 -12.2721 0.277
NP_440988.1_10 Forward -114 -100 9.15859 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCCCGTTTATTCTATGCTCGGCGGGCCATGCGGGAATTCTTGCAGCAACAGGGAGTTCAAGATGTCTTTTAACCCTTTTAATACCGATCAAGAGACAAAACTGAAGCACTTTTTGCAGGCCCATCGCCCAGGGGTTCCCGCTCCCTCGCCGGCACTAGAGGAGCAGATTTTGCAACGGATCAAGCAATGTCCCCGCCGTTCCTTGACCCCTAGTTTGTCTTGGCAATGGCTGGGGGGAGGAGTTCTACTCTTCGGCCTAGTGGGGGCAGGGCTTTTCGGTTGGCGATCGCCGATGCAAACGGCCGAAGAACCGAACATGGCGGAACTGGAAGCTTTCCTCCAGGAAACTTGGTCTGGCTCCATCTACCCCGACAGCGTCAACGGAGCTAACCAGGATTG

CDS

GTGGTTACTAAGCGATCCCCCACGGGAATAAGACAATTTGTACTTTTCAATCACTTTTCAGTTAATTTTCTGAGGAACTTGCTCATCATGAAAAACATTATTATCGCCGGTTTGCTTAGCGGTTTAGCTTGTACTGTCAGCACCATGCCCGCCATGGCCCAAAATCAAAATCTGGATTTACATTGGCAAAGTGGCGATACCAGCGAGCAAATGCTAGCCCAATGGGGCTGGGGCAACAAAAAAGGTGGCCAGGGCCAGTGGATGGAATCCCTTGATTTAACTGATAGTCAAAAACAACAACTGGAAGCCATTCGCCAAAAATATCAAGGCCAAATGCAATCTCTGTCGGAGCAAATGCGTACTAGCCAAAATGAATTACGCACTCTGATGTCTGGCAATGGCAGTGACAGCGAAATCCGCGCCAAACACAACCAGGTGGCTAATTTGAGGCAACAACTGGGGGAACTGCGCTTCAACAGTATGCTGGAAAGCCGTCAAGTATTGACCCCGGAACAACGGCAAAAATTTTCCCAATTAATGCAGGAGCGTCGCAATAGTCGTCAAGGTCGCCGGGGCATGGGCAACCAACAATAA

Protein

MVTKRSPTGIRQFVLFNHFSVNFLRNLLIMKNIIIAGLLSGLACTVSTMPAMAQNQNLDLHWQSGDTSEQMLAQWGWGNKKGGQGQWMESLDLTDSQKQQLEAIRQKYQGQMQSLSEQMRTSQNELRTLMSGNGSDSEIRAKHNQVANLRQQLGELRFNSMLESRQVLTPEQRQKFSQLMQERRNSRQGRRGMGNQQ