Your browser is old and dusty. Try Google Chrome!

Details for sll0846

ORF sll0846
Accession NP_441124.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -357 -343 6.6861 0.115
NP_441061.1_2 Forward -282 -268 -1.8687 0.274
NP_441343.1_7 Forward -230 -211 0.392778 0.278
NP_440897.1_6 Reverse -43 -62 -2.65624 0.219
NP_440897.1_6 Forward -195 -176 -4.32786 0.273
NP_440561.1_1 Forward -302 -283 11.3067 0.249
NP_440226.1_1 Reverse -288 -307 5.70265 0.148
NP_442975.1_10 Reverse -284 -298 3.14559 0.263
NP_440784.1_7 Forward -133 -126 7.51227 0.138
NP_440928.1_5 Reverse -94 -112 11.8189 0.16
NP_442062.1_8 Forward -297 -287 7.94484 0.0848
NP_442062.1_8 Reverse -288 -298 5.28991 0.176
NP_442581.1_1 Forward -264 -250 7.47274 0.264
NP_440304.1_4 Forward -141 -131 11.7798 0.051
NP_442097.1_1 Reverse -30 -49 4.52268 0.187
NP_442602.1_3 Forward -76 -57 -1.7705 0.246
NP_441208.1_1 Reverse -3 -22 -6.88371 0.296
NP_441208.1_9 Forward -70 -56 4.91614 0.282
NP_441594.1_6 Forward -210 -191 5.60432 0.209
NP_441594.1_6 Reverse -50 -69 3.83436 0.225
NP_441594.1_6 Reverse -279 -298 2.45773 0.251
NP_441925.1_4 Forward -284 -265 -14.2592 0.261
NP_440273.1_3 Reverse -76 -95 13.9625 0.0788
NP_441083.1_3 Forward -292 -282 14.8275 0.15
NP_441083.1_5 Forward -201 -191 2.63497 0.193
NP_441083.1_5 Reverse -288 -298 1.06167 0.218
NP_442115.2_4 Reverse -184 -203 7.57013 0.28
NP_441434.1_3 Forward -90 -71 -0.4922 0.233
NP_440209.1_1 Forward -297 -289 5.0343 0.194
NP_442889.1_1 Reverse -63 -82 -15.2418 0.288
NP_442889.1_8 Reverse -285 -299 11.602 0.0733
NP_440056.1_1 Forward -290 -271 7.47261 0.297
NP_440178.1_7 Reverse -162 -181 -21.24 0.215
NP_441624.1_7 Reverse -199 -213 11.5043 0.201
NP_441495.1_6 Forward -48 -31 22.36 0.0314
NP_440747.1_10 Forward -300 -288 -4.77924 0.117
NP_441486.1_1 Reverse -285 -299 -5.50694 0.242
NP_442634.1_4 Forward -141 -127 -0.688726 0.149
NP_441014.1_8 Forward -101 -82 -1.86883 0.224
NP_441014.1_10 Forward -298 -279 14.3549 0.0782
NP_441182.1_3 Reverse -182 -200 14.0805 0.241
NP_440376.1_1 Forward -297 -288 6.19458 0.109
NP_440376.1_1 Reverse -99 -108 3.34298 0.206
NP_440376.1_1 Reverse -288 -297 0.0980582 0.285
NP_442687.1_7 Reverse -287 -297 6.8632 0.151
NP_442687.1_7 Forward -248 -238 4.69992 0.238
NP_441077.1_6 Forward -260 -244 6.94736 0.234
NP_441013.1_3 Reverse -163 -182 8.45592 0.243
NP_440691.1_10 Forward -64 -45 8.06259 0.269
NP_442658.1_1 Forward -141 -131 5.48612 0.265
NP_441971.1_10 Forward -73 -54 16.6174 0.137
NP_442782.1_2 Reverse -75 -89 0.196253 0.293
NP_440656.1_8 Forward -234 -215 -8.85033 0.273
NP_443061.1_3 Reverse -280 -299 19.764 0.193
NP_441487.1_9 Reverse -287 -306 1.96607 0.194
NP_441256.1_1 Forward -280 -261 3.34271 0.124
NP_442937.1_5 Forward -302 -283 16.7157 0.0411
NP_441958.1_5 Reverse -287 -297 -6.90313 0.293
NP_442836.1_10 Reverse -69 -79 14.7297 0.212
NP_440203.1_5 Reverse -133 -143 9.12434 0.271
NP_439990.1_5 Reverse -116 -129 7.49244 0.194
NP_440858.1_5 Reverse -103 -122 9.43841 0.272
NP_443055.1_6 Reverse -192 -210 -0.276578 0.256
NP_443055.1_6 Reverse -131 -149 -1.6532 0.281
NP_443055.1_6 Forward -305 -287 -2.63651 0.298
NP_440993.1_4 Reverse -180 -197 4.75873 0.272
NP_440827.1_3 Forward -369 -350 12.1925 0.26
NP_442210.1_5 Reverse -274 -293 20.649 0.143
NP_442210.1_9 Reverse -89 -107 12.3105 0.209
NP_442853.1_6 Forward -123 -104 18.4238 0.155
NP_442002.1_1 Reverse -67 -85 -3.6191 0.212
NP_442002.1_9 Reverse -287 -294 9.08556 0.289
NP_441646.1_1 Reverse -124 -143 4.71934 0.189
NP_441646.1_1 Reverse -92 -111 -0.590531 0.269
NP_441125.1_6 Reverse -14 -27 18.8988 0.109
NP_441125.1_9 Reverse -84 -103 21.828 0.0502
NP_441125.1_10 Reverse -57 -71 19.7641 0.156
NP_441916.1_7 Forward -297 -287 5.78156 0.12
NP_441916.1_10 Forward -360 -341 3.34271 0.236
NP_441916.1_10 Forward -141 -122 2.94938 0.236
NP_440206.1_4 Reverse -181 -200 0.195343 0.289
NP_441041.1_8 Forward -273 -254 16.9494 0.184
NP_442396.1_5 Forward -301 -288 6.50913 0.234
NP_441725.1_5 Reverse -131 -141 4.89658 0.115
NP_441725.1_5 Forward -296 -286 -0.118297 0.232
NP_439966.1_7 Reverse -286 -296 4.89613 0.254
NP_440736.1_3 Reverse -183 -202 7.07928 0.206
NP_440260.1_8 Reverse -78 -96 -2.43913 0.243
NP_440260.1_8 Forward -143 -125 -6.1757 0.287
NP_441514.1_1 Forward -307 -297 13.2946 0.299
NP_442281.1_1 Reverse -283 -297 2.5556 0.263
NP_441079.1_7 Forward -33 -14 -0.984623 0.2
NP_440177.1_9 Forward -305 -286 14.9458 0.199
NP_441087.1_6 Reverse -198 -216 0.608397 0.258
NP_441556.1_10 Forward -113 -99 11.3899 0.227
NP_442215.1_2 Reverse -340 -356 -5.84132 0.26
NP_442029.1_10 Forward -63 -44 5.70265 0.284
NP_442933.1_10 Forward -297 -288 5.40793 0.19
NP_442554.1_8 Reverse -131 -141 4.0116 0.2
NP_442313.1_4 Reverse -94 -113 6.29264 0.288
NP_442292.1_1 Reverse -289 -298 -0.786921 0.287
NP_440919.1_7 Reverse -82 -100 10.9461 0.171
NP_443009.1_5 Forward -298 -287 4.67974 0.234
NP_440881.1_4 Reverse -44 -63 0.392778 0.226
NP_440881.1_4 Reverse -45 -64 -0.885524 0.265
NP_440730.1_4 Forward -68 -49 -2.75381 0.297
NP_441015.1_8 Forward -195 -176 0.884433 0.272
NP_441015.1_10 Forward -219 -200 -4.81876 0.212
NP_441673.1_1 Reverse -288 -297 1.37636 0.114
NP_441673.1_1 Forward -297 -288 1.1797 0.163
NP_441339.1_4 Reverse -124 -143 3.24438 0.204
NP_442253.1_3 Forward -303 -289 18.3557 0.179
NP_442253.1_5 Forward -143 -126 0.727158 0.203
NP_441826.1_2 Reverse -186 -200 0.392915 0.187
NP_441826.1_2 Reverse -124 -138 -3.147 0.283
NP_441330.1_1 Forward -302 -283 -14.0619 0.212
NP_442490.1_9 Reverse -276 -295 0.196116 0.175
NP_441612.1_2 Forward -184 -174 8.83972 0.21
NP_443058.1_7 Forward -151 -132 3.34271 0.263
NP_442808.1_1 Forward -11 -1 6.0761 0.131
NP_442808.1_1 Forward -55 -45 5.38779 0.155
NP_440145.1_3 Forward -307 -288 0.58944 0.135
NP_442050.1_5 Reverse -347 -357 7.25606 0.265
NP_440558.1_2 Forward -143 -124 3.83436 0.153
NP_440558.1_2 Reverse -165 -184 2.0644 0.173
NP_440558.1_2 Reverse -127 -146 -2.16383 0.223
NP_440558.1_2 Reverse -176 -195 -4.6221 0.247
NP_441878.1_6 Forward -140 -130 -7.49312 0.231
NP_441878.1_6 Forward -298 -288 -7.68978 0.255
NP_441036.1_3 Reverse -10 -29 8.75091 0.119
NP_441036.1_8 Reverse -287 -297 6.96153 0.213
NP_442650.1_2 Forward -370 -356 2.35953 0.277
NP_441557.1_5 Reverse -288 -297 0.491382 0.144
NP_441557.1_5 Forward -297 -288 0.29472 0.174
NP_440084.1_8 Forward -32 -18 13.5715 0.223
NP_440101.1_10 Reverse -69 -88 12.0942 0.137
NP_441458.1_10 Reverse -279 -298 10.7175 0.123
NP_441458.1_10 Reverse -90 -109 5.01433 0.224
NP_442183.1_1 Forward -297 -283 6.78443 0.161
NP_439936.1_3 Forward -179 -160 15.6341 0.253
NP_442645.1_2 Forward -305 -286 -5.99873 0.0788
NP_442508.1_8 Forward -377 -360 8.7903 0.297
NP_440136.1_1 Reverse -101 -117 11.4642 0.238
NP_442590.1_9 Reverse -37 -56 5.80098 0.267
NP_442590.1_10 Reverse -192 -211 3.14605 0.295
NP_442998.1_10 Forward -295 -288 12.5271 0.0457
NP_440899.1_1 Forward -206 -187 12.3111 0.148
NP_440299.1_1 Reverse -284 -297 7.49186 0.112
NP_440299.1_1 Forward -295 -282 5.0336 0.191
NP_442334.1_2 Forward -217 -200 -13.6292 0.297
NP_442333.2_1 Reverse -128 -147 -5.31042 0.25
NP_440256.1_1 Forward -300 -281 2.55606 0.0625
NP_441559.1_8 Reverse -126 -140 -4.32697 0.222
NP_442158.1_4 Reverse -223 -233 15.3197 0.17
NP_441113.1_3 Reverse -9 -23 14.1586 0.295
NP_440306.1_8 Forward -27 -8 2.75194 0.204
NP_442386.1_9 Forward -365 -356 7.47246 0.219
NP_442386.1_10 Forward -150 -137 5.42749 0.262
NP_440570.1_5 Reverse -89 -108 -3.44213 0.289
NP_441750.1_4 Forward -59 -40 0.786102 0.291
NP_441750.1_7 Reverse -2 -12 12.9597 0.278
NP_441340.1_9 Forward -308 -298 9.60492 0.236
NP_441271.1_3 Forward -243 -225 15.358 0.143
NP_440327.1_6 Forward -381 -362 11.7008 0.177
NP_439976.1_4 Forward -60 -41 4.62021 0.28
NP_442240.1_2 Forward -296 -277 -17.0118 0.254
NP_442251.1_6 Forward -296 -289 8.69224 0.199
NP_440192.1_4 Reverse -128 -147 9.00952 0.287
NP_440027.1_3 Forward -140 -122 4.14829 0.262
NP_439984.1_10 Forward -61 -47 13.5686 0.186
NP_439937.1_9 Reverse -129 -146 -9.7949 0.209
NP_439937.1_9 Forward -243 -226 -17.0714 0.291
NP_442294.1_3 Forward -70 -56 14.0603 0.249
NP_443039.1_7 Forward -383 -369 7.3738 0.19
NP_440408.1_7 Forward -214 -195 14.6508 0.165
NP_440171.1_3 Reverse -43 -62 1.86774 0.293
NP_440316.1_10 Reverse -46 -56 9.02648 0.236
NP_441018.1_7 Reverse -89 -108 10.7175 0.199
NP_440344.1_10 Reverse -281 -298 -6.64766 0.114
NP_440282.1_10 Reverse -188 -207 -8.16202 0.26
NP_440531.1_6 Reverse -39 -58 -2.85214 0.258
NP_440531.1_8 Reverse -271 -290 3.53937 0.269
NP_440189.1_2 Reverse -30 -49 2.65439 0.268
NP_442693.1_7 Reverse -173 -192 8.75091 0.266
NP_440350.1_5 Reverse -323 -342 -6.78538 0.297
NP_440888.1_2 Reverse -355 -369 8.25877 0.167
NP_440888.1_2 Forward -297 -283 6.68548 0.223
NP_440888.1_2 Reverse -200 -214 5.1122 0.293
NP_440803.1_3 Forward -68 -49 8.65258 0.201
NP_442277.1_2 Reverse -203 -217 12.3893 0.257
NP_440575.1_1 Forward -25 -6 3.83357 0.253
NP_441543.1_2 Reverse -289 -298 5.99792 0.159
NP_442845.1_2 Forward -201 -187 4.12949 0.267
NP_441304.1_10 Reverse -371 -380 12.6844 0.294
NP_440889.1_4 Forward -361 -342 9.14423 0.186
NP_442204.1_1 Reverse -66 -77 0.0586712 0.284
NP_440544.1_5 Reverse -255 -262 14.5681 0.264
NP_442872.1_1 Forward -237 -218 -2.55715 0.205
NP_440516.1_6 Reverse -205 -219 8.55376 0.246
NP_442428.1_4 Forward -53 -34 6.4893 0.197
NP_440618.1_1 Reverse -52 -71 -10.3253 0.297
NP_440673.1_3 Forward -295 -288 9.77388 0.167
NP_441714.1_3 Forward -164 -146 15.7513 0.138
NP_440718.1_2 Forward -119 -100 16.9124 0.18
NP_441052.1_2 Reverse -288 -298 7.15819 0.0797
NP_441052.1_2 Forward -172 -162 1.65166 0.233
NP_442219.1_9 Reverse -356 -365 2.75299 0.233
NP_440436.1_4 Forward -296 -287 5.30919 0.209
NP_442414.1_8 Forward -61 -42 18.1907 0.0564
NP_441719.1_4 Reverse -289 -296 3.77569 0.285
NP_442366.1_3 Reverse -347 -365 -5.88071 0.298
NP_440094.1_9 Forward -298 -279 -1.08219 0.199
NP_443054.1_2 Forward -56 -42 -0.492064 0.295
NP_441851.1_9 Reverse -47 -66 9.14423 0.248
NP_441851.1_10 Forward -298 -288 4.3066 0.277
NP_441668.1_4 Forward -307 -288 -0.197208 0.249
NP_441396.1_5 Reverse -227 -236 18.0926 0.141
NP_440593.1_3 Reverse -350 -369 0.884433 0.193
NP_441982.1_6 Reverse -380 -389 13.3448 0.274
NP_441046.1_2 Forward -119 -100 1.27776 0.257
NP_441661.1_3 Reverse -72 -89 0.530496 0.226
NP_440726.1_2 Reverse -182 -201 -0.295539 0.295
NP_441477.1_10 Reverse -185 -203 8.37728 0.181
NP_441124.1_2 Forward -69 -52 19.9009 0.0809
NP_441124.1_5 Forward -308 -298 14.2496 0.215
NP_442006.1_2 Reverse -139 -156 -18.0541 0.287
NP_442006.1_2 Forward -148 -131 -18.1524 0.288
NP_441003.1_9 Reverse -121 -140 4.03102 0.29
NP_441078.1_4 Forward -108 -99 3.53964 0.136
NP_441078.1_4 Reverse -288 -297 0.688044 0.164
NP_441078.1_4 Forward -297 -288 0.491382 0.188
NP_442729.1_8 Forward -94 -81 5.13249 0.263
NP_440539.1_9 Forward -100 -81 -3.24547 0.286
NP_440793.1_1 Forward -22 -8 8.65209 0.295
NP_441432.1_3 Forward -119 -100 10.815 0.275
NP_441432.1_8 Forward -184 -175 2.55633 0.298
NP_442320.1_8 Reverse -282 -296 -3.93365 0.136
NP_441732.1_2 Forward -71 -55 -16.4611 0.167
NP_441732.1_2 Reverse -95 -111 -16.6577 0.186
NP_440497.1_6 Reverse -64 -83 -6.29373 0.264
NP_440290.1_1 Forward -35 -26 15.65 0.292
NP_440760.1_1 Reverse -288 -307 -13.5702 0.107
NP_442797.1_7 Reverse -67 -85 1.19912 0.262
NP_442489.1_7 Forward -297 -288 14.7494 0.00484
NP_442489.1_7 Reverse -288 -297 0.688044 0.152
NP_440559.1_1 Reverse -289 -298 11.1111 0.0586
NP_442763.1_8 Reverse -39 -58 8.25926 0.159
NP_441040.1_2 Reverse -85 -104 -9.24366 0.236
NP_440708.1_6 Reverse -89 -108 -10.6203 0.282
NP_442346.1_5 Reverse -281 -291 4.89658 0.269
NP_440545.1_3 Forward -143 -126 3.67709 0.0804
NP_440545.1_3 Reverse -126 -143 -5.56602 0.253
NP_442828.1_7 Reverse -43 -62 -2.0655 0.276
NP_441948.1_4 Reverse -38 -56 2.0841 0.128
NP_441502.1_1 Forward -112 -93 19.0748 0.0979
NP_441502.1_3 Forward -366 -347 4.42435 0.299
NP_442799.1_2 Reverse -197 -216 -0.688862 0.289
NP_440671.1_4 Reverse -186 -200 5.1128 0.292
NP_440224.1_5 Forward -37 -18 18.0924 0.0862
NP_442073.1_6 Forward -154 -135 7.66927 0.193
NP_442021.1_3 Reverse -81 -100 -6.98204 0.261
NP_440875.1_9 Forward -192 -182 7.30133 0.269
NP_440875.1_9 Reverse -202 -212 7.00932 0.287
NP_440821.1_4 Reverse -286 -296 -0.41329 0.257
NP_441239.1_9 Reverse -128 -140 7.02048 0.173
NP_441951.1_6 Forward -280 -261 9.53756 0.258
NP_442691.1_2 Forward -116 -97 20.944 0.0161
NP_441727.1_8 Reverse -271 -290 4.916 0.197
NP_440665.1_1 Reverse -256 -275 -14.1602 0.261
NP_440665.1_2 Reverse -92 -111 -1.96717 0.211
NP_441017.1_6 Reverse -284 -298 16.7152 0.0651
NP_441017.1_8 Reverse -235 -250 12.3696 0.188
NP_442629.1_5 Reverse -224 -238 17.7975 0.142
NP_441526.1_8 Reverse -259 -278 6.39097 0.277
NP_442138.1_9 Forward -90 -71 10.4217 0.21
NP_440391.1_7 Reverse -342 -361 9.53674 0.228
NP_442809.1_1 Forward -382 -363 9.34008 0.299
NP_442809.1_6 Reverse -276 -295 1.37609 0.272
NP_440546.1_2 Reverse -81 -100 14.4541 0.219
NP_441509.1_2 Reverse -60 -78 7.98396 0.245
NP_440462.1_4 Reverse -261 -275 8.35772 0.265
NP_440462.1_6 Reverse -286 -296 2.43831 0.287
NP_442611.1_1 Reverse -33 -52 1.57275 0.236
NP_441672.1_6 Reverse -197 -216 9.04509 0.294
NP_440812.1_10 Reverse -228 -241 12.3107 0.259
NP_442402.1_4 Reverse -245 -264 -5.60616 0.245
NP_440653.1_10 Reverse -277 -296 6.19431 0.217
NP_442053.1_1 Forward -297 -288 6.48957 0.13
NP_440914.1_1 Forward -183 -173 7.24882 0.242
NP_442533.1_1 Reverse -40 -59 -9.44032 0.223
NP_442533.1_6 Reverse -180 -189 3.34298 0.216
NP_442541.1_10 Reverse -130 -144 1.37564 0.287
NP_442232.1_3 Reverse -122 -141 -11.2103 0.281
NP_443016.1_1 Forward -195 -176 -2.65548 0.225
NP_441482.1_7 Reverse -282 -296 -1.77037 0.0823
NP_442269.1_10 Reverse -271 -290 3.53937 0.248
NP_441028.1_6 Reverse -135 -145 13.5492 0.158
NP_441028.1_6 Reverse -84 -94 10.4026 0.203
NP_441028.1_6 Forward -62 -52 6.27276 0.23
NP_441028.1_6 Forward -16 -6 6.27276 0.23
NP_441028.1_6 Forward -17 -7 5.97777 0.234
NP_441028.1_6 Reverse -301 -311 4.89613 0.275
NP_441028.1_6 Forward -61 -51 4.30615 0.278
NP_440007.1_9 Reverse -264 -278 3.93283 0.267
NP_440007.1_9 Reverse -182 -196 1.27789 0.289
NP_441602.1_4 Forward -279 -260 8.55425 0.288
NP_439903.1_6 Reverse -189 -208 0.686995 0.258
NP_441286.1_1 Forward -298 -286 -5.17256 0.192
NP_442674.1_3 Forward -48 -29 12.1917 0.174
NP_440670.1_8 Forward -297 -288 5.89959 0.131
NP_440886.1_7 Reverse -287 -297 5.58445 0.175
NP_442614.1_2 Reverse -56 -70 8.75105 0.248
NP_440404.1_9 Forward -262 -243 13.5117 0.2
NP_442264.1_2 Reverse -278 -295 16.0668 0.122
NP_441463.1_3 Reverse -164 -183 -6.39206 0.245
NP_441962.1_4 Forward -144 -125 -5.40875 0.168
NP_440387.1_1 Reverse -288 -304 2.02515 0.0896
NP_440387.1_1 Forward -297 -281 -5.15301 0.217
NP_441431.1_2 Reverse -182 -196 8.3571 0.218
NP_441836.1_2 Reverse -270 -289 -5.60541 0.284
NP_441993.1_1 Reverse -199 -218 0.972113 0.288
NP_442084.1_6 Reverse -29 -47 4.44404 0.294
NP_441174.1_1 Forward -148 -133 17.3845 0.231
NP_440814.1_8 Forward -189 -170 0.491109 0.269
NP_442323.1_7 Reverse -187 -206 2.75194 0.262
NP_441510.2_2 Reverse -126 -145 9.04509 0.182
NP_440287.1_6 Forward -159 -140 3.53937 0.219
NP_440293.1_3 Forward -196 -177 -6.1954 0.287
NP_441531.1_6 Forward -274 -261 10.1474 0.254
NP_442867.1_8 Forward -382 -363 4.62101 0.278
NP_442278.1_4 Forward -121 -102 20.4523 0.0765
NP_440457.1_1 Reverse -1 -13 4.75886 0.154
NP_440798.1_2 Forward -238 -224 19.2718 0.145
NP_441332.1_6 Reverse -140 -150 12.1308 0.236
NP_441332.1_6 Forward -12 -2 11.9372 0.239
NP_442582.1_3 Forward -268 -254 13.5715 0.27
NP_442514.1_5 Forward -197 -178 -4.03287 0.238
NP_442514.1_5 Reverse -353 -372 -8.45774 0.285
NP_441159.1_1 Reverse -149 -168 -3.44213 0.286
NP_441885.1_5 Reverse -288 -298 2.33998 0.0799
NP_441885.1_5 Forward -108 -98 -1.78992 0.284
NP_442341.1_7 Forward -298 -284 11.0127 0.0591
NP_442341.1_9 Forward -211 -197 5.80051 0.255
NP_441756.1_5 Forward -58 -39 9.24257 0.128
NP_441173.1_9 Forward -387 -379 12.9004 0.206
NP_440507.2_3 Forward -300 -281 7.57013 0.274
NP_440552.1_8 Forward -396 -379 12.6571 0.226
NP_441561.1_4 Reverse -183 -202 8.55425 0.202
NP_441902.1_1 Reverse -247 -266 9.7334 0.282
NP_441902.1_1 Forward -71 -52 9.7334 0.282
NP_442451.1_2 Reverse -123 -142 -11.2103 0.287
NP_440175.1_7 Reverse -89 -107 8.77756 0.288
NP_440149.1_8 Forward -297 -278 -6.29373 0.246
NP_441105.1_3 Forward -113 -94 -1.27885 0.147
NP_441105.1_3 Forward -375 -356 -7.86702 0.261
NP_440216.1_9 Forward -187 -178 11.3078 0.269
NP_440216.1_9 Forward -100 -91 5.50626 0.292
NP_440172.1_1 Reverse -288 -298 2.04498 0.286
NP_442371.1_1 Forward -264 -254 16.9908 0.125
NP_442379.1_3 Forward -114 -100 19.2725 0.202
NP_443052.1_9 Forward -57 -38 4.916 0.149
NP_442154.1_1 Reverse -39 -57 -15.5171 0.22
NP_442226.1_8 Reverse -26 -36 16.6963 0.164
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCGCTAGGATTTTTAACCAATTCCACTTTGCGGTAGGAAACGCGAATGGAATAGTCAAATAAATGACTCAGAAAAGGACTAGCAGTAACGTAGGAAAATTTGTCGATTGCCGTAGCTAGAACCGCACCACCATGCTGGAGAAAATACTCAGGATAATCGGTTCCCCCACCAAAAAAACTAATGCGGACAGGGGCACGGGAAATCAGCATGGGCCTGGCAAAGACAAGGTTAACGACAGATACATTATTGCCGACTGGGGGGCAATGTCAGCGCTCAAAAGAGAAACTGCTGGCTAAACCCAAGGCTAGAGGGAAATCCGTCCCCAAGCCTGGGAGTTTTCCCCCCCGGAGCCCCCATTGGATCTGCCAAAATTAAATTGTTCTTTCCCCCCGCACCCC

CDS

ATGAAATTTTCCCTCGAGTCTCTCTATGGTTGGTACCGTCAAATGCTGAACCATCCCCGGTACCGTTGGTGGATTGTCCTCGGCTCCTTGGTGTATCTCCTCAGTCCCATCGATTTTCTGCCCGACGTTTTCCCCGTACTTGGTTGGATTGACGATGGTTTAATTGCCACTTTGCTGGTATCGGAAATTTCCCAAATGGTTCTCACTGGCTTAAAAAACAAGACAACCAAGCAGGAAAAGGATGCCCCCCAGGAAACCGTGGTGGTGGATGTGGTGGATGTGGTGGGACAGGACGTGGCCCACAGTTAA

Protein

MKFSLESLYGWYRQMLNHPRYRWWIVLGSLVYLLSPIDFLPDVFPVLGWIDDGLIATLLVSEISQMVLTGLKNKTTKQEKDAPQETVVVDVVDVVGQDVAHS