Your browser is old and dusty. Try Google Chrome!

Details for sll0855

ORF sll0855
Accession NP_441114.1
Symbol
Category putative channel transporter
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -30 -16 1.76955 0.183
NP_441061.1_2 Reverse -55 -69 -1.18038 0.252
NP_440795.1_7 Forward -348 -341 7.80726 0.232
NP_440795.1_7 Forward -315 -308 6.92228 0.26
NP_441418.1_6 Reverse -54 -73 -19.9617 0.0997
NP_441418.1_6 Reverse -340 -359 -20.0601 0.103
NP_440897.1_6 Reverse -54 -73 -4.32786 0.273
NP_441453.1_4 Reverse -54 -62 7.09925 0.0962
NP_441453.1_4 Forward -63 -55 7.00092 0.107
NP_442151.1_6 Reverse -54 -68 6.58777 0.228
NP_442151.1_6 Forward -310 -296 5.99778 0.253
NP_441818.1_1 Reverse -55 -66 14.1195 0.0572
NP_441818.1_9 Forward -250 -231 -11.0136 0.3
NP_440226.1_1 Forward -63 -44 1.96607 0.282
NP_441630.1_3 Forward -71 -52 1.57275 0.242
NP_440259.1_4 Reverse -178 -192 10.7568 0.262
NP_440150.1_6 Reverse -51 -70 13.8641 0.0993
NP_442173.1_1 Reverse -55 -63 12.9008 0.0296
NP_442173.1_1 Forward -62 -54 5.72262 0.203
NP_442975.1_10 Reverse -50 -64 10.8154 0.0516
NP_440784.1_7 Forward -62 -55 6.3323 0.228
NP_440784.1_7 Reverse -55 -62 6.13563 0.241
NP_442861.1_4 Forward -42 -23 -0.984623 0.297
NP_440061.1_9 Forward -65 -51 10.8154 0.122
NP_440061.1_9 Reverse -52 -66 9.83206 0.137
NP_442062.1_8 Reverse -54 -64 15.713 0.00658
NP_442062.1_8 Forward -63 -53 9.81313 0.0557
NP_442062.1_8 Forward -31 -21 6.56821 0.123
NP_441900.1_2 Forward -308 -290 0.706727 0.258
NP_441859.1_3 Reverse -201 -220 3.34192 0.244
NP_440304.1_4 Reverse -52 -62 8.04317 0.0867
NP_442242.1_4 Reverse -55 -62 11.8388 0.0776
NP_439918.1_3 Reverse -284 -303 2.3594 0.295
NP_441208.1_9 Forward -313 -299 7.37441 0.222
NP_441925.1_4 Reverse -299 -318 -8.06442 0.203
NP_440856.1_4 Reverse -188 -207 -2.45882 0.211
NP_441083.1_5 Reverse -54 -64 10.5014 0.0197
NP_441083.1_5 Forward -63 -53 1.65166 0.2
NP_439957.1_9 Forward -288 -269 8.35512 0.249
NP_442827.1_8 Forward -71 -52 5.60352 0.115
NP_442115.2_7 Reverse -305 -322 5.9387 0.242
NP_441149.1_9 Reverse -219 -238 1.76863 0.221
NP_441738.1_2 Forward -61 -54 13.8051 0.0221
NP_441738.1_2 Reverse -380 -387 6.23363 0.264
NP_441558.1_5 Forward -65 -46 3.93269 0.294
NP_440209.1_1 Forward -63 -55 8.37755 0.0576
NP_440209.1_1 Reverse -54 -62 8.27922 0.0687
NP_441713.1_1 Forward -210 -191 -9.34199 0.173
NP_440178.1_7 Forward -64 -45 -11.8003 0.103
NP_440178.1_7 Reverse -15 -34 -21.3384 0.218
NP_441716.1_1 Reverse -54 -68 20.4524 0.00829
NP_441624.1_7 Forward -355 -341 8.55439 0.238
NP_441624.1_7 Forward -36 -22 6.48943 0.286
NP_440906.1_5 Forward -62 -55 6.13563 0.241
NP_440906.1_5 Reverse -55 -62 6.13563 0.241
NP_441209.1_4 Forward -305 -286 11.8967 0.279
NP_440747.1_10 Forward -66 -54 7.11881 0.00789
NP_440747.1_10 Reverse -51 -63 -11.8591 0.161
NP_440747.1_10 Reverse -337 -349 -12.2524 0.254
NP_441130.1_10 Reverse -52 -66 10.226 0.117
NP_441130.1_10 Forward -65 -51 6.09611 0.202
NP_441486.1_1 Reverse -51 -65 -4.91696 0.213
NP_441486.1_1 Forward -66 -52 -5.11362 0.222
NP_441880.2_10 Forward -62 -44 11.4255 0.16
NP_440944.1_2 Reverse -22 -41 -1.67217 0.259
NP_440403.1_4 Forward -72 -53 -8.65367 0.26
NP_441014.1_5 Forward -99 -81 10.9339 0.263
NP_441014.1_8 Reverse -302 -321 11.4058 0.0959
NP_441014.1_10 Forward -54 -35 -0.492971 0.252
NP_441014.1_10 Forward -64 -45 -1.67294 0.263
NP_441014.1_10 Reverse -365 -384 -1.96793 0.269
NP_443018.1_3 Reverse -55 -62 12.0355 0.0639
NP_443018.1_3 Forward -62 -55 5.64398 0.181
NP_443018.1_3 Reverse -65 -72 4.36568 0.254
NP_443018.1_3 Forward -72 -65 4.07068 0.299
NP_441634.1_8 Forward -65 -51 16.0275 0.0248
NP_441634.1_8 Reverse -58 -72 -2.45868 0.295
NP_440376.1_1 Reverse -54 -63 16.0277 0.00493
NP_440376.1_1 Forward -63 -54 9.73449 0.0365
NP_440376.1_1 Reverse -44 -53 4.12963 0.173
NP_440376.1_1 Reverse -15 -24 -0.0986038 0.285
NP_442687.1_7 Reverse -43 -53 10.5998 0.0994
NP_442687.1_7 Forward -64 -54 9.02648 0.0994
NP_442687.1_7 Reverse -53 -63 6.17489 0.178
NP_442485.1_3 Forward -360 -341 -4.81876 0.285
NP_442485.1_3 Reverse -296 -315 -4.81876 0.285
NP_442485.1_3 Forward -155 -136 -5.99873 0.297
NP_441846.1_6 Forward -375 -356 8.55425 0.205
NP_440781.1_1 Reverse -57 -71 12.586 0.266
NP_441422.1_7 Forward -65 -48 -5.56602 0.247
NP_442658.1_1 Reverse -52 -62 9.51767 0.151
NP_442658.1_1 Forward -65 -55 6.37109 0.231
NP_442658.1_1 Reverse -386 -396 5.97777 0.242
NP_442658.1_1 Reverse -62 -72 5.97777 0.242
NP_440446.1_10 Reverse -149 -163 20.0591 0.249
NP_442782.1_2 Reverse -22 -36 9.34103 0.198
NP_442544.1_2 Forward -71 -57 -1.47537 0.287
NP_441487.1_9 Forward -64 -45 0.0977854 0.239
NP_442300.1_4 Reverse -161 -180 17.3048 0.156
NP_442937.1_5 Reverse -49 -68 6.78429 0.27
NP_441958.1_5 Forward -64 -54 2.53664 0.0409
NP_441958.1_5 Reverse -53 -63 2.43831 0.0422
NP_442836.1_5 Forward -59 -40 6.68596 0.171
NP_440950.1_6 Reverse -291 -310 11.2092 0.205
NP_439905.1_1 Reverse -55 -68 9.2624 0.221
NP_439905.1_1 Forward -72 -59 8.08242 0.238
NP_439990.1_5 Forward -68 -55 5.32916 0.298
NP_442911.1_2 Reverse -44 -63 -10.4236 0.279
NP_440153.1_5 Forward -62 -48 2.85119 0.219
NP_440153.1_8 Reverse -301 -314 7.29578 0.166
NP_442536.1_4 Reverse -48 -66 7.09898 0.299
NP_443055.1_3 Forward -72 -53 17.9979 0.0489
NP_443055.1_3 Reverse -45 -64 11.6 0.25
NP_441348.1_3 Reverse -49 -68 13.9625 0.135
NP_441099.1_5 Forward -170 -151 -8.85033 0.206
NP_442002.1_9 Reverse -53 -60 9.67555 0.27
NP_440809.1_9 Forward -72 -54 -9.0273 0.291
NP_441646.1_1 Forward -31 -12 1.67108 0.23
NP_441646.1_1 Forward -70 -51 -1.86883 0.296
NP_442438.1_10 Forward -315 -301 6.6861 0.111
NP_442438.1_10 Reverse -293 -307 6.09611 0.121
NP_441000.1_6 Forward -74 -60 -5.01529 0.257
NP_441000.1_6 Forward -64 -50 -5.40861 0.275
NP_441000.1_6 Reverse -53 -67 -5.60527 0.285
NP_441674.1_6 Reverse -302 -321 9.3409 0.177
NP_441674.1_6 Reverse -55 -74 3.14605 0.272
NP_440147.1_4 Forward -65 -52 14.2773 0.0261
NP_440147.1_4 Reverse -52 -65 1.19926 0.235
NP_441550.1_8 Forward -65 -55 5.58445 0.242
NP_441916.1_7 Forward -63 -53 8.73149 0.042
NP_440465.1_10 Reverse -289 -308 -0.0988766 0.29
NP_441041.1_4 Reverse -16 -35 2.55606 0.0715
NP_441041.1_4 Forward -316 -297 -10.7186 0.236
NP_441041.1_7 Reverse -51 -63 8.2922 0.139
NP_440569.1_7 Reverse -85 -104 8.35759 0.289
NP_441725.1_5 Reverse -55 -65 0.471689 0.173
NP_441725.1_5 Forward -62 -52 -0.511621 0.26
NP_441406.1_2 Reverse -50 -69 12.7825 0.191
NP_439966.1_7 Forward -65 -55 11.4843 0.0632
NP_439966.1_7 Reverse -52 -62 7.64939 0.15
NP_439966.1_9 Reverse -52 -61 7.86621 0.253
NP_442941.1_3 Reverse -55 -65 9.41981 0.0319
NP_440289.1_2 Reverse -51 -64 0.60927 0.156
NP_440289.1_4 Reverse -221 -240 10.6192 0.233
NP_441334.1_7 Reverse -299 -318 -14.0619 0.244
NP_441334.1_7 Reverse -52 -71 -20.2567 0.275
NP_001035871.2_7 Reverse -24 -34 14.533 0.187
NP_440437.1_1 Forward -69 -50 -5.80207 0.292
NP_442500.1_2 Forward -318 -299 8.06259 0.283
NP_442012.1_5 Reverse -15 -34 12.5858 0.234
NP_440723.1_10 Forward -87 -68 17.2842 0.24
NP_441556.1_4 Reverse -307 -326 9.61947 0.297
NP_441556.1_10 Forward -30 -16 13.6286 0.178
NP_441644.1_6 Reverse -54 -64 13.4509 0.019
NP_441644.1_6 Forward -310 -300 5.09279 0.21
NP_442215.1_2 Reverse -13 -29 -5.448 0.25
NP_442215.1_2 Reverse -52 -68 -5.64466 0.254
NP_442215.1_2 Reverse -83 -99 -5.84132 0.26
NP_442215.1_2 Forward -27 -11 -6.23465 0.266
NP_442029.1_1 Reverse -52 -71 -18.9784 0.277
NP_440929.1_8 Forward -63 -54 9.53783 0.0296
NP_440929.1_8 Reverse -54 -63 9.4395 0.0326
NP_442933.1_10 Reverse -54 -63 7.86621 0.103
NP_442933.1_10 Forward -63 -54 7.86621 0.103
NP_442554.1_8 Reverse -55 -65 6.96153 0.102
NP_442554.1_8 Forward -62 -52 6.8632 0.103
NP_442554.1_8 Reverse -302 -312 4.79825 0.173
NP_441762.1_7 Forward -64 -52 2.69391 0.0676
NP_441762.1_7 Reverse -63 -75 -5.46756 0.212
NP_441762.1_7 Reverse -53 -65 -7.43418 0.29
NP_442142.1_4 Forward -358 -345 7.00021 0.151
NP_442142.1_4 Reverse -51 -64 2.47701 0.29
NP_442292.1_1 Reverse -55 -64 8.65285 0.0335
NP_442292.1_1 Reverse -302 -311 3.93297 0.189
NP_442292.1_1 Forward -62 -53 0.0980582 0.239
NP_441899.1_7 Forward -157 -138 1.27776 0.168
NP_443009.1_5 Forward -64 -53 17.3644 0.00556
NP_443009.1_5 Forward -201 -190 3.79477 0.278
NP_442301.1_2 Reverse -300 -319 13.47 0.137
NP_441715.1_4 Reverse -55 -65 14.828 0.0268
NP_440357.1_3 Reverse -52 -71 0.491109 0.28
NP_440183.1_9 Reverse -137 -156 -11.7019 0.255
NP_440183.1_9 Forward -170 -151 -15.9302 0.275
NP_441468.1_1 Reverse -55 -62 6.3323 0.202
NP_441468.1_1 Forward -62 -55 6.13563 0.209
NP_441468.1_1 Reverse -65 -72 4.36568 0.237
NP_441015.1_10 Reverse -296 -315 -9.73531 0.282
NP_441015.1_10 Reverse -55 -74 -10.522 0.284
NP_441673.1_1 Forward -63 -54 11.1111 0.0121
NP_441673.1_1 Reverse -54 -63 11.0128 0.018
NP_442253.1_5 Reverse -12 -29 -1.33779 0.254
NP_441826.1_2 Reverse -48 -62 -2.16369 0.267
NP_441637.1_9 Forward -101 -83 0.707465 0.292
NP_442868.1_6 Forward -65 -55 16.008 0.0203
NP_442868.1_6 Reverse -338 -348 0.471689 0.226
NP_442719.1_2 Forward -31 -13 -2.24319 0.185
NP_442719.1_2 Reverse -368 -386 -9.32298 0.263
NP_442719.1_2 Forward -199 -181 -11.5846 0.292
NP_441612.1_2 Forward -231 -221 12.809 0.21
NP_442227.1_4 Forward -38 -19 15.9282 0.15
NP_441911.1_10 Reverse -22 -41 9.61947 0.231
NP_442808.1_1 Reverse -53 -63 9.12434 0.0481
NP_441101.1_10 Forward -67 -48 -7.96535 0.295
NP_442542.1_2 Reverse -52 -65 17.5222 0.0432
NP_442113.1_10 Forward -255 -236 -9.14533 0.294
NP_442050.1_5 Forward -65 -55 11.8776 0.0802
NP_442050.1_5 Forward -298 -288 7.94438 0.243
NP_440342.1_2 Forward -253 -234 24.5822 0.0133
NP_440385.1_2 Reverse -64 -78 18.2892 0.255
NP_441114.1_1 Forward -68 -50 19.5862 0.216
NP_441114.1_2 Forward -252 -235 22.1633 0.0934
NP_441114.1_3 Forward -23 -14 17.1093 0.113
NP_441114.1_3 Forward -198 -189 7.27622 0.247
NP_441114.1_5 Forward -395 -376 27.5321 0.00276
NP_441114.1_6 Forward -361 -343 25.7819 0.00873
NP_441114.1_7 Forward -325 -306 30.5804 0.0000956
NP_441114.1_8 Forward -148 -130 25.6835 0.00937
NP_440558.1_2 Forward -28 -9 4.32602 0.152
NP_440558.1_2 Reverse -51 -70 2.65439 0.166
NP_440558.1_2 Forward -34 -15 -2.55715 0.229
NP_441878.1_6 Reverse -53 -63 2.14332 0.0501
NP_441878.1_6 Forward -64 -54 1.25834 0.108
NP_441878.1_6 Reverse -15 -25 -6.60814 0.193
NP_441878.1_6 Forward -311 -301 -7.29646 0.217
NP_441878.1_6 Forward -173 -163 -7.29646 0.217
NP_441036.1_8 Forward -151 -141 8.1415 0.176
NP_441036.1_8 Reverse -53 -63 7.94484 0.181
NP_441557.1_5 Forward -63 -54 10.2261 0.0144
NP_441557.1_5 Reverse -54 -63 10.1278 0.0188
NP_441445.1_1 Reverse -45 -64 19.174 0.0276
NP_441445.1_1 Forward -72 -53 0.786102 0.269
NP_442066.2_9 Reverse -297 -310 8.9674 0.183
NP_442419.1_2 Forward -68 -49 -4.42544 0.287
NP_442183.1_9 Forward -313 -303 11.3864 0.206
NP_442347.1_2 Reverse -83 -92 4.12963 0.284
NP_442645.1_2 Forward -33 -14 -17.4051 0.254
NP_440547.1_1 Forward -360 -341 11.6017 0.197
NP_441037.1_4 Reverse -52 -62 6.92787 0.237
NP_442508.1_8 Reverse -101 -118 10.6586 0.267
NP_442317.1_6 Forward -255 -236 1.67108 0.298
NP_441633.1_3 Forward -65 -52 19.6855 0.00655
NP_440136.1_2 Reverse -55 -62 13.4121 0.0388
NP_440136.1_2 Forward -62 -55 6.23397 0.171
NP_442998.1_5 Reverse -68 -78 9.41981 0.241
NP_442998.1_10 Reverse -56 -63 12.5271 0.0457
NP_442998.1_10 Forward -51 -44 10.4622 0.0819
NP_442998.1_10 Forward -61 -54 6.23397 0.157
NP_440299.1_1 Forward -67 -54 8.67183 0.0872
NP_441799.1_1 Forward -67 -53 9.73373 0.0857
NP_440977.1_5 Reverse -25 -38 17.0299 0.158
NP_441007.1_10 Forward -321 -308 5.42749 0.182
NP_441007.1_10 Forward -315 -302 -0.275709 0.273
NP_442201.1_10 Reverse -43 -62 -14.3569 0.281
NP_441559.1_8 Forward -68 -54 13.1759 0.0574
NP_441559.1_8 Forward -58 -44 2.75286 0.143
NP_441559.1_8 Forward -36 -22 2.5562 0.143
NP_441559.1_8 Reverse -49 -63 1.67122 0.155
NP_441179.1_9 Reverse -133 -143 15.7125 0.246
NP_441704.1_8 Forward -135 -116 7.27514 0.245
NP_442069.1_4 Forward -164 -145 11.5042 0.245
NP_441464.1_8 Forward -63 -49 9.2427 0.192
NP_440306.1_4 Forward -219 -200 7.66927 0.299
NP_442993.1_1 Forward -310 -294 -14.1995 0.297
NP_442386.1_9 Forward -64 -55 10.1274 0.139
NP_442386.1_9 Reverse -53 -62 6.19416 0.23
NP_442386.1_9 Reverse -21 -30 5.9975 0.23
NP_442386.1_9 Reverse -63 -72 5.50585 0.25
NP_440570.1_5 Forward -34 -15 -0.39387 0.262
NP_440570.1_5 Forward -35 -16 -3.93378 0.298
NP_441750.1_1 Reverse -55 -74 -11.5053 0.3
NP_441340.1_5 Forward -62 -55 6.23397 0.132
NP_441340.1_5 Reverse -55 -62 6.13563 0.175
NP_441340.1_5 Forward -72 -65 3.97235 0.274
NP_440168.1_9 Reverse -43 -62 -0.0988766 0.273
NP_440146.1_4 Reverse -181 -200 9.53756 0.129
NP_440146.1_8 Reverse -105 -123 17.6936 0.217
NP_441676.1_6 Reverse -278 -297 5.30933 0.293
NP_440586.1_9 Forward -70 -51 5.70265 0.288
NP_442251.1_6 Reverse -55 -62 11.9372 0.0749
NP_440192.1_4 Reverse -52 -71 17.9354 0.146
NP_442959.1_6 Forward -316 -297 1.17943 0.29
NP_441262.1_3 Reverse -54 -61 11.5438 0.0584
NP_440027.1_3 Reverse -54 -72 18.7012 0.0682
NP_443051.1_1 Forward -64 -55 0.688044 0.134
NP_443051.1_1 Reverse -53 -62 0.589713 0.143
NP_439996.1_6 Forward -320 -301 11.4117 0.194
NP_439984.1_10 Forward -119 -105 21.2384 0.0994
NP_439984.1_10 Reverse -230 -244 10.8154 0.254
NP_439937.1_9 Reverse -221 -238 -7.04165 0.157
NP_439937.1_9 Reverse -53 -70 -9.99156 0.22
NP_439937.1_9 Forward -64 -47 -15.8914 0.287
NP_439937.1_9 Reverse -81 -98 -17.0714 0.291
NP_440439.1_1 Reverse -51 -64 2.08423 0.138
NP_440439.1_1 Forward -66 -53 1.69091 0.147
NP_442239.1_8 Reverse -232 -251 4.62101 0.296
NP_440372.1_2 Forward -62 -55 6.62729 0.151
NP_440372.1_2 Reverse -55 -62 6.52896 0.188
NP_442783.1_7 Forward -220 -201 17.6007 0.249
NP_441181.1_6 Forward -324 -306 4.34571 0.253
NP_440316.1_10 Reverse -104 -114 5.97822 0.275
NP_442384.1_10 Reverse -54 -67 13.294 0.0211
NP_442262.1_10 Reverse -55 -62 12.4288 0.0538
NP_440344.1_10 Forward -70 -53 -11.6625 0.223
NP_440531.1_6 Forward -71 -52 2.3594 0.158
NP_440531.1_6 Reverse -56 -75 -0.39387 0.211
NP_440487.1_1 Reverse -51 -70 -3.83545 0.214
NP_441335.1_8 Reverse -179 -198 9.3409 0.228
NP_440297.1_9 Forward -24 -14 4.20827 0.238
NP_441896.1_3 Forward -72 -53 -3.24547 0.297
NP_440937.1_5 Reverse -9 -28 9.63589 0.275
NP_440999.1_9 Reverse -50 -64 2.35953 0.151
NP_440999.1_9 Forward -67 -53 -1.47537 0.239
NP_440999.1_9 Forward -311 -297 -2.06536 0.257
NP_440999.1_9 Forward -64 -50 -3.44199 0.293
NP_440888.1_2 Reverse -54 -68 15.8302 0.00862
NP_440888.1_2 Reverse -301 -315 11.7987 0.0588
NP_440888.1_2 Forward -63 -49 7.3738 0.198
NP_440888.1_2 Forward -31 -17 5.40719 0.28
NP_440052.1_5 Forward -255 -236 -5.60541 0.293
NP_442033.1_10 Reverse -52 -71 12.2908 0.042
NP_442033.1_10 Forward -65 -46 -14.4552 0.298
NP_440575.1_1 Reverse -217 -236 -1.57461 0.29
NP_441543.1_2 Forward -62 -53 9.4395 0.0818
NP_441543.1_2 Reverse -55 -64 7.27622 0.13
NP_442845.1_2 Reverse -21 -35 5.80112 0.224
NP_441319.1_8 Forward -69 -51 10.5406 0.185
NP_441469.1_8 Reverse -53 -62 6.78456 0.227
NP_441469.1_8 Forward -74 -65 5.99792 0.241
NP_442315.1_2 Reverse -283 -295 12.527 0.291
NP_442315.1_3 Reverse -340 -359 7.96426 0.222
NP_443064.1_6 Reverse -54 -64 8.97947 0.254
NP_442578.1_4 Forward -288 -269 20.5498 0.116
NP_440071.1_2 Reverse -82 -96 16.7159 0.24
NP_440220.1_4 Forward -38 -19 -0.886293 0.262
NP_440220.1_4 Forward -86 -67 -3.63955 0.293
NP_441462.1_2 Forward -63 -53 1.84832 0.081
NP_441462.1_2 Reverse -54 -64 1.74999 0.0811
NP_443062.1_1 Reverse -64 -82 4.06059 0.276
NP_443062.1_6 Forward -71 -52 5.01433 0.211
NP_440519.1_6 Forward -205 -191 10.0294 0.29
NP_440519.1_8 Reverse -340 -356 5.6634 0.21
NP_442204.1_1 Forward -67 -56 0.0586712 0.284
NP_440516.1_2 Forward -210 -192 -1.25915 0.282
NP_440516.1_2 Reverse -48 -66 -2.73412 0.299
NP_440516.1_8 Forward -63 -54 7.17789 0.0754
NP_440516.1_8 Reverse -54 -63 7.07956 0.0867
NP_442428.1_5 Reverse -55 -62 6.43063 0.148
NP_442428.1_5 Forward -62 -55 6.13563 0.209
NP_442428.1_5 Reverse -65 -72 4.759 0.223
NP_442428.1_8 Forward -320 -301 4.12936 0.224
NP_440818.1_6 Reverse -338 -357 5.60432 0.289
NP_442120.1_10 Reverse -16 -35 -14.5535 0.288
NP_442823.1_8 Forward -204 -185 10.4225 0.297
NP_440673.1_2 Reverse -44 -63 9.51162 0.243
NP_440673.1_3 Reverse -56 -63 9.77388 0.167
NP_440673.1_3 Forward -198 -191 8.98723 0.203
NP_440077.1_2 Forward -145 -127 18.7012 0.175
NP_441052.1_2 Reverse -54 -64 10.3048 0.0289
NP_441052.1_2 Reverse -82 -92 5.78156 0.103
NP_441052.1_2 Forward -63 -53 1.06167 0.252
NP_442219.1_9 Reverse -55 -64 7.96454 0.0696
NP_440436.1_4 Reverse -55 -64 13.9623 0.0193
NP_440436.1_4 Forward -72 -63 11.3073 0.0574
NP_440436.1_4 Forward -62 -53 8.65242 0.0997
NP_441884.1_9 Reverse -51 -70 -2.95047 0.0594
NP_440314.1_9 Forward -230 -211 -6.1954 0.228
NP_442414.1_8 Forward -292 -273 11.5042 0.24
NP_442907.1_2 Forward -62 -44 8.96727 0.257
NP_441719.1_4 Forward -62 -55 6.62729 0.151
NP_441719.1_4 Reverse -55 -62 6.52896 0.188
NP_441004.1_1 Reverse -16 -35 -11.5053 0.24
NP_441004.1_1 Forward -322 -303 -12.8819 0.251
NP_441004.1_1 Reverse -28 -47 -15.5368 0.275
NP_441004.1_1 Forward -100 -81 -18.2901 0.299
NP_441004.1_5 Forward -320 -306 10.3243 0.248
NP_442813.1_4 Forward -250 -231 -9.047 0.299
NP_442366.1_3 Forward -32 -14 0.609134 0.167
NP_440296.1_10 Reverse -51 -70 -5.40875 0.225
NP_442694.1_4 Forward -397 -388 13.9627 0.217
NP_442854.1_4 Forward -302 -283 11.0117 0.278
NP_442854.1_6 Forward -63 -44 2.85105 0.272
NP_443054.1_2 Forward -65 -51 10.9143 0.0761
NP_443054.1_2 Forward -26 -12 0.491246 0.262
NP_443054.1_2 Forward -55 -41 0.294584 0.269
NP_441966.1_9 Reverse -110 -129 11.8967 0.148
NP_440864.1_9 Forward -251 -232 12.7825 0.0633
NP_441851.1_10 Reverse -53 -63 14.3364 0.0179
NP_441851.1_10 Forward -64 -54 6.07655 0.187
NP_442208.1_5 Reverse -141 -160 -3.93378 0.258
NP_441157.1_1 Forward -269 -255 5.70218 0.235
NP_442515.1_1 Forward -64 -50 9.5377 0.0628
NP_441396.1_5 Forward -393 -384 16.8143 0.199
NP_440593.1_3 Forward -261 -242 -3.44213 0.235
NP_440165.1_5 Reverse -53 -72 -6.49039 0.238
NP_441349.1_10 Reverse -44 -63 -9.14533 0.284
NP_441661.1_3 Forward -132 -115 -5.95935 0.283
NP_442843.1_1 Reverse -65 -84 2.45773 0.161
NP_439960.1_10 Forward -70 -52 -3.81576 0.282
NP_440474.1_8 Forward -62 -48 5.01387 0.26
NP_440474.1_8 Forward -309 -295 4.62054 0.271
NP_441570.1_1 Reverse -54 -72 0.314141 0.0395
NP_441570.1_1 Forward -63 -45 -16.9921 0.26
NP_441078.1_4 Forward -63 -54 10.4228 0.0105
NP_441078.1_4 Reverse -54 -63 10.3245 0.0119
NP_441078.1_4 Forward -53 -44 -1.08191 0.222
NP_441078.1_4 Forward -310 -301 -1.6719 0.266
NP_441078.1_4 Reverse -44 -53 -1.86856 0.272
NP_442348.1_2 Forward -398 -389 13.1761 0.206
NP_442348.1_2 Reverse -15 -24 11.8978 0.225
NP_440707.1_6 Forward -71 -52 10.3234 0.285
NP_440526.1_3 Forward -62 -51 0.54986 0.275
NP_441432.1_8 Forward -64 -55 17.7976 0.00595
NP_441432.1_8 Reverse -21 -30 5.60459 0.147
NP_441432.1_8 Reverse -190 -199 5.40793 0.158
NP_441432.1_8 Reverse -15 -24 3.83464 0.243
NP_441432.1_9 Forward -50 -37 8.01662 0.295
NP_441732.1_2 Forward -67 -51 -6.23465 0.0495
NP_441732.1_2 Reverse -50 -66 -15.2811 0.145
NP_441732.1_2 Reverse -297 -313 -15.7728 0.16
NP_442447.1_1 Reverse -173 -192 4.81767 0.271
NP_442003.1_4 Reverse -55 -74 17.994 0.141
NP_441945.1_10 Reverse -339 -358 10.3242 0.252
NP_441945.1_10 Reverse -98 -117 9.63589 0.258
NP_442727.1_1 Forward -398 -384 12.6843 0.256
NP_442751.1_2 Reverse -53 -72 9.83173 0.206
NP_440713.1_4 Forward -73 -54 12.0942 0.11
NP_442489.1_7 Reverse -54 -63 17.601 0.00221
NP_442489.1_7 Forward -63 -54 10.4228 0.0151
NP_442489.1_7 Forward -310 -301 -1.37691 0.195
NP_442489.1_7 Forward -53 -44 -1.86856 0.259
NP_440559.1_1 Reverse -55 -64 7.57121 0.106
NP_440559.1_1 Forward -62 -53 5.50626 0.14
NP_441659.2_8 Reverse -54 -64 8.33817 0.0443
NP_441659.2_8 Reverse -301 -311 3.42162 0.161
NP_441659.2_8 Reverse -340 -350 2.83163 0.187
NP_441659.2_8 Forward -63 -53 2.53664 0.198
NP_442913.1_10 Reverse -45 -64 -2.36049 0.184
NP_441040.1_3 Forward -321 -302 10.8159 0.242
NP_441800.1_7 Reverse -302 -320 1.59244 0.204
NP_441800.1_10 Reverse -15 -34 1.86774 0.255
NP_442346.1_5 Forward -64 -54 13.943 0.0183
NP_442346.1_5 Reverse -190 -200 10.8948 0.0813
NP_442346.1_5 Forward -145 -135 6.96153 0.187
NP_440545.1_3 Reverse -336 -353 4.46374 0.0703
NP_440545.1_3 Reverse -50 -67 -1.14113 0.163
NP_440545.1_3 Forward -67 -50 -2.71443 0.191
NP_440545.1_3 Forward -314 -297 -3.99273 0.215
NP_440831.1_3 Forward -72 -53 6.29006 0.275
NP_440831.1_3 Reverse -147 -166 5.61052 0.28
NP_440459.1_2 Reverse -13 -30 12.7235 0.137
NP_442551.1_4 Forward -313 -298 4.30646 0.245
NP_442551.1_4 Reverse -13 -28 -1.10174 0.245
NP_442603.1_7 Reverse -54 -68 10.717 0.125
NP_441888.1_7 Forward -68 -54 4.03116 0.225
NP_441050.1_5 Reverse -284 -302 -3.71743 0.299
NP_441948.1_4 Forward -70 -52 1.29745 0.133
NP_441833.1_4 Forward -62 -55 6.23397 0.163
NP_441833.1_4 Reverse -55 -62 6.13563 0.198
NP_442799.1_2 Forward -26 -7 10.3242 0.141
NP_442162.1_9 Reverse -55 -62 12.6255 0.0393
NP_442162.1_9 Forward -62 -55 6.52896 0.178
NP_442140.1_3 Forward -62 -52 7.84651 0.126
NP_442140.1_3 Reverse -65 -75 6.76487 0.159
NP_440875.1_9 Forward -61 -51 11.2921 0.175
NP_441813.1_5 Forward -65 -55 8.4365 0.0432
NP_441813.1_5 Reverse -52 -62 0.176696 0.215
NP_441813.1_5 Reverse -62 -72 -0.511621 0.247
NP_441813.1_7 Reverse -82 -96 7.96378 0.298
NP_440590.1_4 Reverse -55 -68 13.4906 0.013
NP_440590.1_4 Forward -62 -49 4.44418 0.0601
NP_440590.1_4 Reverse -45 -58 4.14919 0.0632
NP_440590.1_4 Reverse -16 -29 -3.71729 0.255
NP_442497.1_10 Forward -62 -53 0.688044 0.141
NP_442497.1_10 Reverse -55 -64 0.589713 0.153
NP_440821.1_4 Reverse -52 -62 8.92815 0.0382
NP_440821.1_4 Forward -65 -55 -0.314959 0.251
NP_441239.1_9 Forward -75 -63 10.3637 0.0807
NP_441239.1_9 Reverse -142 -154 8.20045 0.141
NP_441239.1_9 Reverse -52 -64 7.02048 0.173
NP_441239.1_9 Forward -65 -53 5.93884 0.202
NP_440400.1_1 Forward -34 -15 -2.55791 0.285
NP_441892.1_1 Forward -72 -55 -3.00942 0.231
NP_442270.1_9 Reverse -11 -30 -1.18052 0.154
NP_442270.1_9 Forward -74 -55 -8.35868 0.217
NP_442643.1_5 Reverse -18 -37 -6.09707 0.293
NP_441017.1_6 Forward -67 -53 11.1104 0.279
NP_442216.1_4 Forward -122 -114 8.1805 0.255
NP_443035.1_10 Reverse -137 -154 16.1651 0.174
NP_442138.1_10 Reverse -352 -371 -6.09707 0.28
NP_442052.1_8 Forward -202 -192 12.2714 0.282
NP_440462.1_6 Reverse -52 -62 8.1415 0.0699
NP_440868.1_4 Reverse -50 -62 9.47875 0.0482
NP_440868.1_4 Forward -73 -61 2.59558 0.151
NP_440868.1_4 Forward -67 -55 0.825626 0.199
NP_441582.1_5 Forward -65 -46 5.40686 0.216
NP_441582.1_5 Forward -27 -8 2.55527 0.293
NP_441269.1_10 Reverse -290 -307 17.8367 0.178
NP_442402.1_4 Forward -49 -30 0.392004 0.182
NP_442402.1_10 Forward -120 -110 11.1893 0.269
NP_441848.1_7 Forward -83 -64 0.0970122 0.23
NP_440696.1_3 Forward -73 -55 1.78911 0.217
NP_440696.1_3 Forward -63 -45 1.29745 0.217
NP_442039.1_4 Reverse -55 -62 14.3954 0.0271
NP_442039.1_7 Reverse -18 -28 7.15819 0.279
NP_442039.1_7 Forward -67 -57 6.96153 0.286
NP_442837.1_3 Forward -62 -55 6.0373 0.25
NP_442837.1_3 Reverse -55 -62 5.93897 0.265
NP_440160.1_2 Forward -37 -18 -8.94866 0.292
NP_440160.1_3 Reverse -304 -323 7.27514 0.295
NP_442053.1_1 Forward -63 -54 8.65285 0.0741
NP_442053.1_1 Reverse -54 -63 8.55452 0.0784
NP_440505.1_3 Forward -65 -55 16.6963 0.00683
NP_440505.1_3 Reverse -52 -62 11.0914 0.0877
NP_440505.1_3 Reverse -42 -52 9.12481 0.125
NP_442360.1_5 Forward -240 -230 13.353 0.279
NP_441203.1_2 Forward -325 -306 -4.42544 0.22
NP_441408.2_7 Forward -33 -14 3.93269 0.191
NP_442174.1_9 Reverse -338 -357 6.68596 0.285
NP_440914.1_1 Forward -24 -14 11.9332 0.0746
NP_440914.1_1 Reverse -54 -64 8.32233 0.197
NP_440914.1_1 Forward -63 -53 6.66328 0.269
NP_441011.1_8 Forward -62 -53 7.37455 0.172
NP_442101.1_10 Reverse -183 -202 -8.752 0.242
NP_442533.1_1 Forward -325 -306 -13.7669 0.238
NP_442533.1_6 Forward -63 -54 8.65285 0.0727
NP_442533.1_6 Reverse -54 -63 7.96454 0.0838
NP_442533.1_6 Forward -310 -301 4.62128 0.179
NP_442533.1_6 Forward -24 -15 4.0313 0.194
NP_442541.1_10 Forward -25 -11 2.35894 0.262
NP_442322.1_4 Forward -305 -288 -9.7949 0.297
NP_441219.1_6 Reverse -153 -171 9.65558 0.273
NP_440115.1_6 Forward -66 -56 12.9597 0.0846
NP_440115.1_6 Reverse -244 -254 5.87989 0.214
NP_440007.1_9 Forward -34 -20 8.84938 0.171
NP_440007.1_9 Forward -300 -286 4.32615 0.267
NP_441972.1_5 Forward -360 -341 0.884433 0.144
NP_441106.1_1 Reverse -63 -72 11.4061 0.0311
NP_441106.1_1 Reverse -53 -62 8.55452 0.0538
NP_441869.1_2 Forward -38 -19 14.3558 0.183
NP_439903.1_6 Forward -34 -15 14.4533 0.0705
NP_442306.1_10 Forward -68 -49 -1.18052 0.0484
NP_442306.1_10 Reverse -59 -78 -21.1417 0.247
NP_441286.1_1 Forward -64 -52 5.05386 0.0259
NP_441286.1_1 Reverse -53 -65 -6.45087 0.265
NP_440670.1_8 Reverse -54 -63 15.1427 0.00768
NP_440670.1_8 Forward -63 -54 8.65285 0.0627
NP_441930.1_2 Reverse -15 -25 11.9764 0.271
NP_440886.1_7 Reverse -306 -316 12.5659 0.0805
NP_440886.1_7 Reverse -53 -63 7.94438 0.0805
NP_440886.1_7 Forward -54 -44 6.0761 0.147
NP_440886.1_7 Forward -64 -54 5.38779 0.185
NP_440828.1_4 Reverse -297 -316 -4.03287 0.246
NP_440828.1_4 Reverse -300 -319 -5.40949 0.255
NP_442614.1_2 Forward -234 -220 6.78443 0.285
NP_440404.1_9 Forward -234 -215 9.7875 0.218
NP_441399.1_6 Forward -30 -11 15.3382 0.185
NP_442072.1_4 Forward -36 -17 15.0747 0.278
NP_442072.1_9 Forward -64 -46 -23.482 0.297
NP_440907.2_8 Forward -62 -52 7.94438 0.117
NP_441021.1_1 Forward -30 -11 -10.0303 0.227
NP_441463.1_6 Forward -65 -51 6.80246 0.267
NP_442842.1_10 Forward -42 -23 0.950819 0.254
NP_441626.1_2 Reverse -55 -62 6.43063 0.147
NP_441626.1_2 Forward -62 -55 6.0373 0.212
NP_442365.1_7 Forward -67 -48 4.52268 0.144
NP_442794.1_1 Forward -67 -55 7.90546 0.126
NP_442794.1_1 Forward -28 -16 2.20226 0.299
NP_441962.1_4 Forward -315 -296 -8.55534 0.203
NP_440387.1_1 Forward -310 -294 3.59845 0.0551
NP_440387.1_1 Forward -63 -47 -3.8747 0.169
NP_440387.1_1 Reverse -301 -317 -5.93965 0.258
NP_441431.1_2 Reverse -51 -65 8.84875 0.204
NP_441431.1_2 Reverse -61 -75 7.96378 0.23
NP_441836.1_2 Forward -316 -297 0.982764 0.197
NP_441193.1_1 Forward -127 -108 12.0933 0.229
NP_441993.1_1 Reverse -16 -35 7.59921 0.16
NP_441993.1_1 Reverse -137 -156 5.06532 0.208
NP_441993.1_4 Forward -63 -44 8.16011 0.285
NP_441174.1_2 Forward -66 -52 15.7325 0.0967
NP_440114.1_10 Forward -63 -49 9.83269 0.16
NP_441237.1_9 Forward -24 -14 10.7964 0.218
NP_442743.1_1 Forward -34 -15 5.99684 0.268
NP_439910.1_2 Reverse -36 -53 -4.58271 0.0788
NP_439910.1_2 Reverse -46 -63 -13.6292 0.162
NP_440457.1_1 Forward -318 -306 -1.23932 0.3
NP_442940.1_2 Reverse -54 -73 4.71934 0.24
NP_440798.1_6 Forward -62 -49 2.67422 0.166
NP_442680.1_5 Reverse -31 -50 1.3422 0.243
NP_441984.1_6 Forward -240 -228 13.6087 0.274
NP_441436.1_8 Reverse -21 -40 8.94757 0.275
NP_440473.1_9 Reverse -53 -72 -3.04881 0.161
NP_440473.1_9 Reverse -43 -62 -3.04881 0.161
NP_442509.1_9 Forward -63 -53 13.1559 0.061
NP_440554.1_4 Forward -72 -62 6.07655 0.128
NP_440554.1_4 Forward -62 -52 4.40493 0.19
NP_441885.1_5 Reverse -54 -64 11.0914 0.00874
NP_441885.1_5 Forward -63 -53 2.33998 0.0799
NP_440478.1_10 Reverse -52 -66 10.9143 0.193
NP_442341.1_7 Forward -64 -50 10.3243 0.0665
NP_442341.1_7 Reverse -43 -57 3.73617 0.214
NP_442341.1_7 Reverse -14 -28 2.35953 0.259
NP_442341.1_7 Reverse -53 -67 1.08123 0.299
NP_441173.1_9 Reverse -229 -237 11.3271 0.226
NP_443000.1_7 Forward -65 -55 10.2065 0.0355
NP_443000.1_7 Forward -93 -83 2.14332 0.226
NP_441842.1_1 Reverse -56 -69 11.6217 0.248
NP_440275.1_3 Reverse -52 -62 8.1415 0.0602
NP_440275.1_3 Forward -65 -55 5.38824 0.153
NP_440091.1_1 Reverse -50 -62 7.90546 0.072
NP_441902.1_3 Reverse -31 -41 13.5647 0.23
NP_443010.1_10 Reverse -51 -68 10.6948 0.119
NP_442451.1_2 Forward -71 -52 -5.01543 0.217
NP_439962.1_4 Reverse -230 -249 -3.54046 0.253
NP_439962.1_4 Forward -71 -52 -7.67036 0.29
NP_440175.1_4 Reverse -52 -71 -10.0303 0.171
NP_440149.1_8 Forward -189 -170 -7.96535 0.296
NP_441875.1_7 Reverse -179 -189 16.1063 0.227
NP_440216.1_1 Forward -63 -49 -3.04867 0.0682
NP_440216.1_1 Reverse -54 -68 -9.34185 0.145
NP_440216.1_1 Forward -172 -158 -12.5868 0.288
NP_440172.1_1 Reverse -54 -64 11.9764 0.0334
NP_440172.1_1 Forward -63 -53 5.48657 0.143
NP_440172.1_1 Reverse -22 -32 4.40493 0.189
NP_440172.1_1 Forward -310 -300 3.51995 0.224
NP_440172.1_1 Reverse -191 -201 2.7333 0.268
NP_440167.1_3 Forward -73 -54 9.93088 0.247
NP_442015.1_10 Forward -67 -54 11.819 0.0372
NP_442015.1_10 Forward -29 -16 0.117615 0.241
NP_442015.1_10 Forward -57 -44 -0.177378 0.255
NP_441226.1_7 Forward -62 -55 5.64364 0.286
NP_441111.1_7 Forward -62 -54 8.96754 0.0463
NP_441111.1_7 Reverse -55 -63 8.86921 0.0589
NP_441766.1_2 Forward -63 -54 7.76787 0.0714
NP_441766.1_2 Reverse -54 -63 7.66954 0.0723
NP_442417.1_5 Reverse -340 -354 4.81781 0.288
NP_440416.1_7 Forward -73 -56 18.8201 0.288
NP_440416.1_9 Forward -32 -13 -16.1268 0.208
NP_440416.1_9 Forward -70 -51 -16.8151 0.223
NP_443052.1_8 Reverse -44 -63 1.27776 0.061
NP_443052.1_9 Reverse -81 -100 -1.47551 0.228
NP_442403.1_10 Reverse -190 -209 10.9142 0.246
NP_440591.1_9 Forward -64 -46 6.90232 0.215
NP_442154.1_1 Forward -318 -300 -6.37237 0.137
NP_442154.1_1 Forward -324 -306 -17.1888 0.249
NP_442154.1_1 Reverse -97 -115 -17.8771 0.272
NP_440261.1_5 Forward -62 -49 -4.89726 0.178
NP_440261.1_5 Reverse -55 -68 -6.07724 0.193
NP_440988.1_10 Reverse -52 -66 5.28608 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGGGCCTTTGTGGGGGAACTTTACGAACAGCGCAACATGTTAACCACCAATGCTGTGGCCAGGTTATTACACAGTATCATTGGCGGGGTGGCGGTGTCCTCAACCCGTTCCCAACAAATGATGCAATTACTTAAACGAGATTTAACGGCCGCTCCGGCTCCTTTGGGGGAAGATAACCAAATTACCGGTTTTCTCGGTGAACCATTGCCTAAAGATGCCCAAATGTGGTCTAAGGCCGGTTGGACCAGCCAGGTGCGCCATGATTGTGCCTACATTGAAATTCCCCACCAGAGTCCCTATCTTTTGGTGGTGTTCACGGAAAATTCTGCCCTCGCTGGCAATCGCCGCCTATTGCCGTTTATTTCCCAAGCCTTTGCCAATGCCCACTAAATCAGAGCC

CDS

ATGGCTGCCGATTTTGAAACCTCTAATCGACGCTGGTTAGATAAACTTCCCAGGAATTTAACCGATAGCGCCCGTTCTCTCCATCCCCGTACCCTTGTGGCGGCCATTGTGGTGGGGCTGATTACCGGTGTATTGGGGGCCGGTTTTAAATCCGCTGTGAACAATATGCTCCAGTGGCGATCGCAATTAGCACAAATACTTGCCCCCATACCGCCCTTGGCTTGGCTGGTCACCGCTCTGATCAGTGGTGGCATGGTAGCCCTCAGCTTTTGGTTAATGAAACGTTTTGCCCCGGACACCAGCGGCAGTGGTATTCCCCAAATTGAAGGGCATTTGGAAGGGAAACTTCCCCTGGTCTGGCAGAGGGTCTTGCCTATCAAATTAGTGGGGGGATTTTTATCCTTGGGAGCTGGTATGTTGGCGGGATTTGAAGGGCCAACGATTCAAATGGGGGGAAGCATTGGCCAGATGACTGGGGGGTGGTTCAAGGCAACTCAAGAGAATCAACGAATTTTAATTGCAGTGGGAGCCGGGGCCGGTTTGGCCACCGCTTTTAATGCGCCCCTGGCAGGGGTAGCTCTGATTGGGGAAGAAATGCATCCTCGTTTTCGTAGTCAAACCTTGGCGTACCATAGCCTACTATTTGGCTGTGTGATGGCCACTATTATTCTCAGAATGATTCGAGGGCAGTCCGCCATCATCAGCTTGACTGAGTTTAAACGGGTTCCCCTGGATTCCCTCTGGATGTTCATTATTTTGGGGATTTTATTTGGGGTGATGGGTTACACCTTCAACCGGGGTCTATTCAAAGTACTAGACTGGTTCGATCGCCTGCCGCCCCTAGCAACTAAATGGAAAGGGTTTTTGCTCGGTTCCATCATTGGCATTTTGTCCCTATTTCCCCTACCCCTCACCGACGGGGGAGACAATGCAGTGCTCTGGGCTTTTAACAGTCAATCCCATTTTTCTACACTCATACTGGTGTTTTGTGGCAGATTTTTGTTAACCCTGATCTGCTACGGCTCCGGGGCAATTGGCGGTATTTTTGCCCCCATGTTGGGCATTGCTTCCATTGTCAGTGTAGCCATGGCGAGACATTTCCATTTACTCTTTCCCAGTCAAATTCCTGAACCCGCTGTAATGGCGATCGCCGGCATGGGAGCTTTAGTAGCGGCAACGGTGCGAGCCCCATTAACTGCAATTCTGTTAACCATAGAAATGACGGACAACTATTTTGTGATTTTGCCTTTGTTAGTTACCTGCCTAGTGGCCAGTGTGGTGGCGGAAGCATTGGGGGGTAAACCCATTTATACAGTCTTGCTAGAAAGAACTTTAGCTAAACAAAACCGTGGCTAA

Protein

MAADFETSNRRWLDKLPRNLTDSARSLHPRTLVAAIVVGLITGVLGAGFKSAVNNMLQWRSQLAQILAPIPPLAWLVTALISGGMVALSFWLMKRFAPDTSGSGIPQIEGHLEGKLPLVWQRVLPIKLVGGFLSLGAGMLAGFEGPTIQMGGSIGQMTGGWFKATQENQRILIAVGAGAGLATAFNAPLAGVALIGEEMHPRFRSQTLAYHSLLFGCVMATIILRMIRGQSAIISLTEFKRVPLDSLWMFIILGILFGVMGYTFNRGLFKVLDWFDRLPPLATKWKGFLLGSIIGILSLFPLPLTDGGDNAVLWAFNSQSHFSTLILVFCGRFLLTLICYGSGAIGGIFAPMLGIASIVSVAMARHFHLLFPSQIPEPAVMAIAGMGALVAATVRAPLTAILLTIEMTDNYFVILPLLVTCLVASVVAEALGGKPIYTVLLERTLAKQNRG