Your browser is old and dusty. Try Google Chrome!

Details for sll0856

ORF sll0856
Accession NP_441113.1
Symbol sigH
Category RNA synthesis, modification, and DNA transcription
Definition RNA polymerase ECF-type (group 3) sigma-E factor
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -368 -382 11.701 0.0507
NP_441061.1_2 Forward -375 -361 5.21113 0.14
NP_441061.1_2 Forward -337 -323 1.27789 0.192
NP_440795.1_7 Forward -375 -368 14.6904 0.0123
NP_440795.1_7 Reverse -368 -375 14.6904 0.0123
NP_441418.1_3 Reverse -274 -293 13.9891 0.176
NP_441418.1_6 Forward -376 -357 -0.688862 0.0105
NP_441418.1_6 Forward -250 -231 -28.6149 0.206
NP_441418.1_6 Reverse -367 -386 -28.6149 0.206
NP_442291.1_5 Forward -377 -361 1.14018 0.152
NP_442291.1_5 Reverse -366 -382 -3.77637 0.252
NP_441453.1_4 Reverse -367 -375 16.539 0.00633
NP_441453.1_4 Forward -376 -368 16.539 0.00633
NP_442151.1_6 Reverse -367 -381 13.6676 0.0474
NP_443043.1_7 Reverse -5 -24 13.8641 0.128
NP_441818.1_1 Reverse -368 -379 18.8393 0.00301
NP_441818.1_1 Forward -375 -364 8.90795 0.271
NP_441818.1_6 Reverse -360 -374 10.9143 0.253
NP_441818.1_9 Forward -252 -233 -3.44213 0.226
NP_441818.1_9 Reverse -329 -348 -9.24366 0.288
NP_440226.1_1 Reverse -367 -386 13.3725 0.0366
NP_440226.1_1 Forward -376 -357 3.73603 0.215
NP_441630.1_3 Reverse -359 -378 0.0977854 0.285
NP_441098.1_3 Reverse -305 -324 -1.90806 0.277
NP_440150.1_6 Forward -379 -360 16.6174 0.0993
NP_440996.1_3 Forward -251 -233 9.85225 0.269
NP_442287.1_3 Reverse -359 -376 12.4278 0.3
NP_443002.1_5 Reverse -224 -242 15.653 0.192
NP_442173.1_1 Forward -375 -367 15.4574 0.00633
NP_442173.1_1 Reverse -368 -376 15.4574 0.00633
NP_442173.1_6 Reverse -68 -82 18.6825 0.0774
NP_442752.1_4 Forward -376 -369 13.8055 0.0199
NP_442752.1_4 Reverse -367 -374 13.8055 0.0199
NP_442752.1_4 Reverse -111 -118 6.52896 0.154
NP_442752.1_4 Reverse -329 -336 5.54565 0.194
NP_443027.1_4 Forward -378 -368 14.0414 0.0452
NP_443027.1_4 Reverse -365 -375 11.8781 0.0872
NP_441812.1_3 Reverse -366 -380 7.9644 0.254
NP_441812.1_3 Forward -377 -363 6.88276 0.287
NP_442975.1_10 Reverse -363 -377 4.22722 0.245
NP_441675.1_4 Forward -233 -214 3.53937 0.267
NP_440784.1_7 Forward -375 -368 15.9687 0.0123
NP_440784.1_7 Reverse -368 -375 15.9687 0.0123
NP_442909.1_7 Reverse -368 -382 5.70218 0.27
NP_441250.1_3 Reverse -117 -136 1.17943 0.297
NP_440061.1_9 Forward -378 -364 13.4703 0.0811
NP_440061.1_9 Reverse -327 -341 7.86545 0.189
NP_440110.1_8 Forward -240 -221 9.73422 0.0906
NP_441054.1_4 Forward -386 -368 -0.177514 0.18
NP_441476.1_5 Forward -387 -368 -2.55715 0.229
NP_439979.1_2 Forward -376 -357 11.2092 0.192
NP_442062.1_8 Forward -376 -366 19.4496 0.000558
NP_442062.1_8 Reverse -367 -377 17.3846 0.00193
NP_442062.1_8 Reverse -329 -339 4.20827 0.228
NP_441900.1_2 Reverse -225 -243 -2.83317 0.279
NP_440304.1_4 Forward -378 -368 10.8948 0.051
NP_440304.1_4 Reverse -365 -375 1.84832 0.299
NP_442242.1_4 Forward -375 -368 14.3954 0.0124
NP_442242.1_4 Reverse -368 -375 14.3954 0.0124
NP_440044.1_8 Reverse -368 -387 4.12936 0.12
NP_441781.1_7 Reverse -367 -386 5.80098 0.186
NP_441581.1_4 Forward -240 -221 3.93269 0.272
NP_441935.1_1 Forward -55 -36 10.4225 0.211
NP_441594.1_6 Reverse -364 -383 5.01433 0.211
NP_442276.1_2 Forward -262 -243 14.2574 0.264
NP_440132.1_1 Reverse -365 -383 8.27895 0.277
NP_442110.1_7 Reverse -367 -381 8.94771 0.0795
NP_442896.1_6 Reverse -170 -189 18.3873 0.161
NP_441082.1_7 Forward -234 -215 24.2872 0.0119
NP_441772.1_9 Reverse -298 -316 18.5054 0.0643
NP_440856.1_7 Forward -256 -237 1.27776 0.161
NP_440856.1_7 Forward -379 -360 -7.37537 0.252
NP_441083.1_5 Reverse -367 -377 20.3345 0.00053
NP_441083.1_5 Forward -376 -366 11.3864 0.0159
NP_441083.1_5 Forward -338 -328 -0.708283 0.276
NP_442827.1_8 Reverse -359 -378 -0.00131823 0.217
NP_441738.1_2 Forward -374 -367 15.28 0.0102
NP_441738.1_2 Reverse -369 -376 15.28 0.0102
NP_440209.1_1 Reverse -367 -375 18.1123 0.00295
NP_440209.1_1 Forward -376 -368 18.1123 0.00295
NP_442889.1_8 Reverse -364 -378 13.2736 0.0588
NP_441713.1_1 Forward -382 -363 -7.67036 0.135
NP_442675.1_4 Reverse -365 -383 -11.5839 0.3
NP_441770.1_1 Reverse -222 -241 21.2381 0.0611
NP_440178.1_7 Reverse -366 -385 -5.11376 0.0603
NP_442570.1_3 Reverse -365 -384 -6.09707 0.255
NP_441716.1_2 Forward -205 -186 -0.759618 0.277
NP_443013.1_7 Forward -247 -228 16.3224 0.275
NP_442111.1_4 Forward -377 -363 10.3243 0.0545
NP_440343.1_3 Reverse -225 -243 8.6715 0.195
NP_440906.1_5 Forward -375 -368 15.8704 0.0124
NP_440906.1_5 Reverse -368 -375 15.8704 0.0124
NP_440747.1_10 Forward -379 -367 7.51213 0.00286
NP_440747.1_10 Reverse -364 -376 7.31547 0.00577
NP_441130.1_10 Forward -378 -364 18.1908 0.0142
NP_441130.1_10 Reverse -365 -379 8.75105 0.133
NP_441486.1_1 Forward -379 -365 12.9793 0.00973
NP_441486.1_1 Reverse -364 -378 11.5043 0.016
NP_441486.1_1 Reverse -122 -136 0.687908 0.129
NP_442634.1_4 Reverse -365 -379 -2.06536 0.149
NP_440403.1_4 Reverse -358 -377 7.47261 0.0957
NP_440403.1_10 Forward -376 -357 4.81767 0.251
NP_441014.1_5 Forward -104 -86 10.4422 0.263
NP_441014.1_8 Reverse -344 -363 -8.85033 0.288
NP_441014.1_8 Reverse -233 -252 -9.34199 0.295
NP_441014.1_10 Forward -377 -358 1.86696 0.223
NP_441014.1_10 Reverse -366 -385 -0.0996487 0.246
NP_442848.1_1 Forward -382 -368 5.80112 0.0803
NP_442848.1_9 Reverse -331 -350 -0.295539 0.278
NP_443018.1_3 Forward -375 -368 14.8871 0.0123
NP_443018.1_3 Reverse -368 -375 14.8871 0.0123
NP_441634.1_8 Forward -378 -364 12.6843 0.0486
NP_441634.1_8 Reverse -365 -379 -4.52363 0.295
NP_440376.1_1 Forward -376 -367 19.4693 0.000692
NP_440376.1_1 Reverse -367 -376 19.4693 0.000692
NP_441002.1_3 Forward -50 -31 8.55343 0.299
NP_441588.1_4 Reverse -369 -379 8.63316 0.14
NP_442687.1_7 Reverse -366 -376 15.8113 0.0125
NP_442687.1_7 Forward -75 -65 9.91146 0.0994
NP_442687.1_7 Forward -377 -367 8.92815 0.0994
NP_441797.1_4 Reverse -371 -388 19.2134 0.0904
NP_442485.1_3 Forward -351 -332 1.0811 0.233
NP_442485.1_3 Forward -255 -236 0.786102 0.234
NP_442485.1_3 Reverse -356 -375 -0.688862 0.253
NP_442485.1_3 Forward -378 -359 -0.787193 0.253
NP_442485.1_3 Reverse -230 -249 -2.65548 0.264
NP_442958.1_3 Reverse -356 -375 7.37428 0.156
NP_440642.1_10 Forward -277 -263 2.16228 0.283
NP_441013.1_2 Reverse -333 -351 2.0841 0.242
NP_441013.1_3 Forward -58 -39 7.66927 0.263
NP_442770.1_10 Forward -192 -178 20.1604 0.0478
NP_441422.1_7 Reverse -365 -382 -1.33779 0.186
NP_441422.1_7 Reverse -221 -238 -5.56602 0.247
NP_440533.1_6 Forward -104 -85 12.4875 0.238
NP_440667.1_2 Forward -244 -225 -6.58872 0.273
NP_440667.1_2 Forward -241 -222 -7.37537 0.275
NP_441763.1_10 Forward -249 -230 4.91521 0.297
NP_442720.1_8 Reverse -3 -21 9.75391 0.297
NP_442658.1_1 Reverse -365 -375 17.0891 0.00615
NP_442658.1_1 Forward -378 -368 6.76441 0.214
NP_442658.1_1 Reverse -239 -249 5.68278 0.258
NP_440656.1_8 Forward -387 -368 -6.29373 0.243
NP_442544.1_6 Reverse -360 -379 3.83436 0.0907
NP_441414.1_9 Reverse -367 -386 -9.24366 0.256
NP_440800.1_7 Forward -310 -296 10.1277 0.3
NP_441478.1_5 Reverse -329 -348 15.0441 0.238
NP_442937.1_5 Reverse -60 -79 9.24257 0.198
NP_441958.1_5 Forward -377 -367 12.2714 0.00183
NP_441958.1_5 Reverse -366 -376 12.2714 0.00183
NP_441127.1_1 Forward -346 -332 11.6026 0.217
NP_442836.1_5 Reverse -361 -380 1.47442 0.283
NP_439905.1_1 Forward -375 -362 13.6873 0.155
NP_439905.1_2 Reverse -332 -346 14.4542 0.188
NP_439905.1_2 Reverse -236 -250 8.35772 0.265
NP_440984.1_7 Reverse -362 -376 11.8976 0.122
NP_441097.1_2 Forward -66 -49 9.57695 0.223
NP_439990.1_5 Reverse -358 -371 7.39411 0.198
NP_439990.1_5 Reverse -60 -73 6.90245 0.22
NP_439990.1_5 Forward -381 -368 6.70579 0.223
NP_442690.1_1 Forward -193 -174 -11.6036 0.232
NP_442690.1_1 Reverse -172 -191 -16.6185 0.29
NP_442911.1_2 Forward -386 -367 -5.40875 0.158
NP_442911.1_2 Forward -348 -329 -7.57203 0.214
NP_441580.1_6 Forward -387 -368 11.0125 0.0559
NP_440153.1_5 Forward -375 -361 2.35953 0.225
NP_442064.1_4 Reverse -363 -382 4.62021 0.286
NP_443055.1_6 Reverse -350 -368 9.94979 0.132
NP_443055.1_6 Forward -384 -366 0.411736 0.243
NP_441099.1_5 Forward -386 -367 5.40766 0.0469
NP_441099.1_5 Reverse -357 -376 -5.31042 0.151
NP_442002.1_1 Reverse -99 -117 -7.65067 0.251
NP_442002.1_9 Reverse -366 -373 10.7572 0.185
NP_441294.1_7 Reverse -363 -377 11.5544 0.137
NP_441646.1_1 Reverse -360 -379 0.884433 0.242
NP_442438.1_10 Forward -381 -367 8.75105 0.0731
NP_441000.1_6 Forward -377 -363 5.70279 0.0933
NP_441000.1_6 Reverse -366 -380 -4.91696 0.254
NP_440484.1_3 Forward -240 -226 11.5043 0.242
NP_441674.1_10 Reverse -214 -232 0.21581 0.29
NP_440147.1_4 Reverse -365 -378 9.95071 0.0362
NP_440147.1_4 Forward -378 -365 8.47575 0.0504
NP_441550.1_8 Forward -378 -368 12.3692 0.0336
NP_441550.1_8 Reverse -365 -375 8.82935 0.112
NP_441916.1_7 Forward -376 -366 18.4663 0.00144
NP_441916.1_7 Reverse -367 -377 10.3048 0.0261
NP_441041.1_4 Reverse -367 -386 5.11266 0.0533
NP_441041.1_4 Forward -244 -225 -1.47551 0.1
NP_441041.1_7 Reverse -364 -376 8.58373 0.133
NP_441041.1_7 Forward -341 -329 6.15429 0.221
NP_442396.1_5 Forward -380 -367 9.16406 0.13
NP_442004.1_6 Reverse -367 -381 10.3243 0.14
NP_441725.1_5 Reverse -368 -378 11.2881 0.0247
NP_441725.1_5 Forward -375 -365 2.04498 0.115
NP_439966.1_7 Reverse -365 -375 17.9741 0.00631
NP_439966.1_7 Forward -378 -368 15.8108 0.0124
NP_439966.1_9 Reverse -365 -374 0.884706 0.253
NP_440202.1_8 Reverse -359 -378 11.8488 0.272
NP_442941.1_3 Reverse -368 -378 19.9412 0.00262
NP_442941.1_3 Forward -375 -365 10.7964 0.0116
NP_442941.1_3 Forward -337 -327 0.963343 0.16
NP_440289.1_2 Reverse -364 -377 11.229 0.021
NP_440289.1_2 Forward -379 -366 6.60746 0.0591
NP_440289.1_2 Forward -343 -330 0.0192843 0.178
NP_440289.1_2 Reverse -326 -339 -4.89726 0.294
NP_440260.1_8 Forward -362 -344 -7.749 0.3
NP_442281.1_1 Forward -381 -367 14.9452 0.0151
NP_442281.1_1 Reverse -362 -376 10.8154 0.0537
NP_442256.1_2 Forward -378 -360 -7.84733 0.215
NP_440437.1_1 Reverse -223 -242 6.4893 0.0741
NP_442500.1_8 Reverse -272 -286 9.31072 0.285
NP_440498.1_1 Forward -385 -367 0.117479 0.218
NP_441644.1_6 Reverse -367 -377 17.3841 0.00127
NP_441644.1_6 Forward -376 -366 10.1076 0.0628
NP_442215.1_2 Reverse -365 -381 2.32015 0.117
NP_440253.1_2 Forward -376 -358 1.00246 0.173
NP_440253.1_2 Reverse -367 -385 -3.52077 0.294
NP_440929.1_8 Forward -376 -367 19.2726 0.000701
NP_440929.1_8 Reverse -367 -376 19.2726 0.000701
NP_440929.1_8 Reverse -329 -338 6.39124 0.0992
NP_442933.1_2 Reverse -266 -284 6.20896 0.278
NP_442933.1_10 Forward -376 -367 17.601 0.00325
NP_442933.1_10 Reverse -367 -376 17.601 0.00325
NP_441751.2_8 Reverse -368 -382 11.5043 0.0235
NP_441751.2_8 Forward -337 -323 1.76955 0.0968
NP_441751.2_8 Forward -375 -361 -3.93365 0.157
NP_439922.1_6 Forward -286 -268 17.2271 0.262
NP_442554.1_8 Reverse -368 -378 15.9097 0.00747
NP_442554.1_8 Forward -375 -365 14.1397 0.0144
NP_441762.1_7 Forward -377 -365 2.98891 0.0676
NP_441762.1_7 Reverse -366 -378 2.30059 0.0676
NP_442142.1_4 Forward -379 -366 16.7349 0.0264
NP_442142.1_4 Reverse -364 -377 6.0169 0.175
NP_442292.1_1 Reverse -368 -377 18.486 0.00229
NP_442292.1_1 Forward -375 -366 9.63616 0.0183
NP_442292.1_1 Forward -337 -328 -0.786921 0.287
NP_440039.1_9 Reverse -356 -375 16.0274 0.253
NP_442476.1_6 Forward -375 -361 12.586 0.0469
NP_442476.1_6 Reverse -368 -382 4.52282 0.143
NP_442381.1_8 Forward -379 -360 -14.2585 0.28
NP_443009.1_5 Forward -377 -366 18.3477 0.00265
NP_442301.1_2 Reverse -222 -241 8.25844 0.23
NP_441715.1_4 Forward -375 -365 18.8596 0.00741
NP_441715.1_4 Reverse -368 -378 14.828 0.0268
NP_441715.1_4 Forward -337 -327 4.3066 0.29
NP_440183.1_1 Reverse -368 -387 12.5858 0.244
NP_440183.1_9 Forward -374 -355 -18.8801 0.276
NP_440970.1_1 Forward -37 -23 17.5025 0.272
NP_440379.1_2 Reverse -328 -347 13.5691 0.192
NP_440379.1_5 Reverse -232 -251 -3.73712 0.205
NP_440379.1_5 Forward -391 -372 -9.44032 0.264
NP_440379.1_5 Forward -376 -357 -10.6203 0.281
NP_441468.1_1 Forward -375 -368 15.8704 0.0124
NP_441468.1_1 Reverse -368 -375 15.8704 0.0124
NP_441468.1_1 Reverse -330 -337 8.79057 0.111
NP_441020.2_6 Reverse -327 -344 9.97027 0.156
NP_441020.2_6 Forward -378 -361 8.69197 0.191
NP_441015.1_10 Forward -243 -224 -8.16202 0.272
NP_441673.1_1 Forward -376 -367 20.8459 0.000698
NP_441673.1_1 Reverse -367 -376 20.8459 0.000698
NP_441876.1_9 Forward -151 -141 11.1893 0.28
NP_441826.1_2 Reverse -367 -381 -0.492064 0.213
NP_441826.1_2 Forward -382 -368 -3.34366 0.284
NP_441637.1_9 Forward -290 -272 -1.94747 0.292
NP_442868.1_6 Reverse -365 -375 10.3048 0.038
NP_442868.1_6 Forward -378 -368 9.91146 0.038
NP_441056.1_1 Reverse -367 -386 2.3594 0.137
NP_441612.1_2 Reverse -367 -377 8.54929 0.21
NP_442227.1_2 Reverse -237 -256 -2.26216 0.272
NP_442361.1_3 Reverse -223 -236 8.77074 0.285
NP_442427.1_8 Forward -385 -366 6.58763 0.236
NP_442808.1_1 Reverse -366 -376 18.4657 0.00201
NP_442808.1_1 Forward -377 -367 8.63269 0.0481
NP_442542.1_2 Reverse -365 -378 17.6205 0.0422
NP_442542.1_9 Reverse -360 -374 13.8636 0.108
NP_442113.1_10 Reverse -228 -247 7.86593 0.119
NP_442050.1_5 Forward -378 -368 16.4991 0.00812
NP_442050.1_5 Reverse -365 -375 6.96107 0.27
NP_440558.1_2 Forward -385 -366 2.65439 0.166
NP_440558.1_2 Forward -347 -328 -0.688862 0.204
NP_442789.1_4 Reverse -329 -348 -0.000545616 0.197
NP_442789.1_4 Forward -240 -221 -5.60541 0.273
NP_441518.1_3 Forward -386 -367 -4.6221 0.12
NP_441518.1_3 Reverse -357 -376 -14.3569 0.275
NP_441878.1_6 Forward -377 -367 10.4031 0.0176
NP_441878.1_6 Reverse -366 -376 10.4031 0.0176
NP_441036.1_8 Reverse -366 -376 17.7779 0.000554
NP_441036.1_8 Forward -377 -367 8.33817 0.174
NP_441557.1_5 Forward -376 -367 19.9609 0.000699
NP_441557.1_5 Reverse -367 -376 19.9609 0.000699
NP_441445.1_1 Forward -385 -366 7.27595 0.136
NP_442066.2_9 Reverse -363 -376 11.229 0.154
NP_442066.2_9 Forward -380 -367 9.06573 0.181
NP_440101.1_3 Reverse -362 -381 12.7825 0.0849
NP_440101.1_3 Forward -387 -368 1.17943 0.282
NP_441458.1_10 Reverse -358 -377 3.53937 0.248
NP_442183.1_1 Reverse -367 -381 17.6008 0.0104
NP_442183.1_1 Forward -376 -362 11.7993 0.0675
NP_442183.1_1 Reverse -329 -343 4.42448 0.261
NP_440276.1_8 Forward -116 -97 5.99764 0.3
NP_441549.1_9 Forward -242 -224 -0.669169 0.148
NP_441549.1_9 Reverse -363 -381 -3.02911 0.198
NP_442347.1_2 Reverse -368 -377 12.4878 0.056
NP_442347.1_2 Forward -375 -366 11.1111 0.056
NP_442347.1_2 Forward -337 -328 6.39124 0.17
NP_442645.1_2 Forward -384 -365 -4.03212 0.0531
NP_442888.1_5 Reverse -370 -389 11.9958 0.203
NP_441037.1_4 Forward -340 -330 6.92787 0.237
NP_441037.1_4 Reverse -365 -375 6.92787 0.237
NP_441633.1_3 Reverse -365 -378 5.62415 0.0481
NP_441633.1_3 Forward -378 -365 1.39592 0.109
NP_441633.1_8 Reverse -59 -78 14.6508 0.235
NP_442764.1_5 Reverse -221 -240 10.0292 0.22
NP_440136.1_2 Forward -375 -368 15.9687 0.0123
NP_440136.1_2 Reverse -368 -375 15.9687 0.0123
NP_440136.1_2 Reverse -330 -337 4.16902 0.234
NP_442590.1_9 Reverse -58 -77 6.98095 0.252
NP_442590.1_10 Reverse -361 -380 2.94938 0.299
NP_442998.1_5 Reverse -115 -125 7.94484 0.278
NP_442998.1_10 Forward -374 -367 15.5754 0.0102
NP_442998.1_10 Reverse -369 -376 15.5754 0.0102
NP_440899.1_2 Reverse -356 -375 12.88 0.112
NP_440899.1_2 Forward -387 -368 5.60352 0.278
NP_440899.1_8 Reverse -3 -22 -10.6203 0.281
NP_440299.1_1 Reverse -363 -376 6.0169 0.155
NP_440299.1_1 Forward -380 -367 4.34528 0.209
NP_441799.1_1 Reverse -363 -377 16.0269 0.0153
NP_441799.1_1 Forward -380 -366 14.8469 0.0221
NP_441007.1_10 Forward -381 -368 12.2123 0.0521
NP_441007.1_10 Reverse -362 -375 1.59258 0.203
NP_441007.1_10 Forward -243 -230 1.39592 0.203
NP_442201.1_10 Reverse -356 -375 -7.4737 0.201
NP_440256.1_1 Forward -379 -360 15.3391 0.00687
NP_440256.1_1 Reverse -364 -383 -7.96535 0.248
NP_440256.1_1 Forward -65 -46 -8.55534 0.263
NP_440087.1_1 Reverse -358 -377 -6.88371 0.263
NP_441559.1_8 Reverse -362 -376 2.75286 0.143
NP_441559.1_8 Reverse -85 -99 -6.58858 0.279
NP_441559.1_8 Forward -371 -357 -7.08024 0.283
NP_442785.1_7 Forward -378 -364 10.521 0.228
NP_441704.1_8 Forward -387 -368 5.50519 0.29
NP_440748.1_1 Forward -386 -367 13.4708 0.258
NP_440306.1_9 Forward -384 -365 15.5357 0.165
NP_442993.1_1 Reverse -367 -383 -1.3181 0.0893
NP_442993.1_1 Forward -119 -103 -11.7412 0.257
NP_442386.1_9 Reverse -366 -375 15.7322 0.0144
NP_442386.1_9 Forward -377 -368 13.8639 0.0289
NP_441340.1_5 Forward -375 -368 15.6737 0.0124
NP_441340.1_5 Reverse -368 -375 15.6737 0.0124
NP_442484.1_2 Forward -387 -368 13.7658 0.0538
NP_442484.1_2 Forward -145 -126 3.24438 0.21
NP_442484.1_2 Reverse -54 -73 -0.4922 0.266
NP_442484.1_2 Reverse -224 -243 -1.67217 0.295
NP_442791.1_5 Forward -384 -365 -11.4069 0.29
NP_440168.1_9 Forward -378 -359 -5.60541 0.296
NP_442240.1_2 Forward -375 -356 -13.9635 0.173
NP_440586.1_1 Forward -242 -223 -1.47551 0.237
NP_440586.1_8 Forward -375 -368 13.2151 0.026
NP_440586.1_8 Reverse -368 -375 13.2151 0.026
NP_440586.1_8 Forward -133 -126 7.31526 0.265
NP_442251.1_6 Forward -375 -368 15.2804 0.0124
NP_442251.1_6 Reverse -368 -375 15.2804 0.0124
NP_440192.1_4 Forward -235 -216 10.9499 0.227
NP_440684.1_9 Forward -382 -368 6.78443 0.29
NP_441262.1_3 Reverse -367 -374 14.7888 0.0223
NP_441262.1_3 Forward -376 -369 14.7888 0.0223
NP_440027.1_3 Reverse -357 -375 10.1465 0.176
NP_443051.1_1 Reverse -366 -375 10.4228 0.00754
NP_443051.1_1 Forward -377 -368 10.4228 0.00754
NP_439996.1_6 Forward -251 -232 11.8004 0.181
NP_441232.1_10 Reverse -356 -375 2.45773 0.247
NP_441232.1_10 Forward -387 -368 2.16274 0.255
NP_439937.1_8 Forward -384 -365 -3.54046 0.27
NP_440439.1_1 Reverse -364 -377 12.5073 0.0244
NP_440439.1_1 Forward -379 -366 0.117615 0.202
NP_440372.1_2 Forward -375 -368 16.3621 0.0124
NP_440372.1_2 Reverse -368 -375 16.3621 0.0124
NP_441181.1_6 Forward -252 -234 4.14905 0.254
NP_439977.1_5 Reverse -229 -248 -3.3438 0.299
NP_440139.1_1 Reverse -361 -380 9.14342 0.105
NP_441572.1_7 Forward -382 -363 -3.3438 0.209
NP_442384.1_10 Forward -376 -363 18.8988 0.00338
NP_442384.1_10 Reverse -367 -380 8.18076 0.0685
NP_442114.1_4 Forward -376 -365 9.20345 0.17
NP_441877.1_7 Reverse -362 -381 11.11 0.131
NP_441877.1_7 Forward -79 -60 2.9486 0.218
NP_441018.1_7 Forward -254 -235 12.6841 0.154
NP_441018.1_7 Reverse -61 -80 10.9142 0.194
NP_441018.1_7 Reverse -363 -382 7.37428 0.272
NP_442790.1_4 Reverse -358 -377 -6.98204 0.149
NP_442262.1_10 Forward -375 -368 14.1988 0.0123
NP_442262.1_10 Reverse -368 -375 14.1988 0.0123
NP_441689.1_5 Forward -378 -368 15.3192 0.0403
NP_440163.1_10 Forward -379 -369 11.3864 0.169
NP_440344.1_10 Forward -383 -366 8.59364 0.0102
NP_440344.1_10 Reverse -360 -377 -1.43612 0.0537
NP_440531.1_6 Reverse -359 -378 12.6841 0.0494
NP_440531.1_6 Forward -384 -365 5.89931 0.112
NP_442123.1_3 Forward -376 -357 12.1925 0.212
NP_442910.1_1 Forward -383 -364 -6.29373 0.254
NP_441965.1_10 Forward -379 -363 13.5299 0.1
NP_441965.1_10 Reverse -364 -380 8.90832 0.123
NP_440297.1_9 Reverse -368 -378 9.32148 0.0917
NP_440297.1_9 Reverse -236 -246 0.471689 0.282
NP_440297.1_9 Forward -375 -365 -0.118297 0.282
NP_441592.1_4 Forward -346 -327 -0.197208 0.24
NP_441896.1_3 Reverse -358 -377 0.786102 0.224
NP_441103.1_9 Forward -118 -108 12.3919 0.298
NP_440999.1_9 Forward -78 -64 19.9608 0.0114
NP_440999.1_9 Reverse -363 -377 15.9292 0.0222
NP_440999.1_9 Forward -386 -372 1.67122 0.16
NP_440888.1_2 Reverse -367 -381 15.3386 0.0113
NP_440888.1_2 Forward -376 -362 12.5853 0.0424
NP_440600.1_4 Reverse -359 -377 5.62401 0.105
NP_440575.1_1 Forward -163 -144 6.48849 0.217
NP_441543.1_2 Forward -375 -366 18.486 0.00236
NP_441543.1_2 Reverse -368 -377 16.9127 0.00359
NP_442845.1_2 Forward -382 -368 16.8142 0.0608
NP_442845.1_2 Reverse -323 -337 11.6026 0.127
NP_442845.1_2 Forward -373 -359 3.73617 0.279
NP_441551.1_5 Reverse -363 -379 7.72766 0.241
NP_441469.1_8 Reverse -366 -375 16.126 0.00797
NP_441469.1_8 Forward -377 -368 6.48957 0.227
NP_443064.1_6 Reverse -367 -377 12.5669 0.0796
NP_442578.1_7 Forward -375 -368 14.5921 0.026
NP_442578.1_7 Reverse -368 -375 14.5921 0.026
NP_442578.1_7 Forward -24 -17 8.79057 0.163
NP_440710.1_1 Reverse -359 -377 -0.472507 0.163
NP_440220.1_4 Reverse -222 -241 -2.8529 0.282
NP_441462.1_2 Forward -376 -366 11.5831 0.00406
NP_441462.1_2 Reverse -367 -377 11.5831 0.00406
NP_441621.1_7 Reverse -356 -370 -2.65535 0.188
NP_443062.1_1 Reverse -367 -385 6.20575 0.206
NP_443062.1_1 Forward -338 -320 6.10824 0.209
NP_443062.1_6 Forward -384 -365 3.53937 0.235
NP_440349.1_3 Reverse -374 -393 11.3067 0.282
NP_440519.1_8 Forward -238 -222 5.17175 0.21
NP_442204.1_1 Reverse -363 -374 -0.0396598 0.285
NP_440544.1_5 Reverse -11 -18 13.8024 0.28
NP_440516.1_8 Forward -376 -367 16.9127 0.00442
NP_440516.1_8 Reverse -367 -376 16.9127 0.00442
NP_442428.1_5 Forward -375 -368 15.8704 0.0124
NP_442428.1_5 Reverse -368 -375 15.8704 0.0124
NP_441443.1_7 Forward -253 -234 9.53756 0.111
NP_442120.1_10 Reverse -113 -132 -8.94866 0.242
NP_442120.1_10 Reverse -367 -386 -16.2252 0.297
NP_440673.1_3 Forward -374 -367 12.4288 0.0426
NP_440673.1_3 Reverse -369 -376 12.4288 0.0426
NP_440673.1_3 Reverse -339 -346 6.23397 0.283
NP_440673.1_7 Forward -387 -368 1.57275 0.244
NP_440865.1_9 Forward -382 -363 -2.75381 0.188
NP_441052.1_2 Reverse -367 -377 19.9412 0.00106
NP_441052.1_2 Forward -376 -366 10.5014 0.0285
NP_441052.1_2 Forward -338 -328 0.0783647 0.263
NP_441052.1_2 Forward -74 -64 -0.708283 0.294
NP_440992.1_2 Forward -249 -230 9.63589 0.273
NP_442219.1_9 Reverse -368 -377 17.7976 0.00718
NP_442219.1_9 Forward -375 -366 8.35786 0.0681
NP_442219.1_9 Forward -337 -328 5.40793 0.166
NP_440436.1_4 Forward -375 -366 18.1905 0.00233
NP_440436.1_4 Reverse -368 -377 17.2072 0.00233
NP_440436.1_4 Forward -337 -328 4.81753 0.239
NP_441884.1_9 Forward -379 -360 -5.50708 0.0594
NP_441884.1_9 Reverse -364 -383 -23.9933 0.284
NP_441719.1_4 Forward -375 -368 16.3621 0.0124
NP_441719.1_4 Reverse -368 -375 16.3621 0.0124
NP_441733.1_10 Forward -379 -366 9.95071 0.106
NP_441004.1_1 Forward -352 -333 -17.4051 0.291
NP_441004.1_1 Forward -250 -231 -17.6018 0.292
NP_442873.1_9 Forward -386 -367 6.09517 0.259
NP_440296.1_10 Forward -379 -360 -14.2585 0.269
NP_442206.1_10 Forward -376 -361 4.79811 0.178
NP_443054.1_2 Reverse -109 -123 4.52282 0.24
NP_443054.1_2 Forward -378 -364 3.04785 0.24
NP_443054.1_2 Reverse -365 -379 1.37622 0.247
NP_441851.1_10 Reverse -366 -376 16.008 0.00552
NP_441851.1_10 Forward -377 -367 15.8113 0.00552
NP_441851.1_10 Forward -339 -329 4.79825 0.247
NP_441851.1_10 Reverse -328 -338 4.79825 0.247
NP_442622.1_1 Reverse -328 -347 -13.0786 0.282
NP_442622.1_5 Reverse -365 -384 -3.14714 0.171
NP_442622.1_8 Forward -376 -358 -8.83064 0.138
NP_442856.1_7 Reverse -358 -377 -3.73712 0.247
NP_442515.1_1 Forward -377 -363 11.406 0.0412
NP_442515.1_1 Reverse -366 -380 1.96621 0.145
NP_441683.1_7 Forward -234 -215 -11.7019 0.284
NP_441046.1_2 Forward -249 -230 8.16093 0.221
NP_441046.1_2 Forward -387 -368 6.39097 0.221
NP_441349.1_10 Forward -386 -367 -8.65367 0.278
NP_441409.1_6 Forward -382 -363 -15.2418 0.285
NP_440432.1_9 Forward -375 -360 -1.10174 0.167
NP_442843.1_1 Forward -375 -356 -7.86702 0.252
NP_439960.1_10 Reverse -357 -375 -3.12744 0.267
NP_440474.1_8 Reverse -368 -382 5.60385 0.246
NP_440474.1_8 Forward -375 -361 5.01387 0.26
NP_442450.1_5 Forward -378 -368 9.32148 0.115
NP_442168.1_5 Reverse -330 -349 7.47261 0.163
NP_440588.1_2 Forward -385 -366 -4.13045 0.207
NP_442006.1_2 Forward -250 -233 -14.4158 0.203
NP_440483.1_1 Forward -237 -218 -1.57384 0.208
NP_441570.1_1 Reverse -367 -385 2.28076 0.0252
NP_441570.1_1 Forward -376 -358 -5.38906 0.0755
NP_441570.1_1 Forward -238 -220 -10.4039 0.17
NP_441570.1_1 Forward -382 -364 -10.6989 0.177
NP_441078.1_4 Forward -376 -367 19.6659 0.0007
NP_441078.1_4 Reverse -367 -376 19.6659 0.0007
NP_442729.1_8 Forward -380 -367 9.75405 0.125
NP_442729.1_8 Reverse -325 -338 7.00078 0.168
NP_442388.1_3 Forward -379 -360 16.8141 0.131
NP_440539.1_9 Reverse -239 -258 -4.81876 0.286
NP_441663.1_8 Reverse -361 -380 4.22769 0.169
NP_440707.1_6 Reverse -359 -378 12.9783 0.197
NP_440707.1_9 Forward -240 -221 4.32602 0.255
NP_442443.1_1 Forward -252 -233 5.50599 0.157
NP_442443.1_1 Forward -240 -221 -1.57384 0.237
NP_442906.1_9 Reverse -115 -134 15.0441 0.207
NP_440526.1_3 Reverse -368 -379 10.1862 0.0646
NP_440526.1_3 Forward -337 -326 0.353199 0.287
NP_441432.1_8 Forward -377 -368 16.8143 0.00595
NP_441432.1_8 Reverse -366 -375 8.25953 0.0755
NP_442320.1_8 Forward -382 -368 14.8476 0.0132
NP_441732.1_2 Reverse -225 -241 -7.70961 0.0885
NP_441732.1_2 Forward -380 -364 -16.2644 0.165
NP_441732.1_2 Reverse -363 -379 -16.5594 0.174
NP_440497.1_2 Forward -255 -236 5.30933 0.287
NP_442003.1_4 Forward -375 -356 11.6025 0.277
NP_440760.1_1 Reverse -367 -386 -3.3438 0.0342
NP_442797.1_6 Reverse -225 -244 11.4246 0.238
NP_440199.1_10 Forward -379 -369 16.7946 0.0381
NP_442489.1_2 Forward -387 -368 7.37428 0.172
NP_442489.1_7 Forward -376 -367 20.1576 0.000695
NP_442489.1_7 Reverse -367 -376 20.1576 0.000695
NP_441830.1_2 Forward -375 -356 -5.31042 0.281
NP_442079.1_7 Reverse -368 -387 4.42435 0.192
NP_442079.1_7 Forward -375 -356 -0.000545616 0.287
NP_440559.1_1 Reverse -368 -377 17.4043 0.00658
NP_440559.1_1 Forward -375 -366 8.75118 0.0586
NP_441659.2_8 Reverse -367 -377 18.1713 0.00133
NP_441659.2_8 Forward -376 -366 11.9764 0.0147
NP_441800.1_10 Forward -367 -348 1.47442 0.255
NP_442346.1_5 Forward -377 -367 16.6963 0.00248
NP_442346.1_5 Reverse -366 -376 9.02648 0.118
NP_442346.1_5 Reverse -164 -174 6.8632 0.188
NP_442346.1_10 Forward -378 -359 0.982764 0.225
NP_440545.1_3 Forward -380 -363 -4.58271 0.229
NP_440545.1_3 Forward -242 -225 -6.15601 0.27
NP_440831.1_3 Forward -385 -366 5.7076 0.28
NP_441629.1_3 Forward -78 -59 0.490334 0.235
NP_441629.1_3 Reverse -222 -241 -4.72118 0.297
NP_441786.1_10 Forward -385 -366 8.55425 0.233
NP_440010.1_10 Forward -253 -234 3.04771 0.264
NP_442603.1_7 Forward -376 -362 6.29216 0.249
NP_441888.1_7 Reverse -362 -376 13.5693 0.0743
NP_441888.1_7 Forward -79 -65 1.17956 0.263
NP_441833.1_4 Forward -375 -368 15.9687 0.0124
NP_441833.1_4 Reverse -368 -375 15.9687 0.0124
NP_441895.1_2 Reverse -98 -117 -26.7466 0.247
NP_441895.1_3 Forward -350 -331 -16.9135 0.277
NP_442162.1_9 Forward -375 -368 16.2637 0.0124
NP_442162.1_9 Reverse -368 -375 16.2637 0.0124
NP_442796.1_10 Forward -25 -6 10.6192 0.249
NP_440671.1_4 Forward -250 -236 12.1926 0.114
NP_440671.1_4 Forward -382 -368 8.65272 0.193
NP_442045.1_5 Forward -385 -366 -2.16383 0.294
NP_442140.1_3 Forward -375 -365 14.238 0.0486
NP_442140.1_3 Reverse -368 -378 4.40493 0.243
NP_442914.1_8 Forward -249 -230 7.17762 0.237
NP_440875.1_9 Forward -374 -364 14.3096 0.0453
NP_441813.1_5 Reverse -365 -375 19.4496 0.00647
NP_441813.1_5 Forward -378 -368 15.9097 0.01
NP_440590.1_4 Forward -375 -362 5.23083 0.0585
NP_440590.1_4 Reverse -368 -381 2.67422 0.0835
NP_440590.1_4 Forward -352 -339 -4.30728 0.26
NP_440567.1_1 Reverse -368 -382 15.2409 0.0178
NP_440567.1_1 Forward -375 -361 7.47274 0.0707
NP_442497.1_10 Forward -375 -366 10.4228 0.0087
NP_442497.1_10 Reverse -368 -377 10.4228 0.0087
NP_440821.1_4 Forward -378 -368 18.2696 0.00448
NP_440821.1_4 Reverse -365 -375 10.2065 0.0163
NP_440821.1_4 Reverse -327 -337 5.5849 0.109
NP_440821.1_4 Forward -340 -330 -0.314959 0.251
NP_441239.1_9 Reverse -365 -377 14.1986 0.0288
NP_441239.1_9 Forward -378 -366 6.92215 0.173
NP_441951.1_9 Reverse -233 -252 11.7992 0.229
NP_440400.1_1 Forward -83 -64 -0.29631 0.285
NP_440400.1_1 Reverse -40 -59 -3.34455 0.294
NP_441892.1_1 Reverse -364 -381 -5.46769 0.281
NP_442270.1_9 Forward -387 -368 -6.58872 0.207
NP_440949.1_7 Reverse -359 -378 17.2065 0.144
NP_441617.1_6 Forward -281 -262 -7.27704 0.292
NP_442138.1_10 Forward -376 -357 -6.58872 0.286
NP_440546.1_4 Forward -376 -366 11.8882 0.0679
NP_440546.1_4 Reverse -367 -377 10.046 0.109
NP_440546.1_6 Forward -242 -223 7.07928 0.278
NP_442041.1_5 Forward -393 -374 0.786102 0.257
NP_440462.1_6 Reverse -365 -375 17.2863 0.00752
NP_440462.1_6 Forward -378 -368 7.74818 0.0699
NP_442340.1_3 Reverse -339 -358 1.57275 0.144
NP_442340.1_3 Forward -374 -355 -3.3438 0.205
NP_440705.1_4 Forward -241 -222 7.47261 0.296
NP_440868.1_4 Reverse -363 -375 22.1634 0.00629
NP_440868.1_4 Forward -380 -368 8.20045 0.0602
NP_441497.1_2 Forward -289 -270 6.68596 0.233
NP_441474.1_1 Reverse -357 -376 -3.24622 0.296
NP_442402.1_4 Reverse -83 -102 -8.6544 0.284
NP_441848.1_4 Reverse -265 -281 8.79206 0.288
NP_440653.1_10 Reverse -126 -145 2.65439 0.288
NP_440696.1_3 Forward -376 -358 4.54237 0.198
NP_440696.1_3 Reverse -363 -381 0.117479 0.237
NP_442358.1_1 Reverse -359 -377 13.2938 0.291
NP_442882.1_7 Reverse -360 -374 11.7987 0.261
NP_442039.1_4 Forward -375 -368 15.1821 0.0124
NP_442039.1_4 Reverse -368 -375 15.1821 0.0124
NP_442837.1_3 Forward -375 -368 15.7721 0.0124
NP_442837.1_3 Reverse -368 -375 15.7721 0.0124
NP_442837.1_3 Reverse -330 -337 9.77388 0.115
NP_442053.1_1 Forward -376 -367 18.3876 0.0007
NP_442053.1_1 Reverse -367 -376 18.3876 0.0007
NP_440505.1_3 Forward -378 -368 16.303 0.00696
NP_440505.1_3 Reverse -365 -375 15.9097 0.00857
NP_440505.1_3 Reverse -327 -337 6.07655 0.197
NP_442532.1_7 Forward -376 -362 4.52282 0.171
NP_440914.1_1 Reverse -367 -377 17.5935 0.000537
NP_440914.1_1 Forward -376 -366 8.6151 0.186
NP_440914.1_1 Reverse -266 -276 6.27291 0.288
NP_441011.1_8 Forward -375 -366 16.9127 0.00602
NP_441011.1_8 Reverse -368 -377 8.25953 0.144
NP_442533.1_6 Forward -376 -367 17.2076 0.00137
NP_442533.1_6 Reverse -367 -376 17.2076 0.00137
NP_442533.1_6 Forward -338 -329 4.0313 0.194
NP_442322.1_4 Reverse -233 -250 -4.68172 0.26
NP_441482.1_7 Forward -382 -368 -9.14519 0.194
NP_441482.1_7 Reverse -361 -375 -12.2918 0.292
NP_439944.1_9 Reverse -368 -378 19.0562 0.00329
NP_441028.1_6 Forward -151 -141 5.78111 0.243
NP_440721.1_5 Reverse -41 -60 12.1917 0.187
NP_440116.1_8 Reverse -368 -387 1.17943 0.0926
NP_441527.1_4 Reverse -266 -285 -10.0748 0.264
NP_440115.1_6 Reverse -364 -374 6.66654 0.172
NP_440007.1_1 Forward -249 -230 18.9765 0.203
NP_439965.1_1 Forward -385 -366 -3.24547 0.182
NP_441961.1_4 Forward -384 -365 3.44104 0.277
NP_443045.1_5 Forward -237 -224 14.727 0.253
NP_442673.1_7 Forward -288 -269 14.1801 0.196
NP_441972.1_5 Reverse -368 -387 -8.85033 0.272
NP_441106.1_1 Reverse -366 -375 18.191 0.0028
NP_441106.1_1 Forward -377 -368 9.63616 0.0311
NP_442306.1_10 Reverse -362 -381 -19.0768 0.197
NP_440797.1_2 Forward -387 -368 20.167 0.0373
NP_441286.1_1 Reverse -366 -378 11.8387 0.0114
NP_441286.1_1 Forward -377 -365 6.03717 0.0258
NP_441286.1_1 Reverse -328 -340 -4.18925 0.152
NP_440670.1_8 Forward -376 -367 18.3876 0.000699
NP_440670.1_8 Reverse -367 -376 18.3876 0.000699
NP_442908.1_8 Reverse -161 -180 11.3075 0.296
NP_442477.1_2 Forward -52 -33 6.68596 0.104
NP_440886.1_7 Reverse -366 -376 17.7774 0.0011
NP_440886.1_7 Forward -377 -367 7.94438 0.0805
NP_440886.1_7 Reverse -234 -244 6.66608 0.115
NP_440886.1_7 Forward -75 -65 4.40448 0.237
NP_442614.1_2 Reverse -367 -381 14.0609 0.106
NP_440513.1_4 Forward -376 -357 11.7008 0.224
NP_441808.1_8 Reverse -332 -351 9.14423 0.259
NP_442022.1_4 Forward -250 -231 15.4374 0.152
NP_440907.2_8 Forward -375 -365 7.94438 0.117
NP_440907.2_8 Reverse -330 -340 5.09279 0.222
NP_441021.1_1 Forward -375 -356 -8.65367 0.199
NP_441463.1_3 Forward -386 -367 -2.36049 0.153
NP_441463.1_3 Reverse -357 -376 -9.24366 0.278
NP_441463.1_6 Forward -378 -364 6.02939 0.283
NP_441626.1_2 Forward -375 -368 15.7721 0.0124
NP_441626.1_2 Reverse -368 -375 15.7721 0.0124
NP_442365.1_7 Forward -380 -361 10.4225 0.0723
NP_441962.1_4 Reverse -368 -387 -4.22878 0.157
NP_441962.1_4 Forward -381 -362 -5.31042 0.167
NP_441962.1_4 Forward -357 -338 -9.34199 0.215
NP_440387.1_1 Forward -376 -360 6.05672 0.0293
NP_440387.1_1 Reverse -367 -383 -4.56302 0.19
NP_440855.1_1 Forward -253 -234 2.94938 0.188
NP_441431.1_2 Reverse -364 -378 10.0287 0.17
NP_441431.1_2 Reverse -220 -234 5.89884 0.284
NP_441836.1_2 Reverse -361 -380 1.37609 0.193
NP_442805.1_5 Reverse -225 -244 -4.91784 0.269
NP_440114.1_10 Forward -376 -362 13.2743 0.0609
NP_440114.1_10 Reverse -367 -381 11.701 0.106
NP_440766.1_4 Forward -380 -366 7.9644 0.0871
NP_439988.1_7 Forward -374 -360 12.6836 0.292
NP_442743.1_4 Forward -375 -356 -5.31042 0.257
NP_442743.1_5 Reverse -368 -387 10.9142 0.142
NP_441133.1_3 Forward -241 -222 13.6675 0.272
NP_439910.1_2 Forward -384 -367 -22.184 0.215
NP_440457.1_1 Reverse -363 -375 1.12062 0.245
NP_440457.1_1 Forward -248 -236 0.825626 0.25
NP_440457.1_1 Forward -380 -368 -0.0593532 0.25
NP_440457.1_1 Forward -93 -81 -0.354346 0.262
NP_441984.1_3 Reverse -363 -381 7.00065 0.259
NP_441332.1_6 Forward -78 -68 13.6798 0.184
NP_442509.1_9 Forward -376 -366 16.2041 0.00739
NP_442509.1_9 Forward -393 -383 8.23937 0.192
NP_442509.1_9 Reverse -367 -377 8.14104 0.192
NP_442509.1_9 Forward -84 -74 6.37109 0.274
NP_440554.1_4 Forward -375 -365 16.4996 0.0189
NP_440554.1_4 Reverse -368 -378 7.05986 0.106
NP_441885.1_5 Reverse -367 -377 20.9245 0.000538
NP_441885.1_5 Forward -376 -366 11.4848 0.00668
NP_441885.1_5 Forward -338 -328 -0.609952 0.215
NP_442341.1_7 Reverse -366 -380 14.3559 0.0299
NP_442341.1_7 Forward -377 -363 8.75105 0.0848
NP_442341.1_9 Reverse -365 -379 17.6985 0.0235
NP_441173.1_9 Reverse -94 -102 13.1954 0.184
NP_440423.1_6 Forward -384 -365 2.3594 0.0863
NP_440423.1_6 Reverse -359 -378 -17.8968 0.233
NP_443000.1_7 Forward -378 -368 17.0896 0.00865
NP_443000.1_7 Reverse -365 -375 11.5831 0.0344
NP_441842.1_10 Forward -383 -369 10.4227 0.165
NP_441842.1_10 Reverse -360 -374 7.57108 0.255
NP_440275.1_3 Reverse -365 -375 15.418 0.0178
NP_440275.1_3 Forward -378 -368 8.1415 0.0602
NP_440091.1_1 Forward -380 -368 8.88877 0.0567
NP_440091.1_1 Reverse -363 -375 0.727295 0.233
NP_443060.1_5 Forward -384 -365 15.3382 0.109
NP_441902.1_3 Forward -228 -218 12.593 0.24
NP_440679.1_10 Forward -374 -355 -15.4385 0.25
NP_440679.1_10 Forward -347 -328 -21.83 0.3
NP_440127.1_4 Forward -351 -337 17.4042 0.275
NP_443010.1_10 Reverse -364 -381 6.53951 0.182
NP_442451.1_2 Forward -384 -365 -2.16383 0.179
NP_442451.1_2 Forward -348 -329 -11.4069 0.294
NP_439962.1_4 Reverse -329 -348 -0.787193 0.204
NP_439962.1_4 Forward -375 -356 -4.03212 0.265
NP_439962.1_4 Forward -240 -221 -4.22878 0.269
NP_439962.1_4 Reverse -233 -252 -4.32711 0.269
NP_440175.1_4 Forward -384 -365 -4.32711 0.146
NP_440149.1_8 Reverse -367 -386 11.6025 0.0404
NP_440149.1_8 Forward -376 -357 2.55606 0.109
NP_441105.1_3 Forward -255 -236 -8.85033 0.279
NP_442373.1_2 Forward -244 -225 -0.0988766 0.19
NP_440216.1_1 Forward -376 -362 8.55439 0.00592
NP_440216.1_1 Reverse -367 -381 -9.73518 0.145
NP_440216.1_9 Reverse -268 -277 6.78456 0.289
NP_440216.1_9 Forward -132 -123 5.80125 0.289
NP_440172.1_1 Reverse -367 -377 15.0247 0.00945
NP_440172.1_1 Forward -376 -366 8.73149 0.0586
NP_442015.1_10 Reverse -363 -376 12.0157 0.0372
NP_442015.1_10 Forward -380 -367 0.510939 0.224
NP_441226.1_7 Forward -375 -368 14.4934 0.0123
NP_441226.1_7 Reverse -368 -375 14.4934 0.0123
NP_441111.1_7 Forward -375 -367 18.7023 0.00294
NP_441111.1_7 Reverse -368 -376 18.7023 0.00294
NP_441111.1_7 Forward -337 -329 -0.570565 0.233
NP_441766.1_2 Forward -376 -367 17.5026 0.00297
NP_441766.1_2 Reverse -367 -376 17.5026 0.00297
NP_441766.1_9 Reverse -359 -378 6.29264 0.18
NP_442417.1_5 Forward -68 -54 5.30946 0.267
NP_440416.1_1 Reverse -367 -386 -11.7019 0.272
NP_440416.1_9 Forward -383 -364 -6.78538 0.0943
NP_443052.1_8 Forward -348 -329 -10.7186 0.214
NP_443052.1_9 Reverse -222 -241 7.17762 0.135
NP_440591.1_5 Reverse -350 -369 8.35677 0.275
NP_440261.1_5 Forward -375 -362 5.23083 0.045
NP_440261.1_5 Reverse -368 -381 -10.5021 0.201
NP_440988.1_10 Forward -378 -364 7.41596 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCAAATTCCTGAACCCGCTGTAATGGCGATCGCCGGCATGGGAGCTTTAGTAGCGGCAACGGTGCGAGCCCCATTAACTGCAATTCTGTTAACCATAGAAATGACGGACAACTATTTTGTGATTTTGCCTTTGTTAGTTACCTGCCTAGTGGCCAGTGTGGTGGCGGAAGCATTGGGGGGTAAACCCATTTATACAGTCTTGCTAGAAAGAACTTTAGCTAAACAAAACCGTGGCTAAGATTTATTGTCTTGACCCCGATTCTTTTAGCGAAGGAAAATCTGGCCTCCCCTTTGAACCTTGGGTAAACCCGTGGGGTCTAAACCCCCGTAACCGCCAAAGAGGTAGGTTTTGTTGGTTAAGCCCTTAGTCAATCCAGCGGTAGAAGAAAACGAAGCTAGC

CDS

ATGATCCAGCGAAGTCAGCAGGGTGATGCTGAGGCCTTTCGTCAACTTTATCGTCGGTACCAGGCTAAAGTACGTTCTACCCTTTATCAACTTTGTGGACAGCATCAACTCGATGATCTAGTTCAGGAGGTCTTTTTCAAAGTGTGGAAAGGATTGCCCAAACTCCGCAATCACAATTTTTTTGCCACCTGGCTTTATCGCATTACTTGGAATGTGGCCCAGGATGCCCGTAAACAATTGGGGCGATCGCGCCAACGGATTCATCAACCCAGTACTGCCTTAGCCGACAACGAAGGGGAAATATCCCTGCAATTGTCTCGGCCCGAGGACAGTCCCGATCTGTTGCAACTCCATTACCAGGATTTGGTGCAGCAAGGCTTGGCTACCCTCAGCTTTGAGCATCGCACGGTGTTGGTGCTCCACGATCTGGAGGATTTGCCCCAAAAGACCATTGCGGAGGTACTAAATTTGCCTGGGGGTACTATCAAATCCCGTTTATTCTATGCTCGGCGGGCCATGCGGGAATTCTTGCAGCAACAGGGAGTTCAAGATGTCTTTTAA

Protein

MIQRSQQGDAEAFRQLYRRYQAKVRSTLYQLCGQHQLDDLVQEVFFKVWKGLPKLRNHNFFATWLYRITWNVAQDARKQLGRSRQRIHQPSTALADNEGEISLQLSRPEDSPDLLQLHYQDLVQQGLATLSFEHRTVLVLHDLEDLPQKTIAEVLNLPGGTIKSRLFYARRAMREFLQQQGVQDVF