Your browser is old and dusty. Try Google Chrome!

Details for sll0857

ORF sll0857
Accession NP_441112.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -106 -92 1.67122 0.183
NP_441061.1_2 Forward -252 -238 -0.492064 0.231
NP_441061.1_2 Reverse -253 -267 -1.27871 0.255
NP_440795.1_7 Forward -260 -253 14.6904 0.0123
NP_440795.1_7 Reverse -253 -260 14.6904 0.0123
NP_441418.1_6 Forward -261 -242 -12.1936 0.0614
NP_441418.1_6 Reverse -252 -271 -13.8652 0.0791
NP_441453.1_1 Reverse -245 -263 19.2912 0.0375
NP_441453.1_4 Forward -261 -253 16.539 0.00633
NP_441453.1_4 Reverse -252 -260 7.8859 0.0536
NP_442151.1_6 Forward -261 -247 12.4876 0.0722
NP_442151.1_6 Reverse -252 -266 7.57108 0.194
NP_442151.1_6 Reverse -301 -315 5.60446 0.27
NP_442328.1_2 Reverse -235 -254 10.4225 0.212
NP_441818.1_1 Forward -336 -325 13.3328 0.0808
NP_441818.1_1 Reverse -253 -264 11.4645 0.177
NP_441818.1_1 Forward -260 -249 9.10461 0.255
NP_441818.1_9 Reverse -235 -254 0.786102 0.191
NP_440226.1_1 Forward -261 -242 9.53756 0.0719
NP_440226.1_1 Reverse -252 -271 9.53756 0.0719
NP_441630.1_3 Reverse -244 -263 9.83255 0.0942
NP_442173.1_1 Reverse -253 -261 15.4574 0.00633
NP_442173.1_1 Forward -260 -252 8.27922 0.101
NP_442752.1_4 Forward -261 -254 13.8055 0.0199
NP_443027.1_4 Forward -263 -253 6.46988 0.275
NP_441812.1_1 Forward -146 -132 11.2087 0.291
NP_440784.1_7 Forward -260 -253 15.9687 0.0123
NP_440784.1_7 Reverse -253 -260 15.9687 0.0123
NP_442909.1_7 Reverse -247 -261 13.1753 0.128
NP_442909.1_7 Reverse -253 -267 7.96378 0.194
NP_440061.1_10 Reverse -374 -393 17.6982 0.223
NP_440878.1_9 Reverse -242 -261 -3.24547 0.29
NP_442062.1_8 Forward -261 -251 9.41981 0.0625
NP_442062.1_8 Reverse -252 -262 8.1415 0.0801
NP_441900.1_2 Reverse -124 -142 -6.4714 0.294
NP_441859.1_3 Forward -262 -243 7.57013 0.157
NP_441859.1_3 Reverse -251 -270 5.70185 0.192
NP_440304.1_4 Forward -263 -253 17.9746 0.00654
NP_440304.1_4 Reverse -250 -260 8.1415 0.0859
NP_440304.1_4 Reverse -184 -194 5.09324 0.229
NP_442242.1_4 Forward -260 -253 14.3954 0.0124
NP_442242.1_4 Reverse -253 -260 14.3954 0.0124
NP_441594.1_6 Reverse -177 -196 10.2259 0.133
NP_442742.1_9 Forward -71 -52 -10.6203 0.269
NP_440132.1_1 Forward -263 -245 9.75391 0.234
NP_440518.1_9 Forward -217 -198 12.0942 0.293
NP_441082.1_10 Reverse -333 -346 9.45906 0.245
NP_442726.1_1 Forward -127 -108 9.93088 0.233
NP_441083.1_5 Reverse -252 -262 18.0729 0.00245
NP_441083.1_5 Forward -261 -251 9.61647 0.0243
NP_442827.1_8 Reverse -244 -263 19.1731 0.0295
NP_442827.1_8 Forward -269 -250 0.785326 0.196
NP_441434.1_7 Reverse -254 -268 13.1759 0.0961
NP_441434.1_7 Forward -259 -245 3.53951 0.236
NP_441738.1_2 Reverse -254 -261 15.28 0.0102
NP_441558.1_5 Reverse -250 -269 9.24257 0.126
NP_441558.1_5 Forward -263 -244 5.80098 0.24
NP_440209.1_1 Forward -261 -253 18.1123 0.00295
NP_440209.1_1 Reverse -252 -260 15.1624 0.00583
NP_442136.1_4 Reverse -188 -207 11.7983 0.236
NP_442136.1_4 Reverse -254 -273 6.48849 0.295
NP_442136.1_4 Forward -80 -61 5.30853 0.295
NP_440447.1_6 Forward -269 -251 0.117479 0.295
NP_441770.1_4 Reverse -48 -67 -8.35868 0.243
NP_441716.1_1 Forward -95 -81 7.47274 0.169
NP_442111.1_4 Reverse -251 -265 10.3243 0.0545
NP_442111.1_4 Reverse -300 -314 2.16287 0.286
NP_440906.1_5 Forward -260 -253 15.8704 0.0124
NP_440906.1_5 Reverse -253 -260 15.8704 0.0124
NP_442596.1_1 Forward -260 -246 19.6651 0.137
NP_440747.1_10 Forward -264 -252 -11.7607 0.142
NP_440747.1_10 Reverse -249 -261 -11.8591 0.161
NP_441130.1_10 Reverse -250 -264 9.83269 0.12
NP_442634.1_4 Forward -263 -249 -4.81863 0.22
NP_440403.1_4 Forward -270 -251 -8.06369 0.251
NP_440842.1_10 Reverse -249 -263 2.45787 0.274
NP_442848.1_1 Forward -267 -253 -2.06536 0.263
NP_442848.1_9 Forward -267 -248 -0.590531 0.278
NP_443018.1_3 Forward -260 -253 14.8871 0.0123
NP_443018.1_3 Reverse -253 -260 14.8871 0.0123
NP_441316.1_7 Reverse -250 -265 6.17475 0.107
NP_441316.1_7 Forward -263 -248 -3.06836 0.273
NP_440376.1_1 Forward -261 -252 9.73449 0.0365
NP_440376.1_1 Reverse -252 -261 9.63616 0.0385
NP_440794.1_7 Forward -262 -245 11.2486 0.249
NP_442687.1_7 Reverse -251 -261 15.8113 0.0125
NP_442687.1_7 Forward -262 -252 9.51814 0.0994
NP_442687.1_7 Reverse -344 -354 6.27322 0.175
NP_441422.1_7 Forward -197 -180 -2.81276 0.223
NP_440691.1_10 Forward -186 -167 16.3224 0.185
NP_442296.1_5 Forward -268 -249 4.22769 0.251
NP_440360.1_10 Forward -259 -245 11.8976 0.141
NP_442658.1_1 Forward -263 -253 17.6791 0.00565
NP_442658.1_1 Reverse -250 -260 15.5158 0.0122
NP_441855.2_4 Reverse -244 -263 15.2111 0.13
NP_441414.1_9 Reverse -252 -271 -3.24547 0.132
NP_442321.1_4 Reverse -188 -207 11.5042 0.142
NP_441958.1_5 Forward -262 -252 11.3864 0.0074
NP_441958.1_5 Reverse -251 -261 10.6981 0.0112
NP_441127.1_1 Forward -261 -247 8.45605 0.295
NP_441127.1_5 Reverse -237 -256 13.9592 0.274
NP_442685.1_2 Reverse -321 -331 13.648 0.3
NP_442025.1_4 Reverse -69 -88 9.73422 0.291
NP_441754.1_6 Reverse -178 -197 13.2741 0.168
NP_442816.1_3 Reverse -103 -122 16.5191 0.298
NP_439905.1_1 Forward -260 -247 14.3756 0.127
NP_439905.1_1 Reverse -253 -266 8.18076 0.236
NP_440984.1_7 Forward -266 -252 11.701 0.122
NP_439990.1_8 Reverse -309 -328 0.196116 0.283
NP_442376.1_2 Reverse -247 -266 -12.1936 0.286
NP_442911.1_2 Reverse -242 -261 4.916 0.0361
NP_442911.1_2 Forward -271 -252 1.27776 0.0601
NP_443055.1_6 Reverse -244 -262 -1.9482 0.285
NP_442236.1_3 Forward -35 -16 10.6192 0.199
NP_440993.1_2 Forward -266 -250 2.71347 0.262
NP_440138.1_6 Forward -260 -241 1.6703 0.279
NP_441099.1_5 Reverse -242 -261 -10.4236 0.253
NP_442002.1_9 Forward -262 -255 14.1004 0.074
NP_442002.1_9 Reverse -344 -351 12.4288 0.185
NP_442002.1_9 Reverse -62 -69 11.1505 0.185
NP_441646.1_1 Reverse -338 -357 -1.96717 0.298
NP_442771.1_1 Forward -263 -245 4.9357 0.0672
NP_442771.1_1 Reverse -167 -185 -9.71562 0.231
NP_440484.1_1 Forward -63 -44 12.9783 0.191
NP_440147.1_4 Forward -263 -250 4.34585 0.164
NP_440147.1_4 Reverse -250 -263 4.24752 0.167
NP_441175.1_7 Reverse -252 -271 5.30933 0.283
NP_441550.1_8 Forward -263 -253 19.8424 0.00352
NP_441550.1_8 Reverse -250 -260 16.2041 0.0132
NP_441916.1_7 Reverse -252 -262 8.63316 0.0437
NP_441916.1_7 Forward -261 -251 7.55152 0.0639
NP_440465.1_10 Reverse -249 -268 -1.18052 0.29
NP_441041.1_7 Forward -264 -252 11.4991 0.0783
NP_441041.1_7 Reverse -249 -261 9.84704 0.107
NP_442396.1_5 Reverse -340 -353 8.37742 0.157
NP_442004.1_6 Reverse -345 -359 1.37622 0.29
NP_441725.1_5 Reverse -253 -263 18.7612 0.0119
NP_441725.1_5 Forward -260 -250 16.7946 0.0247
NP_439966.1_7 Reverse -250 -260 8.82935 0.13
NP_439966.1_7 Forward -263 -253 8.14104 0.14
NP_439966.1_9 Reverse -250 -259 9.93116 0.186
NP_439966.1_9 Forward -263 -254 0.983037 0.253
NP_440736.1_3 Forward -58 -39 -1.47551 0.286
NP_442941.1_3 Reverse -253 -263 2.43831 0.14
NP_440289.1_2 Reverse -249 -262 13.884 0.0123
NP_440289.1_2 Forward -264 -251 12.999 0.0132
NP_440289.1_2 Forward -209 -196 -1.45568 0.237
NP_441076.1_1 Forward -361 -342 11.8401 0.209
NP_440260.1_7 Reverse -190 -209 -4.52377 0.251
NP_440260.1_8 Reverse -165 -183 2.18243 0.182
NP_441514.1_1 Reverse -29 -39 14.1541 0.28
NP_442847.1_5 Reverse -44 -63 22.2223 0.0297
NP_442256.1_2 Reverse -250 -268 -7.35568 0.214
NP_442256.1_2 Forward -261 -243 -8.63398 0.232
NP_442012.1_6 Forward -229 -210 14.0608 0.284
NP_441644.1_6 Reverse -252 -262 13.0576 0.0244
NP_441644.1_6 Forward -261 -251 11.9759 0.0408
NP_443049.1_6 Forward -262 -252 13.9832 0.139
NP_442247.1_8 Forward -263 -249 11.6026 0.247
NP_442247.1_10 Reverse -319 -338 14.2574 0.277
NP_440253.1_2 Reverse -252 -270 -0.570838 0.216
NP_440929.1_8 Forward -261 -252 9.93116 0.0249
NP_440929.1_8 Reverse -252 -261 9.83282 0.0254
NP_441346.1_4 Forward -262 -243 13.1758 0.26
NP_442933.1_10 Forward -261 -252 9.04618 0.063
NP_442933.1_10 Reverse -252 -261 8.94785 0.0643
NP_441751.2_8 Reverse -253 -267 3.44117 0.0661
NP_442554.1_8 Reverse -253 -263 16.9913 0.0065
NP_442554.1_8 Forward -260 -250 7.45319 0.092
NP_441762.1_7 Forward -262 -250 13.2153 0.0142
NP_441762.1_7 Reverse -251 -263 3.67722 0.0676
NP_442142.1_4 Forward -59 -46 9.45847 0.095
NP_442292.1_1 Reverse -253 -262 9.53783 0.0183
NP_442292.1_1 Forward -260 -251 0.688044 0.23
NP_442476.1_6 Reverse -253 -267 16.8142 0.0367
NP_442476.1_6 Forward -260 -246 3.24451 0.161
NP_442381.1_8 Forward -264 -245 -12.7836 0.267
NP_443009.1_2 Reverse -254 -273 0.392778 0.216
NP_443009.1_5 Reverse -185 -196 10.5796 0.0792
NP_443009.1_5 Forward -262 -251 9.3996 0.0965
NP_443009.1_5 Reverse -251 -262 8.31797 0.112
NP_443009.1_5 Forward -107 -96 7.92465 0.118
NP_443009.1_5 Forward -355 -344 4.18809 0.259
NP_443009.1_5 Reverse -344 -355 3.49977 0.292
NP_440357.1_3 Reverse -250 -269 3.93269 0.242
NP_440357.1_3 Forward -263 -244 1.96607 0.269
NP_440158.1_8 Reverse -250 -269 10.8159 0.249
NP_442076.1_8 Forward -272 -253 18.1907 0.107
NP_442076.1_8 Reverse -241 -260 11.5042 0.203
NP_440183.1_9 Reverse -121 -140 -17.4051 0.276
NP_441198.1_8 Forward -263 -253 15.2245 0.0427
NP_441198.1_8 Reverse -250 -260 12.0017 0.167
NP_441468.1_1 Forward -260 -253 15.8704 0.0124
NP_441468.1_1 Reverse -253 -260 15.8704 0.0124
NP_441020.2_6 Forward -263 -246 22.2616 0.00186
NP_441020.2_6 Reverse -250 -267 19.0167 0.00985
NP_441015.1_10 Reverse -98 -117 -9.34199 0.282
NP_441673.1_1 Forward -261 -252 11.1111 0.0121
NP_441673.1_1 Reverse -252 -261 11.0128 0.018
NP_441826.1_2 Forward -267 -253 1.47456 0.151
NP_441826.1_2 Reverse -322 -336 -3.54032 0.286
NP_441330.1_1 Forward -61 -42 -7.57203 0.183
NP_441379.1_2 Reverse -375 -394 3.73603 0.263
NP_442490.1_9 Reverse -240 -259 13.9625 0.0593
NP_442868.1_6 Forward -263 -253 16.7946 0.0131
NP_442868.1_6 Reverse -250 -260 16.4996 0.0156
NP_442719.1_2 Forward -353 -335 0.215075 0.162
NP_442227.1_2 Reverse -245 -264 -1.37718 0.262
NP_442427.1_8 Forward -270 -251 17.8957 0.0442
NP_442427.1_8 Reverse -243 -262 12.1925 0.152
NP_442808.1_1 Reverse -251 -261 9.12434 0.0481
NP_442808.1_1 Forward -284 -274 3.22451 0.247
NP_440145.1_3 Forward -132 -113 -4.32711 0.228
NP_442542.1_2 Forward -263 -250 12.0157 0.114
NP_442542.1_2 Reverse -250 -263 9.75405 0.131
NP_442050.1_5 Forward -263 -253 14.9258 0.0175
NP_442050.1_5 Reverse -250 -260 13.9425 0.0265
NP_441114.1_3 Reverse -98 -107 13.8644 0.226
NP_441114.1_3 Forward -352 -343 7.37455 0.239
NP_442789.1_4 Forward -263 -244 -5.21209 0.268
NP_441878.1_6 Forward -262 -252 10.5014 0.0176
NP_441878.1_6 Reverse -251 -261 10.4031 0.0176
NP_441036.1_3 Forward -208 -189 0.392778 0.177
NP_441036.1_8 Reverse -251 -261 6.07655 0.242
NP_441557.1_5 Forward -261 -252 10.8161 0.00464
NP_441557.1_5 Reverse -252 -261 10.4228 0.00915
NP_441445.1_1 Forward -131 -112 0.294447 0.278
NP_442066.2_4 Forward -195 -176 -6.88371 0.254
NP_442066.2_9 Forward -265 -252 11.0324 0.154
NP_442066.2_9 Reverse -248 -261 10.639 0.154
NP_442469.1_2 Forward -360 -342 16.5388 0.216
NP_442183.1_1 Forward -261 -247 18.7808 0.0071
NP_442183.1_1 Reverse -252 -266 12.1926 0.0637
NP_442397.1_9 Forward -354 -335 3.6377 0.264
NP_441549.1_9 Reverse -109 -127 -8.63398 0.234
NP_441549.1_9 Forward -265 -247 -10.0106 0.268
NP_442347.1_2 Reverse -253 -262 3.34298 0.284
NP_440547.1_8 Reverse -166 -185 11.7992 0.298
NP_441037.1_4 Forward -263 -253 18.9151 0.00351
NP_441037.1_4 Reverse -250 -260 9.75413 0.21
NP_441037.1_4 Reverse -216 -226 8.19481 0.237
NP_441633.1_3 Reverse -250 -263 -1.45568 0.158
NP_441633.1_3 Forward -197 -184 -3.4223 0.177
NP_441633.1_3 Forward -263 -250 -3.71729 0.177
NP_440136.1_2 Forward -260 -253 15.9687 0.0123
NP_440136.1_2 Reverse -253 -260 15.9687 0.0123
NP_442590.1_10 Forward -92 -73 3.14605 0.295
NP_442998.1_5 Reverse -61 -71 17.4829 0.149
NP_442998.1_10 Reverse -254 -261 15.5754 0.0102
NP_442998.1_10 Forward -259 -252 5.84064 0.235
NP_440899.1_5 Forward -216 -197 1.86774 0.283
NP_440299.1_1 Reverse -280 -293 4.83694 0.197
NP_441799.1_1 Forward -265 -251 5.21053 0.218
NP_441799.1_1 Reverse -248 -262 3.8339 0.279
NP_441799.1_1 Forward -341 -327 3.53891 0.295
NP_441007.1_10 Reverse -247 -260 19.0955 0.0299
NP_441007.1_10 Forward -266 -253 18.4072 0.0299
NP_442334.1_1 Reverse -240 -259 -3.14714 0.208
NP_441435.1_4 Forward -250 -231 8.94757 0.255
NP_441559.1_8 Forward -358 -344 0.491246 0.166
NP_441559.1_8 Forward -288 -274 -0.000409212 0.171
NP_440915.1_6 Forward -265 -251 11.5043 0.0256
NP_440915.1_6 Reverse -248 -262 3.63784 0.101
NP_441866.1_3 Reverse -309 -322 11.0324 0.273
NP_440134.1_2 Reverse -335 -354 -0.688862 0.298
NP_441464.1_8 Forward -261 -247 10.226 0.182
NP_441464.1_8 Reverse -252 -266 5.60446 0.253
NP_441464.1_10 Reverse -52 -66 8.06273 0.287
NP_440026.1_7 Reverse -92 -107 17.5811 0.159
NP_442150.1_2 Reverse -317 -336 16.7341 0.215
NP_441939.1_3 Forward -260 -241 10.7175 0.122
NP_441494.1_6 Reverse -181 -194 17.3255 0.0795
NP_441494.1_6 Forward -359 -346 14.4739 0.168
NP_442386.1_9 Reverse -251 -260 8.35743 0.201
NP_442386.1_9 Reverse -118 -127 6.48915 0.219
NP_442386.1_9 Forward -262 -253 6.39082 0.219
NP_441340.1_5 Forward -260 -253 15.6737 0.0124
NP_441340.1_5 Reverse -253 -260 15.6737 0.0124
NP_442484.1_2 Forward -117 -98 4.81767 0.182
NP_440168.1_9 Reverse -250 -269 6.19431 0.227
NP_440168.1_9 Forward -263 -244 -5.11376 0.296
NP_442506.1_2 Reverse -285 -304 2.75272 0.278
NP_440161.1_3 Reverse -184 -203 10.5209 0.23
NP_440586.1_8 Forward -260 -253 13.2151 0.026
NP_440586.1_8 Reverse -253 -260 13.2151 0.026
NP_442251.1_6 Forward -260 -253 15.2804 0.0124
NP_442251.1_6 Reverse -253 -260 15.2804 0.0124
NP_442959.1_4 Forward -292 -273 9.0459 0.216
NP_442959.1_4 Reverse -339 -358 8.06259 0.224
NP_441262.1_3 Forward -261 -254 14.7888 0.0223
NP_441262.1_3 Reverse -252 -259 6.52896 0.0809
NP_443051.1_1 Forward -262 -253 18.0926 0.00402
NP_443051.1_1 Reverse -251 -260 8.65285 0.029
NP_443051.1_5 Forward -216 -197 3.83436 0.298
NP_439937.1_9 Forward -74 -57 7.3146 0.0798
NP_439937.1_9 Reverse -251 -268 -16.1864 0.287
NP_439943.1_2 Reverse -23 -42 13.5691 0.245
NP_440372.1_2 Forward -260 -253 16.3621 0.0124
NP_440372.1_2 Reverse -253 -260 16.3621 0.0124
NP_442783.1_10 Forward -173 -163 16.6958 0.149
NP_440316.1_10 Forward -262 -252 13.648 0.208
NP_439977.1_5 Reverse -246 -265 9.43923 0.0937
NP_440139.1_1 Reverse -246 -265 1.6703 0.252
NP_441572.1_7 Forward -101 -82 -2.95047 0.205
NP_441572.1_7 Forward -187 -168 -6.29373 0.288
NP_440267.1_2 Forward -249 -235 5.1122 0.281
NP_442384.1_10 Reverse -252 -265 1.39592 0.26
NP_442384.1_10 Forward -261 -248 0.60927 0.286
NP_442114.1_4 Reverse -252 -263 11.1701 0.142
NP_441877.1_5 Reverse -345 -364 5.70265 0.195
NP_442235.1_3 Forward -265 -246 2.26107 0.293
NP_442790.1_3 Forward -226 -207 9.93088 0.203
NP_442790.1_4 Forward -270 -251 1.96607 0.0729
NP_442790.1_4 Reverse -243 -262 -9.93197 0.198
NP_442262.1_10 Forward -260 -253 14.1988 0.0123
NP_442262.1_10 Reverse -253 -260 14.1988 0.0123
NP_440344.1_10 Reverse -245 -262 -3.50107 0.0833
NP_440531.1_6 Forward -64 -45 3.14605 0.148
NP_441060.1_9 Forward -261 -242 15.1424 0.143
NP_440189.1_2 Reverse -112 -131 1.0811 0.27
NP_442750.1_3 Reverse -232 -251 -12.0953 0.272
NP_441898.1_2 Reverse -277 -296 17.6982 0.162
NP_440297.1_9 Reverse -253 -263 9.51814 0.0917
NP_440297.1_9 Reverse -219 -229 3.91327 0.253
NP_440297.1_9 Forward -260 -250 1.06167 0.282
NP_441896.1_3 Reverse -243 -262 3.83436 0.161
NP_441896.1_3 Forward -270 -251 2.75272 0.186
NP_440999.1_1 Forward -67 -48 5.80018 0.197
NP_440999.1_9 Reverse -248 -262 -0.197071 0.201
NP_440888.1_2 Reverse -252 -266 5.21053 0.288
NP_439969.1_7 Forward -357 -339 15.0638 0.211
NP_442033.1_10 Reverse -61 -80 -9.83364 0.222
NP_442033.1_10 Reverse -250 -269 -13.6686 0.287
NP_440575.1_8 Reverse -31 -50 -6.29373 0.281
NP_442077.1_3 Forward -371 -352 12.2908 0.201
NP_441543.1_2 Reverse -253 -262 9.34117 0.0818
NP_441469.1_8 Forward -262 -253 13.3727 0.073
NP_441469.1_8 Reverse -251 -260 12.6844 0.0995
NP_441469.1_8 Forward -338 -329 9.63616 0.227
NP_443064.1_6 Reverse -252 -262 10.7247 0.136
NP_442578.1_7 Forward -260 -253 14.5921 0.026
NP_442578.1_7 Reverse -253 -260 14.5921 0.026
NP_442578.1_7 Reverse -302 -309 9.38056 0.138
NP_440710.1_1 Forward -235 -217 0.314141 0.163
NP_440148.1_6 Forward -378 -364 15.768 0.3
NP_441462.1_2 Forward -261 -251 17.8763 0.00406
NP_441462.1_2 Reverse -252 -262 10.3048 0.0123
NP_441621.1_7 Forward -263 -249 6.48943 0.068
NP_441621.1_7 Reverse -250 -264 4.91614 0.0934
NP_443062.1_1 Forward -394 -376 6.8883 0.19
NP_441601.1_4 Reverse -85 -104 -4.13045 0.293
NP_440516.1_8 Forward -261 -252 18.9776 0.00442
NP_440516.1_8 Reverse -252 -261 7.07956 0.0867
NP_442428.1_5 Forward -260 -253 15.8704 0.0124
NP_442428.1_5 Reverse -253 -260 15.8704 0.0124
NP_442428.1_5 Reverse -329 -336 3.67736 0.298
NP_440673.1_3 Forward -259 -252 13.1171 0.0426
NP_440673.1_3 Reverse -254 -261 12.4288 0.0426
NP_440673.1_3 Forward -54 -47 9.67555 0.179
NP_440673.1_3 Reverse -330 -337 8.20058 0.234
NP_441714.1_2 Reverse -351 -369 11.0322 0.248
NP_441052.1_2 Reverse -252 -262 10.9931 0.0285
NP_441052.1_2 Forward -261 -251 0.668351 0.256
NP_440992.1_5 Forward -255 -236 15.5892 0.272
NP_442219.1_9 Forward -260 -251 8.84951 0.0681
NP_442219.1_9 Reverse -253 -262 8.25953 0.0681
NP_440436.1_4 Reverse -253 -262 15.9289 0.00508
NP_440436.1_4 Forward -260 -251 6.78414 0.147
NP_441884.1_9 Forward -264 -245 -4.13045 0.0594
NP_441884.1_9 Reverse -249 -268 -16.8151 0.138
NP_441086.1_3 Reverse -309 -328 5.65597 0.29
NP_441719.1_4 Forward -260 -253 16.3621 0.0124
NP_441719.1_4 Reverse -253 -260 16.3621 0.0124
NP_441733.1_10 Forward -264 -251 17.1289 0.0382
NP_441733.1_10 Reverse -249 -262 13.294 0.0978
NP_441004.1_1 Forward -111 -92 -12.2919 0.245
NP_442813.1_4 Reverse -203 -222 -1.86883 0.255
NP_442813.1_4 Reverse -45 -64 -3.93378 0.296
NP_440296.1_10 Forward -264 -245 -15.1435 0.286
NP_442694.1_4 Reverse -53 -62 12.6844 0.248
NP_442854.1_6 Forward -82 -63 2.65439 0.272
NP_442430.1_10 Reverse -176 -195 16.8132 0.0934
NP_442308.1_8 Forward -265 -246 7.57094 0.299
NP_441851.1_3 Forward -139 -120 10.6192 0.253
NP_441851.1_10 Forward -262 -252 10.0098 0.106
NP_441851.1_10 Reverse -251 -261 8.1415 0.122
NP_442208.1_8 Forward -312 -294 15.9488 0.235
NP_442622.1_8 Reverse -252 -270 -18.9587 0.293
NP_441668.1_4 Forward -271 -252 4.12936 0.183
NP_442515.1_1 Forward -262 -248 16.1259 0.0227
NP_442515.1_1 Reverse -251 -265 15.5359 0.0244
NP_442709.1_3 Reverse -162 -181 14.5524 0.0744
NP_440432.1_9 Reverse -253 -268 16.5978 0.0106
NP_440432.1_9 Forward -260 -245 0.471552 0.159
NP_442843.1_1 Forward -152 -133 -9.24366 0.264
NP_442843.1_1 Reverse -329 -348 -9.83364 0.271
NP_440396.1_10 Reverse -253 -269 11.7592 0.186
NP_440396.1_10 Forward -345 -329 9.59593 0.276
NP_440933.1_7 Reverse -229 -248 17.7974 0.18
NP_440431.1_3 Reverse -309 -328 -10.7186 0.276
NP_442450.1_5 Reverse -250 -260 10.4031 0.115
NP_442450.1_5 Forward -263 -253 10.1081 0.115
NP_442006.1_2 Reverse -218 -235 -15.8908 0.23
NP_442006.1_2 Forward -261 -244 -18.1524 0.288
NP_442006.1_3 Forward -267 -249 -6.66736 0.298
NP_441570.1_1 Reverse -328 -346 -8.83064 0.122
NP_441570.1_1 Reverse -47 -65 -13.3539 0.222
NP_441570.1_1 Forward -310 -292 -17.8771 0.295
NP_441078.1_4 Forward -261 -252 9.93116 0.0203
NP_441078.1_4 Reverse -252 -261 9.83282 0.0226
NP_442729.1_8 Forward -265 -252 10.2457 0.125
NP_442729.1_8 Reverse -248 -261 10.1474 0.125
NP_442443.1_1 Forward -79 -60 5.99764 0.155
NP_442443.1_1 Forward -88 -69 5.60432 0.157
NP_442443.1_1 Reverse -329 -348 -3.04881 0.264
NP_440526.1_3 Reverse -253 -264 11.4645 0.0646
NP_440526.1_3 Forward -260 -249 2.22148 0.267
NP_441432.1_8 Forward -262 -253 8.35786 0.0755
NP_443024.1_3 Forward -74 -64 10.2065 0.289
NP_442320.1_8 Forward -267 -253 -3.44199 0.122
NP_440497.1_2 Reverse -98 -117 3.73603 0.293
NP_442815.1_2 Forward -263 -245 6.31233 0.212
NP_440760.1_1 Forward -261 -242 3.53937 0.0178
NP_440760.1_1 Reverse -252 -271 -4.6221 0.0452
NP_440760.1_1 Reverse -97 -116 -11.0136 0.0851
NP_440760.1_1 Forward -354 -335 -20.8467 0.225
NP_442797.1_7 Reverse -245 -263 -1.55415 0.299
NP_440913.1_1 Forward -263 -245 4.44404 0.268
NP_442489.1_2 Reverse -207 -226 5.60432 0.192
NP_442489.1_7 Forward -261 -252 10.4228 0.0151
NP_442489.1_7 Reverse -252 -261 10.3245 0.0193
NP_440757.1_6 Forward -265 -246 7.96426 0.3
NP_440565.1_7 Reverse -267 -286 -1.67217 0.284
NP_442079.1_7 Reverse -253 -272 1.57275 0.249
NP_442079.1_7 Forward -260 -241 0.0977854 0.287
NP_440559.1_1 Reverse -253 -262 17.306 0.00658
NP_440559.1_1 Forward -260 -251 9.14451 0.0586
NP_442763.1_8 Reverse -165 -184 4.62101 0.182
NP_441659.2_8 Forward -261 -251 9.81313 0.0269
NP_441659.2_8 Reverse -252 -262 9.81313 0.0269
NP_439956.1_7 Reverse -139 -158 4.42435 0.257
NP_440779.1_5 Forward -261 -244 -13.0392 0.21
NP_442346.1_5 Reverse -251 -261 14.1397 0.0164
NP_442346.1_5 Forward -262 -252 9.51814 0.118
NP_440352.1_5 Forward -218 -199 10.417 0.275
NP_440545.1_3 Reverse -182 -199 -6.54933 0.283
NP_440025.1_3 Reverse -59 -73 20.3889 0.0481
NP_440831.1_3 Reverse -243 -262 9.68776 0.188
NP_441629.1_3 Forward -63 -44 -2.95123 0.276
NP_441943.1_8 Reverse -170 -189 -4.6221 0.219
NP_442311.1_5 Forward -359 -340 2.85105 0.251
NP_442603.1_7 Reverse -252 -266 12.2903 0.1
NP_442603.1_7 Forward -261 -247 8.84875 0.162
NP_441050.1_5 Reverse -341 -359 5.42735 0.194
NP_440946.1_6 Reverse -216 -235 5.01433 0.294
NP_440449.1_6 Reverse -244 -262 8.74215 0.194
NP_441833.1_4 Forward -260 -253 15.9687 0.0124
NP_441833.1_4 Reverse -253 -260 15.9687 0.0124
NP_441329.1_6 Reverse -304 -323 -2.81744 0.294
NP_441112.1_1 Forward -307 -288 36.4802 0.00000411
NP_441112.1_2 Forward -25 -6 25.1722 0.00449
NP_441112.1_3 Forward -88 -69 27.4338 0.00208
NP_441112.1_4 Forward -112 -93 26.6471 0.00327
NP_441112.1_5 Forward -145 -126 30.5804 0.000304
NP_441112.1_6 Forward -66 -47 22.3206 0.0197
NP_441112.1_7 Forward -328 -309 24.5822 0.0121
NP_441112.1_10 Forward -169 -150 23.8939 0.00744
NP_442162.1_9 Forward -260 -253 16.2637 0.0124
NP_442162.1_9 Reverse -253 -260 16.2637 0.0124
NP_440671.1_4 Reverse -322 -336 8.94771 0.188
NP_441973.1_1 Reverse -202 -217 9.41967 0.235
NP_442199.1_5 Forward -244 -225 -6.98204 0.284
NP_442199.1_7 Reverse -68 -87 1.37531 0.272
NP_442140.1_3 Forward -260 -250 16.598 0.0255
NP_442140.1_3 Reverse -253 -263 14.828 0.0433
NP_442140.1_3 Reverse -74 -84 4.69992 0.238
NP_441813.1_5 Reverse -250 -260 8.92815 0.0347
NP_441813.1_5 Forward -263 -253 8.92815 0.0347
NP_440594.1_8 Reverse -253 -266 10.3434 0.168
NP_440590.1_4 Reverse -253 -266 -5.68391 0.286
NP_440567.1_1 Forward -260 -246 17.5025 0.0153
NP_440567.1_1 Reverse -253 -267 5.80112 0.0959
NP_442497.1_10 Reverse -253 -262 19.8626 0.00532
NP_442497.1_10 Forward -260 -251 10.8161 0.0087
NP_440821.1_4 Forward -263 -253 19.5479 0.00399
NP_440821.1_4 Reverse -250 -260 17.188 0.00705
NP_441239.1_9 Reverse -250 -262 17.7386 0.0146
NP_441239.1_9 Forward -263 -251 8.49544 0.131
NP_441727.1_3 Reverse -245 -264 8.16093 0.213
NP_441892.1_1 Forward -65 -48 -1.43612 0.205
NP_441892.1_1 Forward -270 -253 -2.81276 0.228
NP_441892.1_1 Reverse -243 -260 -2.91109 0.23
NP_441892.1_1 Reverse -376 -393 -6.05768 0.296
NP_442270.1_9 Forward -117 -98 2.55606 0.14
NP_442270.1_9 Reverse -207 -226 -8.94866 0.226
NP_440833.1_7 Forward -178 -159 17.6007 0.227
NP_442216.1_4 Reverse -200 -208 8.08217 0.255
NP_440876.1_5 Reverse -254 -273 6.09597 0.283
NP_440354.1_7 Reverse -246 -264 6.80398 0.278
NP_440546.1_4 Forward -261 -251 14.0213 0.0459
NP_440546.1_4 Reverse -252 -262 10.143 0.109
NP_440546.1_4 Forward -169 -159 7.23423 0.252
NP_440462.1_6 Forward -263 -253 10.4031 0.0396
NP_440462.1_6 Reverse -250 -260 9.41981 0.044
NP_440868.1_4 Reverse -248 -260 3.97222 0.129
NP_440868.1_4 Forward -265 -253 2.69391 0.149
NP_442402.1_2 Reverse -347 -361 11.1104 0.288
NP_440036.1_10 Reverse -330 -342 12.232 0.3
NP_442923.1_4 Reverse -218 -237 1.17943 0.18
NP_442039.1_4 Forward -260 -253 15.1821 0.0124
NP_442039.1_4 Reverse -253 -260 15.1821 0.0124
NP_441811.1_3 Forward -260 -246 18.2892 0.299
NP_441811.1_8 Reverse -246 -260 13.6676 0.178
NP_441811.1_8 Forward -267 -253 8.25939 0.238
NP_442837.1_3 Forward -260 -253 15.7721 0.0124
NP_442837.1_3 Reverse -253 -260 15.7721 0.0124
NP_442053.1_1 Forward -261 -252 17.601 0.00138
NP_442053.1_1 Reverse -252 -261 16.2243 0.00451
NP_440505.1_3 Forward -30 -20 8.4365 0.143
NP_440505.1_3 Forward -263 -253 7.84651 0.147
NP_440505.1_3 Reverse -222 -232 4.3066 0.3
NP_440505.1_7 Reverse -205 -224 3.83436 0.207
NP_441102.1_2 Reverse -337 -356 5.11266 0.298
NP_441252.1_6 Reverse -342 -349 14.3954 0.168
NP_441252.1_6 Reverse -60 -67 11.9372 0.25
NP_442532.1_7 Forward -261 -247 14.6509 0.0644
NP_440914.1_1 Forward -337 -327 9.00547 0.186
NP_440914.1_1 Forward -261 -251 7.24882 0.242
NP_441011.1_8 Reverse -253 -262 14.356 0.0249
NP_441011.1_8 Forward -260 -251 12.7828 0.0397
NP_442101.1_10 Forward -103 -84 -6.1954 0.183
NP_442533.1_6 Forward -261 -252 7.86621 0.0862
NP_442533.1_6 Reverse -252 -261 7.37455 0.0898
NP_441482.1_7 Forward -267 -253 6.3911 0.0298
NP_441482.1_7 Reverse -246 -260 -11.1118 0.237
NP_439944.1_9 Reverse -253 -263 17.4829 0.00423
NP_439944.1_9 Forward -260 -250 8.4365 0.108
NP_441749.1_7 Forward -266 -247 15.4374 0.205
NP_442202.1_10 Forward -347 -333 2.94952 0.282
NP_440115.1_6 Forward -264 -254 10.0098 0.115
NP_439965.1_7 Forward -308 -289 10.8063 0.294
NP_443045.1_2 Reverse -246 -265 16.7157 0.181
NP_441602.1_3 Reverse -247 -266 -5.31042 0.282
NP_442890.1_9 Reverse -293 -312 12.5858 0.254
NP_441972.1_5 Forward -260 -241 -5.70374 0.224
NP_441972.1_5 Reverse -98 -117 -8.94866 0.276
NP_441106.1_1 Forward -262 -253 9.73449 0.0311
NP_441825.1_4 Reverse -9 -19 11.5831 0.259
NP_439903.1_6 Forward -357 -338 -0.29631 0.28
NP_439903.1_6 Forward -264 -245 -0.787962 0.285
NP_442306.1_10 Forward -266 -247 -20.7484 0.226
NP_441286.1_1 Forward -262 -250 13.8053 0.00558
NP_441286.1_1 Reverse -251 -263 5.54551 0.0259
NP_440670.1_8 Forward -261 -252 9.04618 0.0606
NP_440670.1_8 Reverse -252 -261 8.75118 0.0606
NP_441886.1_1 Reverse -249 -268 4.81767 0.159
NP_440886.1_7 Reverse -251 -261 8.04271 0.0805
NP_440886.1_7 Forward -262 -252 6.76441 0.114
NP_440886.1_7 Forward -338 -328 5.38779 0.185
NP_442614.1_2 Forward -261 -247 10.0294 0.235
NP_442072.1_9 Reverse -251 -269 -21.9087 0.215
NP_440907.2_8 Reverse -253 -263 19.449 0.00351
NP_440907.2_8 Forward -260 -250 10.3043 0.103
NP_441021.1_1 Forward -260 -241 -10.3253 0.234
NP_441626.1_2 Forward -260 -253 15.7721 0.0124
NP_441626.1_2 Reverse -253 -260 15.7721 0.0124
NP_441460.1_2 Forward -190 -177 13.2934 0.289
NP_442615.1_1 Reverse -243 -261 -2.83245 0.151
NP_442615.1_1 Forward -270 -252 -6.27403 0.241
NP_441962.1_4 Reverse -247 -266 7.66927 0.0686
NP_441962.1_4 Reverse -181 -200 -3.14714 0.143
NP_440387.1_1 Forward -261 -245 -3.48138 0.16
NP_440387.1_1 Reverse -252 -268 -3.8747 0.169
NP_440387.1_1 Reverse -113 -129 -3.97304 0.171
NP_440855.1_9 Reverse -117 -136 19.5664 0.22
NP_441431.1_2 Reverse -249 -263 6.0955 0.28
NP_441431.1_2 Forward -264 -250 5.50552 0.298
NP_441488.1_8 Forward -111 -97 7.86545 0.221
NP_441836.1_2 Reverse -246 -265 -4.32711 0.255
NP_441836.1_2 Forward -264 -245 -6.39206 0.297
NP_441993.1_1 Forward -195 -176 1.26449 0.282
NP_441174.1_2 Forward -179 -165 11.7993 0.28
NP_442352.1_1 Reverse -246 -259 13.7085 0.285
NP_440114.1_10 Forward -261 -247 12.586 0.0783
NP_440114.1_10 Reverse -252 -266 11.8976 0.0996
NP_440114.1_10 Reverse -47 -61 6.6861 0.26
NP_440114.1_10 Forward -354 -340 5.80112 0.292
NP_440293.1_3 Forward -269 -250 -5.21209 0.274
NP_440766.1_5 Reverse -316 -328 9.66112 0.275
NP_441237.1_5 Forward -93 -75 15.5554 0.196
NP_441237.1_6 Forward -143 -126 18.6234 0.042
NP_441237.1_9 Reverse -253 -263 17.2863 0.00348
NP_441237.1_9 Forward -260 -250 16.893 0.01
NP_440457.1_1 Forward -265 -253 8.10212 0.101
NP_440801.1_8 Forward -215 -196 2.16274 0.229
NP_442509.1_9 Forward -261 -251 15.9091 0.00953
NP_442509.1_9 Reverse -252 -262 13.6475 0.0475
NP_440554.1_4 Reverse -253 -263 6.27322 0.123
NP_442862.1_3 Reverse -348 -365 11.1502 0.202
NP_441885.1_5 Forward -261 -251 2.24165 0.0822
NP_441885.1_5 Reverse -252 -262 1.55333 0.109
NP_441885.1_5 Forward -122 -112 -1.69159 0.277
NP_441428.1_8 Reverse -244 -263 7.37428 0.206
NP_442341.1_7 Reverse -79 -93 3.73617 0.214
NP_442341.1_7 Forward -262 -248 2.65453 0.249
NP_442341.1_7 Reverse -251 -265 2.5562 0.252
NP_440409.1_1 Forward -269 -250 3.34271 0.18
NP_440191.1_4 Reverse -353 -363 15.4751 0.254
NP_440423.1_6 Forward -269 -250 -21.0434 0.279
NP_443000.1_7 Forward -263 -253 2.14332 0.226
NP_441842.1_10 Reverse -245 -259 11.8976 0.115
NP_440275.1_3 Forward -263 -253 19.5479 0.00756
NP_440275.1_3 Reverse -250 -260 10.8948 0.0398
NP_442932.1_10 Forward -152 -133 10.9142 0.123
NP_440679.1_10 Forward -268 -249 -13.0786 0.221
NP_442451.1_2 Reverse -244 -263 -8.06369 0.241
NP_439962.1_4 Reverse -244 -263 -0.885524 0.204
NP_439962.1_4 Forward -278 -259 -5.31042 0.278
NP_439962.1_4 Forward -89 -70 -8.26035 0.292
NP_440175.1_7 Forward -199 -181 8.67997 0.292
NP_440149.1_10 Reverse -167 -186 -11.9969 0.285
NP_440216.1_1 Forward -261 -247 -12.2918 0.256
NP_440216.1_1 Reverse -252 -266 -12.3901 0.264
NP_440216.1_9 Reverse -26 -35 13.8644 0.184
NP_440172.1_1 Forward -261 -251 17.2863 0.00544
NP_440172.1_1 Reverse -252 -262 6.46988 0.103
NP_442015.1_10 Reverse -93 -106 -0.472371 0.268
NP_441226.1_7 Forward -260 -253 14.4934 0.0123
NP_441226.1_7 Reverse -253 -260 14.4934 0.0123
NP_441226.1_7 Forward -252 -245 9.47853 0.147
NP_441111.1_7 Reverse -253 -261 18.7023 0.00294
NP_441111.1_7 Forward -260 -252 8.96754 0.0463
NP_441766.1_2 Reverse -252 -261 18.2893 0.00297
NP_441766.1_2 Forward -261 -252 9.14451 0.0337
NP_441766.1_2 Forward -169 -160 1.57302 0.282
NP_440416.1_9 Reverse -165 -184 -18.0934 0.251
NP_440261.1_5 Reverse -253 -266 8.77074 0.0244
NP_440261.1_5 Forward -260 -247 -0.964025 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATCAACTCGATGATCTAGTTCAGGAGGTCTTTTTCAAAGTGTGGAAAGGATTGCCCAAACTCCGCAATCACAATTTTTTTGCCACCTGGCTTTATCGCATTACTTGGAATGTGGCCCAGGATGCCCGTAAACAATTGGGGCGATCGCGCCAACGGATTCATCAACCCAGTACTGCCTTAGCCGACAACGAAGGGGAAATATCCCTGCAATTGTCTCGGCCCGAGGACAGTCCCGATCTGTTGCAACTCCATTACCAGGATTTGGTGCAGCAAGGCTTGGCTACCCTCAGCTTTGAGCATCGCACGGTGTTGGTGCTCCACGATCTGGAGGATTTGCCCCAAAAGACCATTGCGGAGGTACTAAATTTGCCTGGGGGTACTATCAAATCCCGTTTATTCT

CDS

ATGCTCGGCGGGCCATGCGGGAATTCTTGCAGCAACAGGGAGTTCAAGATGTCTTTTAACCCTTTTAATACCGATCAAGAGACAAAACTGAAGCACTTTTTGCAGGCCCATCGCCCAGGGGTTCCCGCTCCCTCGCCGGCACTAGAGGAGCAGATTTTGCAACGGATCAAGCAATGTCCCCGCCGTTCCTTGACCCCTAGTTTGTCTTGGCAATGGCTGGGGGGAGGAGTTCTACTCTTCGGCCTAGTGGGGGCAGGGCTTTTCGGTTGGCGATCGCCGATGCAAACGGCCGAAGAACCGAACATGGCGGAACTGGAAGCTTTCCTCCAGGAAACTTGGTCTGGCTCCATCTACCCCGACAGCGTCAACGGAGCTAACCAGGATTGGTGGTTACTAAGCGATCCCCCACGGGAATAA

Protein

MLGGPCGNSCSNREFKMSFNPFNTDQETKLKHFLQAHRPGVPAPSPALEEQILQRIKQCPRRSLTPSLSWQWLGGGVLLFGLVGAGLFGWRSPMQTAEEPNMAELEAFLQETWSGSIYPDSVNGANQDWWLLSDPPRE