Your browser is old and dusty. Try Google Chrome!

Details for sll0854

ORF sll0854
Accession NP_441115.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -288 -302 3.04785 0.168
NP_441418.1_6 Forward -302 -283 -29.8932 0.245
NP_441480.1_1 Reverse -325 -344 11.9958 0.108
NP_440897.1_6 Reverse -296 -315 -2.55791 0.216
NP_440897.1_6 Forward -354 -335 -4.22953 0.27
NP_442287.1_1 Reverse -184 -194 13.4509 0.277
NP_443002.1_5 Reverse -52 -70 9.55647 0.286
NP_442752.1_4 Forward -194 -187 12.1338 0.0546
NP_442752.1_4 Forward -296 -289 6.23397 0.161
NP_441812.1_2 Forward -210 -191 13.1758 0.235
NP_442909.1_2 Forward -314 -295 10.0292 0.255
NP_440061.1_9 Reverse -342 -356 6.88214 0.228
NP_440011.1_1 Reverse -7 -26 13.0775 0.258
NP_442602.1_3 Reverse -354 -373 -1.27885 0.237
NP_441352.1_4 Forward -308 -289 17.699 0.155
NP_441200.1_6 Reverse -271 -288 15.5751 0.177
NP_441594.1_6 Forward -305 -286 6.4893 0.189
NP_441594.1_6 Forward -280 -261 2.3594 0.252
NP_441594.1_6 Reverse -55 -74 2.0644 0.256
NP_442110.1_7 Forward -73 -59 5.50613 0.169
NP_441083.1_5 Reverse -287 -297 8.4365 0.0363
NP_442570.1_2 Forward -80 -61 8.06259 0.126
NP_442570.1_3 Forward -255 -236 -2.55715 0.212
NP_442570.1_3 Reverse -336 -355 -7.4737 0.27
NP_442445.1_2 Forward -383 -364 8.06259 0.288
NP_441716.1_1 Forward -308 -294 5.70279 0.22
NP_441716.1_1 Forward -239 -225 4.62115 0.254
NP_441598.1_1 Forward -73 -54 6.09597 0.295
NP_440747.1_10 Forward -299 -287 -11.9574 0.178
NP_440842.1_10 Forward -356 -342 2.5562 0.274
NP_441012.1_4 Reverse -295 -308 9.65572 0.272
NP_440376.1_1 Forward -73 -64 4.32629 0.163
NP_440376.1_1 Forward -194 -185 0.196389 0.283
NP_442687.1_7 Reverse -273 -283 5.87989 0.183
NP_441013.1_2 Forward -313 -295 -3.81576 0.292
NP_441763.1_10 Reverse -276 -295 6.78348 0.266
NP_442782.1_2 Reverse -258 -272 1.76955 0.281
NP_441487.1_6 Forward -304 -285 0.884433 0.254
NP_442605.1_2 Forward -351 -335 17.0691 0.259
NP_440203.1_5 Reverse -188 -198 10.8943 0.209
NP_442260.1_1 Forward -322 -303 18.1907 0.112
NP_441580.1_6 Reverse -270 -289 -8.94866 0.277
NP_440153.1_5 Forward -72 -58 2.94952 0.219
NP_443055.1_6 Reverse -177 -195 -2.04653 0.287
NP_440993.1_2 Reverse -59 -75 5.36841 0.234
NP_441429.1_4 Forward -355 -336 16.7149 0.13
NP_442002.1_1 Forward -203 -185 -6.07737 0.249
NP_441398.1_5 Reverse -292 -311 6.58763 0.298
NP_441110.1_1 Forward -305 -286 23.4022 0.0146
NP_440703.1_9 Forward -353 -340 5.32859 0.293
NP_439966.1_7 Reverse -183 -193 8.82935 0.13
NP_439966.1_7 Reverse -285 -295 8.53436 0.135
NP_442941.1_3 Reverse -288 -298 0.57002 0.199
NP_442049.1_6 Forward -304 -285 11.6025 0.215
NP_441644.1_6 Reverse -287 -297 4.7978 0.224
NP_441644.1_6 Reverse -185 -195 4.69947 0.228
NP_443049.1_6 Forward -195 -185 12.1289 0.24
NP_442215.1_2 Reverse -265 -281 -6.7263 0.278
NP_441310.1_10 Reverse -306 -316 14.4292 0.279
NP_441751.2_8 Reverse -288 -302 -1.67204 0.13
NP_442075.1_10 Forward -296 -277 12.9791 0.282
NP_441673.1_1 Reverse -64 -73 -8.06341 0.254
NP_441876.1_9 Reverse -282 -292 11.1893 0.28
NP_441826.1_2 Forward -302 -288 2.85119 0.119
NP_441612.1_2 Reverse -243 -253 7.00028 0.268
NP_443058.1_7 Reverse -332 -351 3.73603 0.26
NP_442361.1_3 Forward -302 -289 9.45906 0.276
NP_442808.1_1 Reverse -286 -296 9.81266 0.0481
NP_442808.1_1 Reverse -184 -194 4.50281 0.197
NP_440031.1_10 Forward -205 -186 4.42435 0.256
NP_441557.1_8 Reverse -347 -357 14.6309 0.183
NP_441590.1_4 Reverse -270 -289 10.6184 0.249
NP_442066.2_4 Forward -73 -54 -0.295539 0.173
NP_442183.1_1 Forward -296 -282 4.71948 0.25
NP_441574.1_1 Forward -113 -94 -0.197208 0.202
NP_440276.1_2 Forward -285 -266 11.7435 0.233
NP_442347.1_2 Reverse -288 -297 3.83464 0.284
NP_441633.1_3 Reverse -228 -241 -1.94734 0.168
NP_442590.1_10 Reverse -327 -346 4.916 0.27
NP_442998.1_5 Forward -355 -345 8.04317 0.274
NP_442998.1_10 Reverse -289 -296 5.74231 0.255
NP_440299.1_1 Reverse -100 -113 2.772 0.274
NP_442334.1_2 Forward -297 -280 -8.71262 0.297
NP_442967.1_10 Reverse -57 -71 15.609 0.237
NP_442866.1_1 Forward -172 -153 -9.83364 0.3
NP_440748.1_4 Forward -289 -270 16.5182 0.21
NP_441464.1_10 Forward -196 -182 11.111 0.231
NP_442993.1_1 Forward -296 -280 -9.67623 0.19
NP_442993.1_1 Forward -326 -310 -11.0529 0.233
NP_442386.1_9 Reverse -184 -193 7.76745 0.217
NP_440570.1_5 Reverse -353 -372 -2.45882 0.279
NP_442791.1_5 Forward -291 -272 1.96607 0.21
NP_440168.1_4 Reverse -88 -107 -0.787193 0.255
NP_442240.1_2 Reverse -4 -23 -14.8485 0.191
NP_440372.1_2 Forward -295 -288 4.07068 0.262
NP_440819.1_5 Reverse -308 -316 7.8859 0.266
NP_440316.1_10 Forward -195 -185 6.07655 0.271
NP_441803.1_2 Forward -295 -276 -0.885524 0.291
NP_442790.1_4 Forward -305 -286 -8.45701 0.17
NP_441689.1_5 Forward -298 -288 10.206 0.132
NP_441965.1_10 Reverse -182 -198 8.515 0.125
NP_442750.1_3 Forward -189 -170 -12.2919 0.276
NP_440297.1_4 Reverse -118 -137 13.8641 0.144
NP_442280.1_10 Reverse -335 -353 5.25962 0.289
NP_440990.1_10 Forward -197 -178 15.7324 0.261
NP_440894.1_10 Reverse -282 -301 13.3725 0.116
NP_441894.1_1 Reverse -55 -74 -5.80207 0.274
NP_440888.1_2 Reverse -287 -301 8.94708 0.142
NP_440888.1_2 Forward -73 -59 6.68548 0.223
NP_442845.1_2 Forward -302 -288 6.19444 0.215
NP_442845.1_2 Forward -200 -186 4.22782 0.264
NP_441551.1_5 Reverse -283 -299 7.53099 0.245
NP_442337.1_8 Reverse -333 -352 0.786102 0.244
NP_441462.1_5 Reverse -127 -146 5.11266 0.258
NP_443062.1_1 Reverse -185 -203 8.44842 0.153
NP_443062.1_1 Reverse -287 -305 7.76586 0.168
NP_442204.1_1 Forward -300 -289 6.84351 0.15
NP_442204.1_1 Reverse -353 -364 0.845319 0.281
NP_442204.1_1 Forward -198 -187 0.255333 0.282
NP_440255.1_4 Forward -36 -17 12.5568 0.271
NP_440516.1_8 Forward -296 -287 9.24284 0.0264
NP_440516.1_8 Forward -194 -185 -0.491928 0.262
NP_441052.1_2 Reverse -287 -297 1.35667 0.248
NP_441115.1_2 Forward -205 -186 19.0748 0.0338
NP_441115.1_4 Forward -74 -56 13.588 0.0741
NP_441115.1_9 Forward -290 -272 26.6668 0.00564
NP_442430.1_2 Reverse -88 -107 5.60432 0.268
NP_442622.1_8 Reverse -293 -311 -18.8604 0.285
NP_440165.1_5 Reverse -286 -305 -1.18052 0.185
NP_441046.1_2 Forward -112 -93 -0.39387 0.28
NP_441409.1_6 Reverse -281 -300 -15.0452 0.275
NP_439950.1_1 Forward -241 -232 12.1928 0.296
NP_442006.1_3 Forward -302 -284 -7.65067 0.298
NP_440483.1_1 Forward -199 -180 -8.26035 0.282
NP_442243.1_1 Reverse -58 -76 -1.16155 0.269
NP_440707.1_7 Forward -303 -284 8.35759 0.22
NP_441432.1_8 Forward -297 -288 4.32629 0.223
NP_441432.1_8 Forward -167 -158 2.65466 0.292
NP_441732.1_2 Reverse -223 -239 -17.1494 0.24
NP_441732.1_2 Forward -300 -284 -17.5427 0.27
NP_442797.1_6 Forward -71 -52 16.8542 0.17
NP_440199.1_10 Forward -299 -289 6.96153 0.251
NP_440913.1_1 Forward -304 -286 3.46073 0.299
NP_440713.1_4 Forward -306 -287 2.65439 0.26
NP_442489.1_7 Forward -73 -64 5.21127 0.077
NP_440386.1_6 Forward -318 -299 9.7334 0.146
NP_442763.1_8 Forward -75 -56 2.85105 0.207
NP_442749.1_8 Forward -244 -226 15.6538 0.167
NP_440831.1_3 Forward -305 -286 10.5615 0.175
NP_442603.1_7 Reverse -287 -301 11.4053 0.117
NP_441585.1_5 Forward -20 -1 2.45694 0.27
NP_440170.1_2 Reverse -318 -337 3.93269 0.296
NP_440170.1_5 Forward -306 -287 7.27595 0.144
NP_440671.1_4 Forward -302 -288 17.2075 0.0227
NP_442140.1_3 Reverse -275 -285 7.05986 0.152
NP_441813.1_5 Reverse -285 -295 4.20827 0.163
NP_442254.1_1 Forward -206 -187 1.37609 0.249
NP_439901.1_1 Reverse -113 -132 4.03102 0.237
NP_440567.1_1 Forward -72 -58 0.294584 0.25
NP_440227.1_10 Reverse -158 -177 10.4217 0.277
NP_442193.1_8 Reverse -284 -303 15.4366 0.211
NP_441874.1_1 Forward -299 -285 9.34103 0.277
NP_440354.1_5 Forward -76 -57 4.52268 0.212
NP_440391.1_7 Reverse -97 -116 6.98015 0.273
NP_440546.1_4 Forward -194 -184 8.30077 0.196
NP_440462.1_6 Reverse -285 -295 1.65166 0.294
NP_440868.1_4 Reverse -283 -295 2.39892 0.156
NP_440401.1_5 Reverse -359 -373 13.4709 0.296
NP_442499.1_1 Forward -301 -282 3.14605 0.264
NP_441084.1_6 Reverse -62 -76 9.63499 0.273
NP_442039.1_4 Forward -295 -288 7.80726 0.24
NP_441811.1_8 Forward -377 -363 7.57108 0.241
NP_442053.1_1 Reverse -287 -296 10.8161 0.0481
NP_440505.1_3 Forward -298 -288 5.68323 0.217
NP_442456.1_5 Forward -198 -180 5.82068 0.283
NP_441252.1_6 Forward -356 -349 11.9372 0.25
NP_440914.1_1 Reverse -287 -297 10.6645 0.129
NP_440914.1_1 Forward -194 -184 6.76087 0.267
NP_442533.1_6 Reverse -185 -194 4.0313 0.194
NP_442232.1_3 Forward -291 -272 -15.2418 0.289
NP_441482.1_7 Forward -302 -288 -11.2101 0.245
NP_439944.1_9 Reverse -288 -298 5.38824 0.254
NP_441028.1_6 Reverse -282 -292 5.78111 0.243
NP_441028.1_6 Forward -69 -59 3.8145 0.281
NP_440115.1_6 Reverse -61 -71 4.69992 0.288
NP_441286.1_1 Forward -297 -285 -5.66422 0.213
NP_442674.1_3 Forward -304 -285 7.17681 0.219
NP_440886.1_7 Reverse -286 -296 14.6309 0.0467
NP_440886.1_7 Reverse -184 -194 3.71617 0.267
NP_442264.1_2 Forward -306 -289 6.82368 0.25
NP_442794.1_1 Forward -300 -288 8.6921 0.0961
NP_440387.1_1 Forward -107 -91 -6.62797 0.298
NP_440634.1_10 Reverse -287 -306 7.4718 0.243
NP_440766.1_4 Forward -300 -286 20.0591 0.0255
NP_442930.1_1 Forward -33 -23 10.206 0.278
NP_440457.1_1 Forward -300 -288 1.02229 0.248
NP_442680.1_5 Reverse -305 -324 1.43989 0.243
NP_440142.1_7 Forward -171 -152 5.30933 0.296
NP_442509.1_9 Forward -296 -286 9.12434 0.192
NP_442514.1_5 Reverse -177 -196 -4.03287 0.238
NP_442737.1_5 Forward -303 -284 11.6185 0.284
NP_442341.1_7 Reverse -286 -300 4.42448 0.191
NP_442395.2_4 Reverse -286 -305 6.09517 0.151
NP_443060.1_2 Forward -300 -281 2.55606 0.226
NP_442495.1_4 Forward -195 -185 14.533 0.16
NP_441105.1_3 Forward -307 -288 -7.37537 0.251
NP_441064.1_4 Reverse -351 -370 21.6323 0.024
NP_442015.1_10 Reverse -239 -252 -0.472371 0.268
NP_441226.1_7 Reverse -186 -193 8.29857 0.205
NP_441766.1_2 Reverse -287 -296 10.9145 0.0211
NP_441766.1_9 Forward -310 -291 4.916 0.201
NP_440416.1_9 Forward -303 -284 -17.7985 0.247
NP_440416.1_9 Reverse -292 -311 -18.8801 0.266
NP_442403.1_8 Reverse -283 -302 -1.67217 0.258
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGAGTTAATCCTGCTACAACTGAGTTGGGATAATTCCGTAGACTGGGGCAAGTCCAAACAAAAGGGCACCATCTATTATGGCTTTTTACCCGATGCTGACCATGGAGATCGGGGTCAACTATGGCGGGGCACAACGAATTCCAACTTGGCTTTCCTAAGGGGTGATTATCATTTAGGTTCTGATGAATGTTTGACCCTAAATCTAGGGGATGGGGAGACTAGTTTAACGGAAAGGCATTGGTATGCTAGTCCTAATCTCCGACTCCGCACCAGTTTGATCCAGCAGGGAGAAGGTTATAGTCATAGTGCCTTCTATTCTGATATTCGTCGTTTGCCTCCGGCAGAGTAACAGTTATCAAGTACAAGTAATAATTATCCTCAACCCGAACCGATTATTCC

CDS

ATGGCATTTTTTAAAGAAGACCCGGCTTTGGGGGATATGGCCCAGGCTATTCTCGAAACTACTTGGCAAACTTTCCCCCAACTTCAGCGGGATCAAATTGCCTTGACTTGGTTGGTTTATGACGCTCCAGTGGTGGTTAATACCGGGGGGGCGATCGCCGCCAATGAGTTTTGGCAATATCCGGTGCGGGGTTTTAGTTATCGGGGCATTGAACGTATTTATCCCGCCAGTGTGGTGAAATTGTTTTACCTGGTGGCCATGGCGGAATGGTTGGAAGGAGGCATGGTGAATGATTCCCCGGAGTTGGACCGGGCCGTGCGGGATATGATTGTGGACTCCAGCAACGATGCCACTAGCTTAGTGGTAGATATACTCACTGGCACCAGCAGTGGGCCCATGTTACCCCCCGGACCCTTTGAAACTTGGCAGCAACAACGCAATATTGTGAACCGTTATTTTCAATCCTTGGGCTGGGAGGAGTTGCAGAATATTAATGTCAACCAAAAGACCTGGGGTGATGGTTACTATGGCCGGGAAAGGGCCTTTGTGGGGGAACTTTACGAACAGCGCAACATGTTAACCACCAATGCTGTGGCCAGGTTATTACACAGTATCATTGGCGGGGTGGCGGTGTCCTCAACCCGTTCCCAACAAATGATGCAATTACTTAAACGAGATTTAACGGCCGCTCCGGCTCCTTTGGGGGAAGATAACCAAATTACCGGTTTTCTCGGTGAACCATTGCCTAAAGATGCCCAAATGTGGTCTAAGGCCGGTTGGACCAGCCAGGTGCGCCATGATTGTGCCTACATTGAAATTCCCCACCAGAGTCCCTATCTTTTGGTGGTGTTCACGGAAAATTCTGCCCTCGCTGGCAATCGCCGCCTATTGCCGTTTATTTCCCAAGCCTTTGCCAATGCCCACTAA

Protein

MAFFKEDPALGDMAQAILETTWQTFPQLQRDQIALTWLVYDAPVVVNTGGAIAANEFWQYPVRGFSYRGIERIYPASVVKLFYLVAMAEWLEGGMVNDSPELDRAVRDMIVDSSNDATSLVVDILTGTSSGPMLPPGPFETWQQQRNIVNRYFQSLGWEELQNINVNQKTWGDGYYGRERAFVGELYEQRNMLTTNAVARLLHSIIGGVAVSSTRSQQMMQLLKRDLTAAPAPLGEDNQITGFLGEPLPKDAQMWSKAGWTSQVRHDCAYIEIPHQSPYLLVVFTENSALAGNRRLLPFISQAFANAH