Your browser is old and dusty. Try Google Chrome!

Details for sll0839

ORF sll0839
Accession NP_441132.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -75 -89 15.4376 0.104
NP_442711.1_1 Reverse -107 -121 13.6676 0.166
NP_442711.1_1 Forward -84 -70 12.0943 0.222
NP_441061.1_2 Forward -260 -246 11.701 0.0507
NP_441061.1_2 Forward -380 -366 10.521 0.0605
NP_441061.1_2 Forward -83 -69 7.86607 0.0956
NP_441061.1_2 Reverse -306 -320 4.81781 0.143
NP_441061.1_2 Reverse -76 -90 2.45787 0.176
NP_441061.1_2 Reverse -238 -252 0.786239 0.199
NP_441061.1_2 Forward -89 -75 0.196253 0.215
NP_440557.1_1 Reverse -76 -95 1.47442 0.256
NP_440795.1_7 Forward -313 -306 14.6904 0.0123
NP_440795.1_7 Reverse -306 -313 14.6904 0.0123
NP_440795.1_7 Forward -83 -76 14.6904 0.0123
NP_440795.1_7 Reverse -76 -83 14.6904 0.0123
NP_441418.1_6 Forward -84 -65 -1.18052 0.0125
NP_441418.1_6 Reverse -75 -94 -18.4868 0.0832
NP_441418.1_6 Reverse -305 -324 -29.5982 0.23
NP_440815.1_5 Forward -314 -295 8.25926 0.237
NP_442291.1_5 Forward -315 -299 15.6932 0.0222
NP_442291.1_5 Reverse -304 -320 -4.46469 0.276
NP_441453.1_1 Reverse -68 -86 6.99988 0.221
NP_441453.1_1 Forward -91 -73 4.14829 0.263
NP_441453.1_4 Reverse -305 -313 16.539 0.00633
NP_441453.1_4 Reverse -75 -83 16.539 0.00633
NP_441453.1_4 Forward -314 -306 16.539 0.00633
NP_441453.1_4 Forward -84 -76 16.539 0.00633
NP_441453.1_4 Forward -375 -367 4.34598 0.257
NP_441453.1_4 Reverse -366 -374 4.24765 0.259
NP_441453.1_4 Reverse -246 -254 4.24765 0.259
NP_441623.1_1 Forward -366 -348 -3.6191 0.262
NP_442151.1_6 Reverse -305 -319 17.2075 0.0113
NP_442151.1_6 Forward -84 -70 12.4876 0.0722
NP_442151.1_6 Forward -116 -102 8.94771 0.162
NP_442151.1_6 Forward -314 -300 8.55439 0.171
NP_442151.1_6 Reverse -75 -89 7.17775 0.206
NP_442151.1_6 Reverse -246 -260 5.1128 0.294
NP_440561.1_4 Reverse -364 -383 13.6968 0.229
NP_441818.1_1 Forward -313 -302 18.446 0.0046
NP_441818.1_1 Reverse -306 -317 10.1862 0.232
NP_441818.1_9 Reverse -358 -377 -10.817 0.299
NP_440226.1_1 Reverse -305 -324 6.98095 0.115
NP_441465.1_8 Reverse -64 -82 7.78729 0.235
NP_441630.1_3 Reverse -297 -316 1.96607 0.235
NP_442623.1_3 Forward -83 -64 -18.4868 0.263
NP_440996.1_3 Forward -70 -52 11.6222 0.222
NP_442655.1_1 Reverse -300 -319 1.37609 0.238
NP_442655.1_1 Reverse -70 -89 0.0977854 0.24
NP_442173.1_1 Forward -313 -305 15.4574 0.00633
NP_442173.1_1 Forward -83 -75 15.4574 0.00633
NP_442173.1_1 Reverse -306 -314 15.4574 0.00633
NP_442173.1_1 Reverse -76 -84 15.4574 0.00633
NP_442752.1_4 Forward -314 -307 13.8055 0.0199
NP_442752.1_4 Reverse -305 -312 13.8055 0.0199
NP_442752.1_4 Forward -84 -77 13.8055 0.0199
NP_442752.1_4 Reverse -75 -82 13.8055 0.0199
NP_442752.1_4 Forward -116 -109 4.26735 0.293
NP_443027.1_4 Reverse -73 -83 13.943 0.0452
NP_443027.1_4 Forward -86 -76 13.2547 0.0521
NP_443027.1_4 Reverse -303 -313 11.0914 0.107
NP_443027.1_4 Forward -118 -108 8.4365 0.202
NP_443027.1_4 Forward -377 -367 7.25653 0.24
NP_441745.1_3 Forward -258 -239 13.7649 0.282
NP_441812.1_3 Forward -171 -157 9.2427 0.245
NP_442975.1_10 Reverse -71 -85 21.6317 0.000774
NP_442975.1_10 Forward -318 -304 11.2087 0.0508
NP_442975.1_10 Reverse -301 -315 4.32555 0.245
NP_440784.1_7 Forward -313 -306 15.9687 0.0123
NP_440784.1_7 Reverse -306 -313 15.9687 0.0123
NP_440784.1_7 Forward -83 -76 15.9687 0.0123
NP_440784.1_7 Reverse -76 -83 15.9687 0.0123
NP_442909.1_7 Reverse -306 -320 13.5686 0.12
NP_442909.1_7 Forward -142 -128 10.8154 0.131
NP_441934.1_8 Reverse -243 -262 17.6007 0.188
NP_441250.1_3 Forward -68 -49 14.4541 0.131
NP_442289.1_4 Forward -107 -91 11.6616 0.249
NP_440061.1_9 Forward -316 -302 12.487 0.0964
NP_440061.1_9 Forward -377 -363 10.3237 0.126
NP_440061.1_9 Reverse -116 -130 8.25877 0.177
NP_440110.1_8 Reverse -73 -92 2.0644 0.211
NP_441054.1_1 Forward -321 -307 14.2576 0.231
NP_441054.1_2 Reverse -278 -297 9.14423 0.299
NP_441476.1_5 Reverse -70 -89 -1.18052 0.2
NP_441476.1_5 Forward -89 -70 -7.67036 0.29
NP_440878.1_4 Reverse -98 -116 10.9339 0.29
NP_442062.1_8 Forward -84 -74 19.4496 0.000558
NP_442062.1_8 Forward -314 -304 17.3846 0.00193
NP_442062.1_8 Reverse -305 -315 17.3846 0.00193
NP_442062.1_8 Reverse -75 -85 10.3048 0.0493
NP_442062.1_8 Forward -116 -106 5.19158 0.181
NP_440761.1_4 Reverse -70 -89 -13.7669 0.257
NP_441859.1_3 Forward -85 -66 8.16011 0.144
NP_441859.1_5 Reverse -290 -309 10.0292 0.21
NP_440304.1_4 Forward -86 -76 10.8948 0.051
NP_440304.1_4 Reverse -73 -83 9.91146 0.051
NP_440304.1_4 Reverse -364 -374 6.76487 0.146
NP_440304.1_4 Reverse -328 -338 6.17489 0.174
NP_440304.1_4 Reverse -356 -366 4.3066 0.271
NP_440304.1_4 Forward -316 -306 1.84832 0.299
NP_440304.1_4 Reverse -303 -313 1.84832 0.299
NP_442242.1_4 Forward -313 -306 14.3954 0.0124
NP_442242.1_4 Reverse -306 -313 14.3954 0.0124
NP_442242.1_4 Forward -83 -76 14.3954 0.0124
NP_442242.1_4 Reverse -76 -83 14.3954 0.0124
NP_440044.1_8 Forward -83 -64 4.42435 0.114
NP_440044.1_8 Reverse -306 -325 3.34271 0.132
NP_441035.1_3 Forward -216 -197 3.93269 0.227
NP_441581.1_6 Forward -122 -103 13.7525 0.283
NP_440916.1_1 Reverse -60 -74 13.5693 0.206
NP_441200.1_6 Reverse -180 -197 10.3636 0.285
NP_441935.1_1 Forward -136 -117 9.14423 0.225
NP_441619.1_8 Forward -320 -306 10.1271 0.189
NP_440893.1_3 Reverse -294 -313 0.588665 0.273
NP_441208.1_9 Reverse -104 -118 8.65272 0.219
NP_441208.1_9 Forward -87 -73 8.16106 0.219
NP_441208.1_9 Reverse -72 -86 5.99778 0.254
NP_441208.1_9 Forward -317 -303 4.52282 0.299
NP_441594.1_6 Forward -93 -74 9.14423 0.146
NP_441594.1_6 Reverse -66 -85 8.94757 0.152
NP_441594.1_6 Forward -323 -304 4.03102 0.223
NP_441594.1_6 Forward -125 -106 2.94938 0.239
NP_442196.1_10 Forward -86 -67 25.6638 0.00566
NP_440132.1_1 Reverse -73 -91 14.8671 0.117
NP_440132.1_1 Reverse -244 -262 12.0155 0.198
NP_442110.1_7 Reverse -75 -89 12.0943 0.0586
NP_442110.1_7 Forward -84 -70 10.226 0.0684
NP_442110.1_7 Reverse -305 -319 9.63603 0.0715
NP_441925.1_4 Forward -374 -355 -15.0459 0.263
NP_440856.1_4 Forward -91 -72 7.27595 0.0705
NP_440856.1_4 Forward -382 -363 -0.983855 0.189
NP_440856.1_7 Forward -236 -217 -7.27704 0.249
NP_441083.1_5 Forward -314 -304 20.3345 0.00053
NP_441083.1_5 Reverse -305 -315 20.3345 0.00053
NP_441083.1_5 Forward -84 -74 11.3864 0.0159
NP_441083.1_5 Reverse -75 -85 11.2881 0.0159
NP_441083.1_5 Forward -116 -106 8.23984 0.0429
NP_442827.1_8 Reverse -67 -86 2.26028 0.164
NP_442827.1_8 Forward -92 -73 -0.0996487 0.218
NP_441434.1_7 Forward -82 -68 5.40779 0.225
NP_440645.1_6 Reverse -8 -27 12.7825 0.228
NP_441738.1_2 Forward -312 -305 15.28 0.0102
NP_441738.1_2 Reverse -307 -314 15.28 0.0102
NP_441738.1_2 Forward -82 -75 15.28 0.0102
NP_441738.1_2 Reverse -77 -84 15.28 0.0102
NP_441738.1_4 Forward -324 -305 16.6174 0.0727
NP_441558.1_5 Forward -86 -67 13.0775 0.0626
NP_441558.1_5 Reverse -303 -322 3.93269 0.294
NP_441942.1_7 Reverse -362 -381 11.2092 0.282
NP_440209.1_1 Reverse -305 -313 18.1123 0.00295
NP_440209.1_1 Reverse -75 -83 18.1123 0.00295
NP_440209.1_1 Forward -314 -306 18.1123 0.00295
NP_440209.1_1 Forward -84 -76 18.1123 0.00295
NP_440209.1_1 Reverse -107 -115 5.0343 0.194
NP_442889.1_8 Reverse -302 -316 14.4536 0.0523
NP_442889.1_8 Forward -119 -105 5.99717 0.207
NP_442889.1_8 Reverse -72 -86 3.73557 0.273
NP_442889.1_8 Forward -317 -303 3.53891 0.275
NP_440447.1_1 Forward -121 -103 5.91901 0.194
NP_440056.1_1 Forward -35 -16 16.0274 0.11
NP_441713.1_1 Reverse -162 -181 -11.7019 0.234
NP_441713.1_1 Reverse -69 -88 -16.5201 0.284
NP_441770.1_10 Forward -86 -67 14.8474 0.213
NP_440178.1_7 Forward -315 -296 -13.7669 0.143
NP_440178.1_7 Reverse -304 -323 -14.3569 0.153
NP_440178.1_7 Forward -144 -125 -21.9284 0.246
NP_440178.1_7 Forward -85 -66 -22.42 0.265
NP_442570.1_3 Reverse -73 -92 -2.26216 0.212
NP_441716.1_1 Forward -314 -300 11.2093 0.0936
NP_441716.1_1 Forward -339 -325 2.65453 0.298
NP_442111.1_4 Reverse -74 -88 13.4709 0.0383
NP_442111.1_4 Forward -85 -71 9.83269 0.0575
NP_442111.1_4 Reverse -106 -120 3.53951 0.24
NP_442111.1_4 Reverse -304 -318 3.14618 0.253
NP_442111.1_4 Forward -117 -103 2.5562 0.271
NP_441624.1_7 Forward -204 -190 7.57108 0.249
NP_441624.1_7 Forward -381 -367 7.37441 0.257
NP_440343.1_3 Forward -365 -347 7.29487 0.211
NP_440906.1_5 Forward -313 -306 15.8704 0.0124
NP_440906.1_5 Reverse -306 -313 15.8704 0.0124
NP_440906.1_5 Forward -83 -76 15.8704 0.0124
NP_440906.1_5 Reverse -76 -83 15.8704 0.0124
NP_440747.1_10 Forward -87 -75 17.1486 0.000663
NP_440747.1_10 Reverse -302 -314 16.8536 0.00143
NP_440747.1_10 Forward -317 -305 14.9853 0.00221
NP_440747.1_10 Reverse -72 -84 -2.02597 0.0196
NP_440747.1_10 Forward -119 -107 -2.32097 0.0331
NP_440747.1_10 Reverse -104 -116 -4.68091 0.115
NP_440747.1_10 Forward -146 -134 -11.6624 0.131
NP_440747.1_10 Forward -378 -366 -12.1541 0.227
NP_440747.1_10 Reverse -243 -255 -12.1541 0.227
NP_441130.1_10 Reverse -73 -87 10.0294 0.117
NP_441130.1_10 Forward -86 -72 8.94771 0.131
NP_441130.1_10 Forward -316 -302 7.9644 0.144
NP_441130.1_10 Reverse -303 -317 5.80112 0.214
NP_441854.1_10 Reverse -73 -92 4.12936 0.282
NP_441486.1_1 Reverse -302 -316 15.1426 0.0061
NP_441486.1_1 Forward -317 -303 14.6509 0.00628
NP_441486.1_1 Reverse -72 -86 -3.34366 0.178
NP_441880.2_10 Forward -83 -65 7.68896 0.297
NP_442634.1_4 Reverse -73 -87 6.58777 0.0489
NP_442634.1_4 Reverse -244 -258 5.89945 0.051
NP_442634.1_4 Forward -86 -72 5.80112 0.051
NP_442634.1_4 Reverse -364 -378 3.73617 0.0983
NP_441265.1_3 Reverse -69 -83 2.94952 0.181
NP_440403.1_4 Reverse -66 -85 -4.81876 0.213
NP_440403.1_10 Reverse -66 -85 16.9124 0.0938
NP_440842.1_10 Reverse -65 -79 3.63784 0.255
NP_441695.1_8 Reverse -366 -380 10.9143 0.269
NP_441014.1_10 Forward -315 -296 0.588665 0.241
NP_441014.1_10 Reverse -288 -307 -2.36125 0.274
NP_442848.1_1 Forward -320 -306 15.8309 0.0143
NP_442848.1_1 Reverse -69 -83 -3.24533 0.263
NP_442848.1_5 Forward -382 -364 3.16574 0.276
NP_442848.1_5 Forward -91 -73 1.19912 0.276
NP_442848.1_9 Reverse -372 -391 3.14605 0.24
NP_443018.1_3 Forward -313 -306 14.8871 0.0123
NP_443018.1_3 Reverse -306 -313 14.8871 0.0123
NP_443018.1_3 Forward -83 -76 14.8871 0.0123
NP_443018.1_3 Reverse -76 -83 14.8871 0.0123
NP_443018.1_3 Forward -374 -367 12.5271 0.0523
NP_443018.1_3 Forward -254 -247 12.5271 0.0523
NP_443018.1_3 Reverse -367 -374 12.5271 0.0523
NP_443018.1_3 Reverse -247 -254 12.5271 0.0523
NP_443018.1_3 Forward -366 -359 7.6106 0.156
NP_441316.1_7 Reverse -73 -88 4.20813 0.135
NP_441634.1_8 Forward -86 -72 15.1426 0.0248
NP_441634.1_8 Reverse -303 -317 5.1128 0.114
NP_441634.1_8 Forward -316 -302 -4.52363 0.295
NP_440376.1_1 Forward -314 -305 19.4693 0.000692
NP_440376.1_1 Reverse -305 -314 19.4693 0.000692
NP_440376.1_1 Forward -84 -75 19.4693 0.000692
NP_440376.1_1 Reverse -75 -84 19.4693 0.000692
NP_440376.1_1 Forward -143 -134 4.62128 0.154
NP_440376.1_1 Forward -116 -107 0.0980582 0.285
NP_440376.1_1 Reverse -107 -116 -0.000272808 0.285
NP_441857.1_5 Reverse -68 -86 7.00065 0.189
NP_441588.1_4 Reverse -307 -317 18.1713 0.0143
NP_441588.1_4 Forward -312 -302 8.73149 0.14
NP_441588.1_4 Forward -82 -72 6.96153 0.178
NP_442687.1_7 Reverse -74 -84 15.8113 0.0125
NP_442687.1_7 Forward -85 -75 9.02648 0.0994
NP_442687.1_7 Forward -315 -305 8.92815 0.0994
NP_442687.1_7 Reverse -304 -314 8.92815 0.0994
NP_442687.1_7 Reverse -365 -375 6.46988 0.165
NP_442191.1_4 Reverse -76 -90 17.2953 0.0224
NP_442191.1_4 Forward -83 -69 15.3562 0.0603
NP_442191.1_4 Reverse -135 -149 11.6718 0.247
NP_442589.1_3 Forward -203 -184 16.3704 0.255
NP_442485.1_3 Reverse -235 -254 23.2056 0.0127
NP_442485.1_3 Forward -386 -367 6.39097 0.163
NP_442485.1_3 Reverse -64 -83 5.211 0.169
NP_442485.1_3 Reverse -355 -374 -2.65548 0.264
NP_442485.1_3 Reverse -70 -89 -3.73712 0.277
NP_441846.1_10 Reverse -348 -367 -19.3717 0.256
NP_441846.1_10 Reverse -129 -148 -22.6167 0.264
NP_442958.1_3 Forward -127 -108 -0.688862 0.268
NP_441013.1_2 Reverse -294 -312 3.3624 0.23
NP_441013.1_2 Forward -238 -220 -0.570838 0.271
NP_441013.1_2 Reverse -241 -259 -1.65248 0.282
NP_441013.1_2 Reverse -70 -88 -4.79907 0.299
NP_441422.1_7 Reverse -303 -320 -0.649475 0.168
NP_441422.1_7 Reverse -73 -90 -1.73112 0.194
NP_441029.1_4 Forward -106 -87 1.37609 0.274
NP_440691.1_8 Forward -180 -163 15.8701 0.213
NP_440533.1_9 Forward -261 -242 9.43923 0.147
NP_442296.1_9 Reverse -69 -88 -2.0655 0.219
NP_441763.1_5 Forward -337 -318 -5.31042 0.269
NP_442658.1_1 Reverse -73 -83 18.7607 0.00222
NP_442658.1_1 Forward -86 -76 14.2375 0.0237
NP_442658.1_1 Reverse -303 -313 7.94438 0.199
NP_442658.1_1 Reverse -364 -374 7.45273 0.214
NP_442658.1_1 Forward -316 -306 6.76441 0.214
NP_442658.1_1 Reverse -244 -254 5.78111 0.25
NP_442658.1_1 Reverse -356 -366 5.48612 0.265
NP_441855.2_4 Reverse -112 -131 9.13744 0.287
NP_442782.1_2 Reverse -75 -89 11.111 0.173
NP_442782.1_2 Reverse -366 -380 10.521 0.173
NP_442782.1_2 Reverse -337 -351 5.1128 0.247
NP_442782.1_2 Reverse -246 -260 1.37622 0.281
NP_442782.1_2 Forward -181 -167 -0.000409212 0.297
NP_442496.1_5 Reverse -351 -369 13.5888 0.188
NP_440656.1_8 Reverse -235 -254 -4.81876 0.208
NP_441414.1_9 Forward -314 -295 -3.54046 0.138
NP_442300.1_4 Reverse -265 -284 17.9932 0.152
NP_441256.1_1 Forward -258 -239 -3.54046 0.233
NP_442937.1_5 Reverse -300 -319 13.1758 0.095
NP_442937.1_5 Forward -319 -300 12.1925 0.116
NP_442937.1_5 Forward -62 -43 8.45592 0.22
NP_442321.1_9 Forward -21 -2 14.9458 0.265
NP_441958.1_5 Forward -85 -75 21.2195 0.000805
NP_441958.1_5 Forward -315 -305 12.2714 0.00183
NP_441958.1_5 Reverse -304 -314 12.2714 0.00183
NP_441958.1_5 Reverse -74 -84 12.2714 0.00183
NP_441958.1_5 Forward -117 -107 2.04498 0.0554
NP_441958.1_5 Reverse -365 -375 -0.314959 0.198
NP_441127.1_1 Forward -78 -64 13.0776 0.204
NP_441127.1_1 Reverse -349 -363 12.3893 0.215
NP_441127.1_1 Forward -77 -63 8.94771 0.284
NP_442836.1_5 Reverse -299 -318 12.9791 0.0679
NP_442836.1_5 Forward -320 -301 4.916 0.2
NP_440203.1_5 Forward -258 -248 16.4008 0.0611
NP_439905.1_2 Forward -395 -381 8.06273 0.285
NP_440995.1_8 Reverse -295 -314 10.0292 0.178
NP_440984.1_7 Reverse -70 -84 10.6193 0.122
NP_440984.1_7 Reverse -300 -314 5.50613 0.252
NP_439990.1_5 Reverse -300 -313 12.5073 0.11
NP_439990.1_5 Forward -89 -76 10.7374 0.128
NP_439990.1_5 Forward -319 -306 10.049 0.128
NP_442376.1_2 Reverse -70 -89 -12.6852 0.286
NP_442911.1_2 Reverse -65 -84 -8.55534 0.237
NP_442911.1_2 Forward -221 -202 -10.522 0.282
NP_442911.1_2 Forward -324 -305 -11.1119 0.299
NP_441580.1_6 Reverse -64 -83 4.52268 0.117
NP_440153.1_5 Reverse -108 -122 4.12949 0.199
NP_440153.1_5 Forward -83 -69 3.93283 0.199
NP_440153.1_5 Forward -313 -299 1.37622 0.257
NP_440153.1_8 Forward -375 -362 2.96921 0.21
NP_441591.1_10 Forward -86 -67 6.88262 0.275
NP_442064.1_4 Forward -94 -75 6.29183 0.254
NP_443055.1_3 Reverse -296 -315 18.6664 0.0456
NP_443055.1_6 Reverse -358 -376 6.01657 0.172
NP_443055.1_6 Reverse -238 -256 4.34495 0.182
NP_443055.1_6 Forward -375 -357 -1.84987 0.284
NP_440993.1_2 Forward -89 -73 5.95839 0.234
NP_440993.1_2 Reverse -70 -86 3.89344 0.256
NP_440138.1_6 Forward -319 -300 6.78348 0.219
NP_440138.1_7 Forward -349 -331 17.1905 0.278
NP_441099.1_5 Forward -94 -75 4.03102 0.0506
NP_441099.1_5 Reverse -295 -314 2.26107 0.0576
NP_441099.1_5 Forward -324 -305 -11.1119 0.271
NP_442002.1_1 Reverse -341 -359 -7.55234 0.251
NP_442002.1_9 Reverse -74 -81 10.7572 0.185
NP_440475.1_1 Reverse -66 -85 11.2653 0.259
NP_441294.1_7 Forward -318 -304 17.8896 0.00674
NP_441294.1_7 Reverse -301 -315 17.1217 0.0101
NP_441294.1_7 Reverse -71 -85 13.0902 0.0747
NP_441646.1_1 Forward -321 -302 11.6025 0.098
NP_442438.1_10 Reverse -70 -84 17.7975 0.0179
NP_442438.1_10 Forward -319 -305 7.47274 0.0933
NP_442438.1_10 Forward -89 -75 2.75286 0.168
NP_442231.1_1 Reverse -338 -357 4.12936 0.272
NP_441000.1_6 Forward -315 -301 5.1128 0.0933
NP_441000.1_6 Forward -85 -71 -3.34366 0.221
NP_441000.1_6 Reverse -74 -88 -4.03198 0.225
NP_442771.1_1 Reverse -73 -91 -4.11075 0.166
NP_442771.1_1 Reverse -200 -218 -6.56903 0.168
NP_441674.1_6 Forward -389 -370 6.88262 0.232
NP_440147.1_4 Forward -316 -303 18.9972 0.00328
NP_440147.1_4 Forward -86 -73 18.4072 0.00407
NP_440147.1_4 Reverse -73 -86 10.4424 0.0355
NP_440147.1_4 Reverse -303 -316 8.77074 0.0465
NP_440147.1_4 Forward -377 -364 5.91914 0.109
NP_440147.1_4 Forward -47 -34 -0.570702 0.291
NP_441175.1_7 Reverse -266 -285 6.58763 0.254
NP_441550.1_8 Forward -86 -76 15.8108 0.0132
NP_441550.1_8 Reverse -303 -313 15.1225 0.0132
NP_441550.1_8 Forward -316 -306 14.6309 0.0132
NP_441550.1_8 Reverse -73 -83 10.501 0.066
NP_441550.1_8 Reverse -364 -374 6.96107 0.183
NP_441550.1_8 Reverse -244 -254 5.28945 0.255
NP_441916.1_7 Reverse -75 -85 18.9579 0.00144
NP_441916.1_7 Forward -84 -74 18.4663 0.00144
NP_441916.1_7 Forward -314 -304 10.3048 0.0261
NP_441916.1_7 Reverse -305 -315 10.3048 0.0261
NP_441916.1_7 Reverse -107 -117 5.87989 0.116
NP_441916.1_7 Forward -375 -365 4.99491 0.15
NP_441916.1_7 Reverse -366 -376 4.3066 0.182
NP_441916.1_10 Reverse -322 -341 7.07928 0.198
NP_440206.1_4 Reverse -236 -255 -0.492971 0.29
NP_441041.1_4 Reverse -75 -94 1.27776 0.0813
NP_441041.1_4 Reverse -305 -324 1.0811 0.0818
NP_441041.1_4 Forward -84 -65 -2.0655 0.106
NP_441041.1_4 Reverse -252 -271 -12.8819 0.276
NP_441041.1_7 Reverse -72 -84 19.5648 0.00277
NP_441041.1_7 Forward -87 -75 13.3454 0.0485
NP_441041.1_7 Forward -317 -305 11.8878 0.0689
NP_441041.1_7 Reverse -302 -314 10.8188 0.0864
NP_442642.1_9 Forward -321 -304 5.74204 0.192
NP_440016.1_9 Forward -90 -71 12.5858 0.259
NP_442004.1_6 Reverse -305 -319 8.84938 0.14
NP_442004.1_6 Reverse -75 -89 7.27608 0.161
NP_441725.1_4 Forward -89 -75 22.025 0.00544
NP_441725.1_4 Forward -380 -366 2.75226 0.279
NP_441725.1_5 Forward -83 -73 9.02648 0.0553
NP_441725.1_5 Forward -374 -364 6.96153 0.108
NP_441725.1_5 Forward -366 -356 4.79825 0.115
NP_441725.1_5 Forward -313 -303 2.04498 0.115
NP_441725.1_5 Reverse -306 -316 2.04498 0.115
NP_441725.1_5 Reverse -76 -86 1.94665 0.115
NP_441725.1_5 Forward -254 -244 -0.0199663 0.223
NP_439966.1_7 Reverse -73 -83 17.4824 0.00636
NP_439966.1_7 Reverse -303 -313 15.3192 0.0152
NP_439966.1_7 Forward -86 -76 14.3359 0.0203
NP_439966.1_7 Forward -316 -306 7.25606 0.15
NP_439966.1_9 Reverse -73 -82 10.7178 0.0863
NP_439966.1_9 Forward -230 -221 3.7363 0.253
NP_440202.1_8 Reverse -229 -248 14.4749 0.236
NP_442941.1_3 Forward -313 -303 19.2529 0.00262
NP_442941.1_3 Reverse -76 -86 19.2529 0.00262
NP_442941.1_3 Reverse -306 -316 11.0914 0.0116
NP_442941.1_3 Forward -83 -73 2.53664 0.14
NP_442941.1_3 Reverse -108 -118 -0.118297 0.249
NP_442941.1_3 Forward -115 -105 -1.19994 0.288
NP_440674.1_3 Reverse -75 -94 9.53756 0.199
NP_440289.1_2 Reverse -72 -85 12.9006 0.0132
NP_440289.1_2 Reverse -302 -315 12.6056 0.0139
NP_440289.1_2 Forward -317 -304 4.54251 0.066
NP_440289.1_2 Forward -87 -74 -3.52063 0.267
NP_440289.1_2 Forward -384 -371 -5.09393 0.297
NP_440983.1_5 Reverse -121 -140 -8.26035 0.294
NP_440983.1_9 Forward -93 -74 4.62101 0.285
NP_440260.1_8 Forward -93 -75 2.57575 0.182
NP_440260.1_8 Forward -139 -121 1.19912 0.19
NP_440260.1_8 Reverse -363 -381 -7.749 0.3
NP_440802.1_10 Forward -127 -108 17.7974 0.299
NP_442281.1_1 Reverse -70 -84 17.6985 0.00542
NP_442281.1_1 Forward -319 -305 16.2235 0.0087
NP_442281.1_1 Forward -89 -75 15.2402 0.0132
NP_442281.1_1 Forward -380 -366 10.3237 0.0595
NP_442281.1_1 Reverse -300 -314 8.75042 0.0764
NP_442281.1_1 Reverse -241 -255 6.29216 0.13
NP_442281.1_1 Forward -121 -107 3.14559 0.243
NP_441334.1_7 Reverse -73 -92 9.14423 0.0185
NP_441334.1_7 Forward -86 -67 -2.0655 0.066
NP_441334.1_7 Reverse -364 -383 -21.1417 0.29
NP_440018.1_3 Reverse -225 -244 2.55606 0.291
NP_442256.1_2 Forward -118 -100 -6.4707 0.214
NP_442256.1_2 Reverse -303 -321 -9.0273 0.247
NP_440437.1_1 Forward -90 -71 0.982764 0.16
NP_442012.1_1 Forward -90 -71 1.86774 0.21
NP_441457.1_7 Forward -86 -67 9.63589 0.126
NP_441556.1_4 Reverse -237 -256 10.3907 0.284
NP_441556.1_7 Forward -391 -372 11.0117 0.165
NP_440453.1_1 Reverse -127 -146 10.2259 0.271
NP_441644.1_6 Reverse -75 -85 19.0557 0.000803
NP_441644.1_6 Forward -314 -304 17.3841 0.00127
NP_441644.1_6 Reverse -305 -315 17.3841 0.00127
NP_441644.1_6 Reverse -246 -256 11.8776 0.0417
NP_441644.1_6 Forward -339 -329 10.1076 0.0628
NP_441644.1_6 Forward -84 -74 10.1076 0.0628
NP_441644.1_6 Forward -375 -365 9.91099 0.0661
NP_441644.1_6 Forward -255 -245 9.616 0.0728
NP_441644.1_6 Forward -367 -357 7.0594 0.137
NP_441644.1_6 Reverse -366 -376 6.17443 0.165
NP_441644.1_6 Forward -116 -106 4.50281 0.235
NP_440867.1_10 Forward -255 -236 4.916 0.283
NP_440867.1_10 Forward -376 -357 3.53937 0.283
NP_442215.1_2 Reverse -303 -319 7.2367 0.0694
NP_442215.1_2 Forward -341 -325 -1.51476 0.186
NP_442215.1_2 Reverse -105 -121 -1.80975 0.189
NP_442215.1_2 Forward -316 -300 -1.90808 0.189
NP_442215.1_2 Reverse -73 -89 -3.38305 0.214
NP_442215.1_2 Forward -329 -313 -3.57971 0.218
NP_442215.1_2 Forward -263 -247 -7.21796 0.289
NP_440253.1_2 Forward -84 -66 9.0656 0.0519
NP_440253.1_2 Forward -314 -296 -2.53746 0.268
NP_440929.1_8 Forward -314 -305 19.2726 0.000701
NP_440929.1_8 Reverse -305 -314 19.2726 0.000701
NP_440929.1_8 Forward -84 -75 19.2726 0.000701
NP_440929.1_8 Reverse -75 -84 19.2726 0.000701
NP_440929.1_8 Reverse -134 -143 12.4878 0.0169
NP_442933.1_10 Forward -314 -305 17.601 0.00325
NP_442933.1_10 Reverse -305 -314 17.601 0.00325
NP_442933.1_10 Forward -84 -75 17.601 0.00325
NP_442933.1_10 Reverse -75 -84 17.601 0.00325
NP_442933.1_10 Reverse -107 -116 11.5045 0.042
NP_442933.1_10 Reverse -366 -375 4.42462 0.246
NP_442933.1_10 Forward -375 -366 4.42462 0.246
NP_440430.1_2 Reverse -4 -23 21.0423 0.187
NP_441751.2_8 Forward -313 -299 12.3893 0.0193
NP_441751.2_8 Reverse -76 -90 5.21113 0.0448
NP_441751.2_8 Forward -338 -324 -2.26202 0.132
NP_441751.2_8 Reverse -306 -320 -4.52363 0.174
NP_441751.2_8 Reverse -108 -122 -4.52363 0.174
NP_442554.1_8 Reverse -76 -86 17.2863 0.00543
NP_442554.1_8 Forward -313 -303 16.2046 0.0065
NP_442554.1_8 Forward -83 -73 16.008 0.0065
NP_442554.1_8 Reverse -306 -316 15.3197 0.00882
NP_442554.1_8 Forward -374 -364 14.828 0.0108
NP_442554.1_8 Forward -254 -244 12.9597 0.021
NP_442554.1_8 Reverse -367 -377 5.48657 0.146
NP_442554.1_8 Reverse -247 -257 5.28991 0.153
NP_441762.1_7 Forward -85 -73 12.527 0.0142
NP_441762.1_7 Reverse -74 -86 2.30059 0.0676
NP_441762.1_7 Reverse -304 -316 0.432302 0.0747
NP_441762.1_7 Forward -315 -303 -6.74586 0.284
NP_442313.1_5 Reverse -367 -386 4.71934 0.267
NP_442313.1_5 Reverse -76 -95 3.73603 0.29
NP_442142.1_4 Forward -87 -74 15.4566 0.0264
NP_442142.1_4 Reverse -72 -85 14.4733 0.0311
NP_442142.1_4 Reverse -302 -315 12.2117 0.0464
NP_442142.1_4 Forward -317 -304 10.9334 0.0646
NP_442142.1_4 Forward -258 -245 9.36014 0.0973
NP_442142.1_4 Reverse -243 -256 9.06515 0.103
NP_442142.1_4 Forward -119 -106 4.83694 0.209
NP_442292.1_1 Forward -313 -304 18.486 0.00229
NP_442292.1_1 Reverse -306 -315 18.486 0.00229
NP_442292.1_1 Reverse -76 -85 17.5026 0.00435
NP_442292.1_1 Forward -83 -74 9.63616 0.0183
NP_440895.1_6 Reverse -299 -312 10.4424 0.202
NP_442381.1_8 Reverse -72 -91 6.19431 0.0616
NP_441523.1_6 Forward -120 -101 6.39097 0.215
NP_443009.1_5 Forward -85 -74 19.626 0.00102
NP_443009.1_5 Reverse -304 -315 8.90795 0.0965
NP_443009.1_5 Forward -315 -304 8.90795 0.0965
NP_443009.1_5 Reverse -74 -85 7.82632 0.118
NP_443009.1_5 Reverse -365 -376 4.08976 0.263
NP_442406.1_9 Reverse -364 -383 8.16093 0.262
NP_441715.1_4 Forward -313 -303 17.3846 0.0106
NP_441715.1_4 Reverse -76 -86 16.7946 0.0106
NP_441715.1_4 Forward -83 -73 9.32148 0.097
NP_441715.1_4 Reverse -306 -316 7.94484 0.107
NP_440357.1_3 Reverse -355 -374 3.73603 0.242
NP_440357.1_3 Reverse -12 -31 -0.983855 0.296
NP_440015.1_9 Reverse -305 -323 -0.275845 0.256
NP_441448.1_1 Forward -257 -238 4.12936 0.279
NP_440183.1_9 Forward -253 -234 -2.45882 0.175
NP_440183.1_9 Forward -373 -354 -2.85214 0.175
NP_440183.1_9 Forward -82 -63 -4.91709 0.197
NP_441198.1_8 Reverse -364 -374 12.2947 0.144
NP_440379.1_5 Forward -93 -74 -1.57384 0.191
NP_440379.1_5 Forward -384 -365 -7.4737 0.245
NP_440379.1_5 Reverse -363 -382 -8.94866 0.257
NP_440464.1_10 Reverse -306 -316 13.0082 0.169
NP_441468.1_1 Forward -313 -306 15.8704 0.0124
NP_441468.1_1 Reverse -306 -313 15.8704 0.0124
NP_441468.1_1 Forward -83 -76 15.8704 0.0124
NP_441468.1_1 Reverse -76 -83 15.8704 0.0124
NP_441468.1_1 Reverse -367 -374 3.97235 0.277
NP_441468.1_1 Reverse -247 -254 3.97235 0.277
NP_441468.1_1 Forward -374 -367 3.97235 0.277
NP_441468.1_1 Forward -254 -247 3.97235 0.277
NP_441020.2_6 Reverse -73 -90 20.0984 0.00619
NP_441020.2_6 Forward -86 -69 9.08529 0.18
NP_441020.2_6 Reverse -347 -364 7.217 0.237
NP_441015.1_10 Forward -89 -70 3.53937 0.136
NP_441015.1_10 Reverse -347 -366 -11.2103 0.292
NP_441673.1_1 Forward -314 -305 20.8459 0.000698
NP_441673.1_1 Reverse -305 -314 20.8459 0.000698
NP_441673.1_1 Forward -84 -75 20.8459 0.000698
NP_441673.1_1 Reverse -75 -84 20.8459 0.000698
NP_441673.1_1 Forward -116 -107 1.37636 0.114
NP_441673.1_1 Reverse -107 -116 1.1797 0.163
NP_441673.1_1 Forward -143 -134 -7.86675 0.187
NP_441673.1_1 Reverse -134 -143 -7.96508 0.206
NP_440265.1_7 Reverse -366 -380 16.3219 0.169
NP_441876.1_9 Reverse -64 -74 13.6475 0.267
NP_441876.1_9 Forward -207 -197 13.3526 0.267
NP_441876.1_9 Forward -151 -141 13.1559 0.267
NP_441826.1_2 Reverse -69 -83 13.9626 0.0213
NP_441826.1_2 Forward -320 -306 5.1128 0.0978
NP_441826.1_2 Reverse -305 -319 -0.197071 0.204
NP_441826.1_2 Reverse -299 -313 -2.45868 0.271
NP_441330.1_1 Reverse -300 -319 -10.9153 0.183
NP_441330.1_1 Forward -89 -70 -12.2919 0.183
NP_442490.1_9 Forward -96 -77 -6.49039 0.273
NP_442868.1_6 Reverse -303 -313 19.2529 0.00563
NP_442868.1_6 Forward -86 -76 10.4031 0.038
NP_442868.1_6 Forward -316 -306 9.81313 0.038
NP_442868.1_6 Reverse -73 -83 8.53483 0.0555
NP_442719.1_2 Forward -375 -357 -9.12632 0.259
NP_442719.1_2 Forward -163 -145 -11.2896 0.291
NP_441056.1_1 Reverse -305 -324 0.58944 0.155
NP_441056.1_1 Reverse -75 -94 -8.06369 0.282
NP_442677.1_7 Forward -92 -82 16.893 0.27
NP_441612.1_2 Forward -116 -106 13.0995 0.21
NP_441612.1_2 Reverse -305 -315 8.54929 0.21
NP_441612.1_2 Forward -314 -304 8.54929 0.21
NP_441612.1_2 Reverse -144 -154 6.70984 0.277
NP_442227.1_2 Forward -337 -318 2.75272 0.223
NP_442361.1_3 Forward -320 -307 13.589 0.14
NP_442361.1_3 Reverse -69 -82 10.5407 0.272
NP_442361.1_3 Forward -90 -77 9.06573 0.283
NP_442808.1_1 Reverse -74 -84 18.4657 0.00201
NP_442808.1_1 Forward -85 -75 8.73102 0.0481
NP_442808.1_1 Reverse -304 -314 8.63269 0.0481
NP_442808.1_1 Forward -315 -305 8.63269 0.0481
NP_442808.1_1 Forward -382 -372 3.91283 0.218
NP_441101.1_10 Reverse -198 -217 -0.590531 0.189
NP_441290.1_3 Forward -84 -65 19.0757 0.187
NP_440145.1_3 Forward -94 -75 8.94757 0.0446
NP_440145.1_3 Forward -324 -305 -1.7705 0.156
NP_440145.1_3 Reverse -295 -314 -4.03212 0.217
NP_442820.1_3 Reverse -230 -240 14.1392 0.277
NP_442718.1_2 Forward -236 -217 -5.50708 0.295
NP_442542.1_2 Reverse -73 -86 10.344 0.126
NP_442542.1_2 Reverse -356 -369 7.49244 0.179
NP_442542.1_9 Reverse -68 -82 21.6317 0.00646
NP_442050.1_5 Forward -86 -76 15.9091 0.0091
NP_442050.1_5 Reverse -303 -313 14.3359 0.0206
NP_442050.1_5 Reverse -73 -83 8.23937 0.234
NP_442050.1_5 Forward -316 -306 7.64939 0.243
NP_442050.1_8 Reverse -69 -88 16.7111 0.272
NP_442342.1_9 Reverse -73 -89 11.0716 0.12
NP_442342.1_9 Reverse -303 -319 2.12349 0.29
NP_441114.1_3 Reverse -49 -58 7.66954 0.231
NP_441114.1_3 Forward -365 -356 7.57121 0.231
NP_440558.1_2 Forward -93 -74 2.94938 0.164
NP_442789.1_4 Reverse -73 -92 10.0292 0.0942
NP_442789.1_4 Reverse -364 -383 -6.1954 0.285
NP_442789.1_4 Reverse -319 -338 -8.06369 0.299
NP_442789.1_4 Forward -86 -67 -8.16202 0.299
NP_441518.1_3 Reverse -65 -84 -5.70374 0.126
NP_441518.1_3 Reverse -295 -314 -13.1769 0.264
NP_441878.1_6 Reverse -245 -255 10.5014 0.0176
NP_441878.1_6 Forward -85 -75 10.5014 0.0176
NP_441878.1_6 Reverse -365 -375 10.4031 0.0176
NP_441878.1_6 Forward -315 -305 10.4031 0.0176
NP_441878.1_6 Reverse -304 -314 10.4031 0.0176
NP_441878.1_6 Reverse -74 -84 10.4031 0.0176
NP_441878.1_6 Forward -376 -366 0.766681 0.134
NP_441878.1_6 Forward -256 -246 0.668351 0.139
NP_441878.1_6 Reverse -133 -143 0.275027 0.146
NP_441878.1_6 Reverse -357 -367 -7.39479 0.222
NP_441878.1_6 Reverse -329 -339 -7.49312 0.231
NP_441878.1_10 Reverse -380 -394 12.1926 0.289
NP_441036.1_8 Reverse -74 -84 17.7779 0.000554
NP_441036.1_8 Forward -85 -75 15.713 0.00724
NP_441036.1_8 Forward -144 -134 11.5831 0.114
NP_441036.1_8 Forward -315 -305 8.33817 0.174
NP_441036.1_8 Reverse -304 -314 8.33817 0.174
NP_442650.1_2 Reverse -305 -319 8.45605 0.13
NP_441557.1_5 Forward -314 -305 19.9609 0.000699
NP_441557.1_5 Reverse -305 -314 19.9609 0.000699
NP_441557.1_5 Forward -84 -75 19.9609 0.000699
NP_441557.1_5 Reverse -75 -84 19.9609 0.000699
NP_441557.1_5 Forward -116 -107 0.491382 0.144
NP_441557.1_5 Reverse -107 -116 0.29472 0.174
NP_441557.1_5 Reverse -366 -375 -0.885252 0.26
NP_441445.1_1 Forward -323 -304 9.63589 0.104
NP_441445.1_1 Reverse -296 -315 6.39097 0.15
NP_441445.1_1 Reverse -372 -391 -0.688862 0.3
NP_442066.2_4 Forward -84 -65 8.06259 0.0828
NP_442066.2_4 Reverse -75 -94 0.58944 0.163
NP_442066.2_9 Reverse -301 -314 8.47575 0.185
NP_442066.2_9 Reverse -71 -84 8.37742 0.185
NP_442777.1_3 Forward -262 -244 9.45814 0.158
NP_442777.1_3 Forward -382 -364 6.99988 0.195
NP_442962.1_5 Reverse -255 -274 6.4893 0.242
NP_442419.1_2 Forward -380 -361 -1.86883 0.246
NP_441308.1_8 Reverse -73 -83 9.22315 0.226
NP_440101.1_3 Reverse -70 -89 10.1275 0.128
NP_441458.1_10 Forward -323 -304 21.9273 0.0227
NP_441458.1_10 Forward -93 -74 13.1758 0.0856
NP_442830.1_5 Forward -367 -353 4.22722 0.239
NP_442183.1_1 Forward -84 -70 11.406 0.0702
NP_442183.1_1 Reverse -305 -319 7.27608 0.145
NP_442183.1_1 Reverse -75 -89 7.17775 0.147
NP_442166.1_7 Reverse -76 -90 22.1241 0.0164
NP_442166.1_7 Reverse -367 -381 14.8476 0.175
NP_442135.1_8 Reverse -319 -337 12.9988 0.207
NP_441574.1_1 Reverse -63 -82 -5.40875 0.26
NP_441549.1_9 Forward -343 -325 -5.38906 0.198
NP_442170.1_5 Reverse -75 -94 -3.63879 0.286
NP_442347.1_2 Forward -313 -304 12.4878 0.056
NP_442347.1_2 Reverse -306 -315 12.4878 0.056
NP_442347.1_2 Forward -83 -74 11.1111 0.056
NP_442347.1_2 Reverse -108 -117 5.40793 0.23
NP_442347.1_2 Reverse -76 -85 3.34298 0.284
NP_442645.1_2 Forward -322 -303 -12.6852 0.144
NP_442645.1_2 Reverse -297 -316 -14.9469 0.185
NP_442645.1_2 Forward -92 -73 -22.2233 0.29
NP_442645.1_4 Forward -102 -83 6.58763 0.235
NP_441037.1_4 Reverse -73 -83 16.2838 0.0168
NP_441037.1_4 Reverse -379 -389 8.6821 0.237
NP_441037.1_4 Forward -316 -306 7.9999 0.237
NP_441037.1_4 Reverse -364 -374 7.90244 0.237
NP_441037.1_4 Forward -86 -76 7.22024 0.237
NP_440690.1_1 Forward -270 -251 6.98095 0.249
NP_442317.1_6 Forward -380 -361 4.42435 0.247
NP_441633.1_3 Forward -86 -73 13.3923 0.018
NP_441633.1_3 Reverse -303 -316 3.46087 0.0699
NP_441633.1_3 Forward -316 -303 1.19926 0.109
NP_441633.1_3 Reverse -73 -86 -3.81562 0.177
NP_441633.1_3 Forward -132 -119 -6.86388 0.277
NP_442764.1_5 Forward -369 -350 10.9142 0.178
NP_442764.1_8 Forward -350 -331 5.211 0.241
NP_440136.1_2 Forward -313 -306 15.9687 0.0123
NP_440136.1_2 Reverse -306 -313 15.9687 0.0123
NP_440136.1_2 Forward -83 -76 15.9687 0.0123
NP_440136.1_2 Reverse -76 -83 15.9687 0.0123
NP_442590.1_9 Forward -256 -237 6.98095 0.252
NP_442590.1_10 Reverse -305 -324 10.3242 0.183
NP_442998.1_10 Forward -312 -305 15.5754 0.0102
NP_442998.1_10 Reverse -307 -314 15.5754 0.0102
NP_442998.1_10 Forward -82 -75 15.5754 0.0102
NP_442998.1_10 Reverse -77 -84 15.5754 0.0102
NP_442998.1_10 Reverse -109 -116 5.93897 0.206
NP_440899.1_2 Forward -95 -76 5.50519 0.28
NP_440299.1_1 Forward -318 -305 14.08 0.0259
NP_440299.1_1 Reverse -71 -84 11.4251 0.0489
NP_440299.1_1 Forward -88 -75 11.1301 0.0518
NP_440299.1_1 Forward -394 -381 2.772 0.274
NP_440299.1_1 Reverse -301 -314 2.37867 0.291
NP_441799.1_1 Reverse -301 -315 11.307 0.0591
NP_441799.1_1 Forward -88 -74 10.3237 0.0756
NP_441799.1_1 Forward -318 -304 6.98048 0.155
NP_441799.1_1 Forward -343 -329 6.78381 0.162
NP_441799.1_1 Forward -49 -35 6.68548 0.165
NP_441799.1_1 Reverse -242 -256 3.8339 0.279
NP_441799.1_1 Reverse -71 -85 3.44058 0.298
NP_442802.1_6 Forward -85 -66 1.17943 0.204
NP_441007.1_10 Reverse -70 -83 3.46087 0.182
NP_441007.1_10 Forward -89 -76 3.26421 0.182
NP_441007.1_10 Forward -319 -306 2.57589 0.183
NP_441007.1_10 Forward -260 -247 0.510939 0.226
NP_442334.1_1 Reverse -63 -82 -4.03212 0.259
NP_442334.1_2 Reverse -356 -373 -4.77938 0.2
NP_442334.1_2 Reverse -348 -365 -4.97604 0.2
NP_442201.1_10 Forward -127 -108 -14.4552 0.282
NP_440256.1_1 Forward -87 -68 21.7306 0.00324
NP_440256.1_1 Reverse -302 -321 7.57094 0.0257
NP_440256.1_1 Reverse -72 -91 0.0977854 0.087
NP_440256.1_1 Forward -317 -298 -1.37718 0.103
NP_440256.1_1 Reverse -333 -352 -8.65367 0.264
NP_441229.1_10 Forward -324 -305 2.45773 0.288
NP_441512.1_4 Forward -88 -69 7.96426 0.265
NP_441512.1_4 Forward -120 -101 7.57094 0.271
NP_441559.1_8 Forward -89 -75 11.0127 0.0574
NP_441559.1_8 Reverse -325 -339 -3.73699 0.209
NP_441559.1_8 Reverse -300 -314 -5.70361 0.27
NP_441559.1_8 Forward -148 -134 -5.9986 0.271
NP_441559.1_8 Forward -121 -107 -5.9986 0.271
NP_441559.1_8 Reverse -70 -84 -6.29359 0.276
NP_441559.1_8 Forward -250 -236 -6.98191 0.281
NP_440915.1_6 Reverse -71 -85 24.9757 0.000297
NP_440915.1_6 Forward -88 -74 10.6193 0.0301
NP_440915.1_6 Forward -379 -365 5.99778 0.0871
NP_440915.1_6 Forward -318 -304 4.42448 0.0953
NP_440915.1_6 Reverse -32 -46 2.06454 0.126
NP_440915.1_6 Reverse -301 -315 1.76955 0.131
NP_440915.1_6 Forward -147 -133 1.27789 0.142
NP_440915.1_6 Reverse -354 -368 1.17956 0.145
NP_440915.1_6 Reverse -242 -256 -0.0987402 0.182
NP_440915.1_6 Reverse -346 -360 -1.67204 0.243
NP_441704.1_8 Forward -325 -306 7.66846 0.233
NP_442069.1_4 Reverse -117 -136 5.99764 0.245
NP_442069.1_4 Reverse -64 -83 3.14605 0.27
NP_441464.1_1 Reverse -238 -257 6.58763 0.287
NP_440306.1_5 Forward -194 -175 2.45773 0.189
NP_440695.1_5 Reverse -75 -94 0.982764 0.284
NP_441939.1_3 Reverse -76 -95 16.7157 0.0354
NP_441199.1_6 Reverse -71 -90 4.71934 0.159
NP_441494.1_6 Forward -89 -76 8.77074 0.227
NP_442993.1_1 Forward -314 -298 1.82849 0.0502
NP_442386.1_9 Reverse -74 -83 15.7322 0.0144
NP_442386.1_9 Reverse -304 -313 13.8639 0.0289
NP_442386.1_9 Forward -315 -306 13.8639 0.0289
NP_442386.1_9 Forward -85 -76 6.39082 0.219
NP_442386.1_9 Forward -24 -15 5.11253 0.266
NP_442386.1_9 Forward -256 -247 4.81753 0.282
NP_440570.1_5 Reverse -242 -261 3.73603 0.234
NP_440570.1_5 Forward -330 -311 -2.75381 0.28
NP_442054.1_4 Reverse -287 -306 6.4893 0.299
NP_441750.1_1 Reverse -352 -371 -6.49039 0.239
NP_441750.1_4 Forward -88 -69 1.47442 0.28
NP_441340.1_5 Forward -313 -306 15.6737 0.0124
NP_441340.1_5 Reverse -306 -313 15.6737 0.0124
NP_441340.1_5 Forward -83 -76 15.6737 0.0124
NP_441340.1_5 Reverse -76 -83 15.6737 0.0124
NP_441340.1_5 Reverse -367 -374 4.07068 0.239
NP_441340.1_5 Reverse -247 -254 4.07068 0.239
NP_441340.1_5 Forward -374 -367 4.07068 0.239
NP_441340.1_5 Forward -254 -247 4.07068 0.239
NP_441947.1_4 Reverse -64 -83 10.1275 0.3
NP_442484.1_2 Forward -325 -306 5.89931 0.159
NP_442791.1_5 Forward -322 -303 -11.8003 0.29
NP_440168.1_9 Reverse -364 -383 0.884433 0.255
NP_440168.1_9 Forward -86 -67 -3.44213 0.296
NP_441132.1_1 Forward -113 -94 29.3021 0.000613
NP_441132.1_2 Forward -212 -193 33.2353 0.000039
NP_441132.1_3 Forward -152 -133 27.8271 0.00164
NP_441132.1_4 Forward -56 -37 31.957 0.0000631
NP_441132.1_4 Reverse -37 -56 20.8456 0.03
NP_441132.1_5 Forward -86 -67 24.0905 0.0251
NP_441132.1_6 Forward -338 -319 28.3188 0.0013
NP_441132.1_7 Forward -188 -169 18.9773 0.103
NP_441132.1_8 Forward -233 -214 25.4672 0.00768
NP_441132.1_10 Forward -293 -274 19.174 0.0972
NP_442240.1_2 Reverse -108 -127 3.14605 0.0551
NP_442240.1_2 Reverse -76 -95 -10.522 0.137
NP_441160.1_1 Forward -383 -364 -11.5053 0.295
NP_440211.1_1 Forward -41 -22 15.4366 0.159
NP_440586.1_8 Forward -313 -306 13.2151 0.026
NP_440586.1_8 Forward -83 -76 13.2151 0.026
NP_440586.1_8 Reverse -306 -313 13.2151 0.026
NP_440586.1_8 Reverse -76 -83 13.2151 0.026
NP_440586.1_8 Forward -115 -108 12.6251 0.0546
NP_440586.1_8 Forward -374 -367 7.61025 0.227
NP_440586.1_8 Forward -254 -247 7.61025 0.227
NP_440586.1_8 Reverse -367 -374 7.61025 0.227
NP_440586.1_8 Reverse -247 -254 7.61025 0.227
NP_442251.1_6 Forward -313 -306 15.2804 0.0124
NP_442251.1_6 Reverse -306 -313 15.2804 0.0124
NP_442251.1_6 Forward -83 -76 15.2804 0.0124
NP_442251.1_6 Reverse -76 -83 15.2804 0.0124
NP_440192.1_4 Reverse -225 -244 13.7635 0.169
NP_440192.1_4 Reverse -73 -92 9.49463 0.276
NP_440684.1_9 Forward -320 -306 8.55439 0.226
NP_441262.1_3 Reverse -305 -312 14.7888 0.0223
NP_441262.1_3 Reverse -75 -82 14.7888 0.0223
NP_441262.1_3 Forward -314 -307 14.7888 0.0223
NP_441262.1_3 Forward -84 -77 14.7888 0.0223
NP_440027.1_3 Forward -84 -66 4.93494 0.249
NP_440027.1_8 Forward -25 -6 5.89851 0.279
NP_443051.1_1 Forward -85 -76 19.5676 0.00335
NP_443051.1_1 Reverse -304 -313 10.4228 0.00754
NP_443051.1_1 Reverse -74 -83 10.4228 0.00754
NP_443051.1_1 Forward -315 -306 10.4228 0.00754
NP_443051.1_1 Forward -117 -108 0.29472 0.195
NP_439937.1_8 Reverse -73 -92 -0.197208 0.238
NP_439937.1_9 Reverse -226 -243 -8.90993 0.177
NP_439937.1_9 Forward -249 -232 -13.2365 0.283
NP_440926.1_10 Forward -170 -151 16.3224 0.259
NP_440408.1_7 Reverse -20 -39 8.25926 0.282
NP_440439.1_1 Forward -87 -74 18.1122 0.0105
NP_440439.1_1 Reverse -72 -85 9.36073 0.0465
NP_440439.1_1 Forward -146 -133 6.90245 0.0706
NP_440372.1_2 Forward -313 -306 16.3621 0.0124
NP_440372.1_2 Reverse -306 -313 16.3621 0.0124
NP_440372.1_2 Forward -83 -76 16.3621 0.0124
NP_440372.1_2 Reverse -76 -83 16.3621 0.0124
NP_440271.1_2 Reverse -321 -340 -0.39387 0.292
NP_440574.1_2 Forward -35 -16 19.9606 0.0177
NP_440316.1_10 Reverse -245 -255 17.5813 0.153
NP_440316.1_10 Reverse -357 -367 16.9913 0.153
NP_440316.1_10 Reverse -365 -375 7.74818 0.246
NP_440316.1_10 Forward -78 -68 5.38824 0.299
NP_441803.1_2 Forward -89 -70 20.5506 0.0223
NP_441803.1_2 Forward -121 -102 8.25926 0.118
NP_439977.1_5 Forward -90 -71 12.8808 0.0531
NP_439977.1_5 Reverse -69 -88 4.12936 0.155
NP_439977.1_5 Forward -381 -362 3.04771 0.163
NP_439977.1_5 Forward -387 -368 -2.36049 0.277
NP_440139.1_1 Forward -51 -32 7.17681 0.136
NP_441572.1_7 Reverse -69 -88 6.68596 0.0785
NP_441572.1_7 Reverse -124 -143 -1.86883 0.19
NP_441572.1_7 Forward -122 -103 -4.13045 0.227
NP_441572.1_7 Reverse -324 -343 -6.49039 0.293
NP_440267.1_2 Forward -121 -107 10.6187 0.134
NP_442384.1_10 Reverse -75 -88 18.8988 0.00338
NP_442384.1_10 Reverse -305 -318 10.049 0.047
NP_442384.1_10 Reverse -107 -120 8.27909 0.0674
NP_442384.1_10 Forward -116 -103 6.01747 0.113
NP_442384.1_10 Reverse -330 -343 5.52582 0.127
NP_442384.1_10 Forward -314 -301 4.54251 0.153
NP_442384.1_10 Reverse -134 -147 3.16588 0.199
NP_442384.1_10 Forward -84 -71 2.2809 0.23
NP_442114.1_4 Forward -84 -73 12.1534 0.107
NP_440364.1_2 Reverse -15 -34 14.0317 0.288
NP_442121.1_4 Reverse -194 -213 -5.70374 0.286
NP_441877.1_7 Reverse -300 -319 2.06362 0.24
NP_441018.1_7 Forward -324 -305 12.3892 0.161
NP_441018.1_7 Forward -343 -324 11.7008 0.179
NP_442790.1_4 Reverse -66 -85 -6.58872 0.144
NP_442262.1_10 Forward -313 -306 14.1988 0.0123
NP_442262.1_10 Reverse -306 -313 14.1988 0.0123
NP_442262.1_10 Forward -83 -76 14.1988 0.0123
NP_442262.1_10 Reverse -76 -83 14.1988 0.0123
NP_442262.1_10 Forward -374 -367 10.4622 0.145
NP_442262.1_10 Forward -254 -247 10.4622 0.145
NP_442262.1_10 Reverse -367 -374 10.4622 0.145
NP_442262.1_10 Reverse -247 -254 10.4622 0.145
NP_442262.1_10 Forward -366 -359 8.8889 0.219
NP_441689.1_5 Forward -86 -76 8.3377 0.132
NP_441689.1_5 Forward -316 -306 5.78111 0.197
NP_441689.1_5 Reverse -303 -313 5.78111 0.197
NP_442244.1_3 Forward -81 -62 7.27595 0.189
NP_440344.1_10 Forward -321 -304 11.2486 0.0063
NP_440344.1_10 Reverse -68 -85 8.7903 0.00973
NP_440344.1_10 Forward -91 -74 -1.63279 0.0557
NP_440344.1_10 Reverse -298 -315 -7.82764 0.119
NP_440282.1_10 Reverse -236 -255 -5.11376 0.25
NP_440531.1_6 Reverse -297 -316 16.4207 0.0353
NP_440531.1_6 Forward -92 -73 -0.688862 0.218
NP_440189.1_10 Forward -231 -212 4.32602 0.279
NP_441335.1_8 Reverse -355 -374 17.6007 0.111
NP_441335.1_8 Reverse -346 -365 7.17762 0.281
NP_441965.1_10 Reverse -72 -88 10.1866 0.107
NP_441965.1_10 Reverse -363 -379 6.25339 0.183
NP_441640.1_8 Reverse -312 -331 8.55425 0.103
NP_442065.1_7 Forward -101 -83 5.13236 0.215
NP_442065.1_7 Forward -323 -305 3.06741 0.215
NP_442529.1_4 Reverse -66 -85 9.53756 0.235
NP_442693.1_2 Reverse -235 -254 8.94757 0.246
NP_442693.1_6 Forward -90 -71 5.70265 0.278
NP_440297.1_9 Forward -254 -244 9.61647 0.0917
NP_440297.1_9 Forward -374 -364 9.51814 0.0917
NP_440297.1_9 Reverse -247 -257 0.766681 0.282
NP_440297.1_9 Forward -313 -303 -0.118297 0.282
NP_440297.1_9 Reverse -306 -316 -0.118297 0.282
NP_440297.1_9 Forward -83 -73 -0.216628 0.282
NP_440297.1_9 Reverse -76 -86 -0.216628 0.282
NP_441896.1_3 Reverse -66 -85 10.7175 0.0845
NP_441896.1_3 Forward -93 -74 0.786102 0.224
NP_441896.1_5 Reverse -371 -378 12.2322 0.273
NP_440894.1_10 Reverse -70 -89 11.7008 0.142
NP_440894.1_10 Forward -386 -367 2.94938 0.279
NP_441778.1_8 Forward -203 -189 16.4202 0.273
NP_442067.1_4 Reverse -361 -380 4.916 0.244
NP_442067.1_4 Reverse -241 -260 2.3594 0.298
NP_440999.1_1 Reverse -235 -254 2.16195 0.249
NP_440999.1_9 Reverse -71 -85 21.1407 0.0083
NP_440999.1_9 Forward -318 -304 4.22782 0.116
NP_440999.1_9 Reverse -301 -315 1.57289 0.162
NP_440999.1_9 Forward -88 -74 1.17956 0.169
NP_440888.1_2 Forward -84 -70 20.9434 0.000502
NP_440888.1_2 Forward -314 -300 15.7319 0.0092
NP_440888.1_2 Reverse -75 -89 14.1586 0.02
NP_440888.1_2 Reverse -305 -319 11.2087 0.0729
NP_440888.1_2 Reverse -189 -203 5.60385 0.272
NP_440600.1_4 Forward -322 -304 1.39578 0.128
NP_440600.1_4 Reverse -297 -315 -2.0458 0.183
NP_440600.1_4 Forward -92 -74 -7.45401 0.291
NP_440491.1_1 Reverse -72 -91 14.2263 0.113
NP_440491.1_1 Forward -87 -68 6.81956 0.288
NP_440052.1_5 Reverse -64 -83 -0.39387 0.191
NP_440052.1_5 Forward -95 -76 -1.57384 0.199
NP_439969.1_3 Forward -229 -210 5.80098 0.178
NP_439969.1_3 Reverse -70 -89 1.57275 0.257
NP_439969.1_3 Reverse -102 -121 0.196116 0.268
NP_442277.1_4 Reverse -66 -85 14.4533 0.0423
NP_442033.1_10 Reverse -73 -92 1.96607 0.0882
NP_442033.1_10 Forward -249 -230 -12.8819 0.277
NP_440105.1_7 Forward -63 -44 14.1591 0.214
NP_441543.1_2 Forward -83 -74 18.486 0.00236
NP_441543.1_2 Forward -313 -304 16.9127 0.00359
NP_441543.1_2 Reverse -306 -315 16.9127 0.00359
NP_441543.1_2 Reverse -76 -85 15.9293 0.00518
NP_441543.1_2 Forward -115 -106 11.9961 0.047
NP_442845.1_2 Forward -320 -306 6.6861 0.205
NP_442845.1_2 Forward -261 -247 6.6861 0.205
NP_442845.1_2 Reverse -299 -313 3.93283 0.272
NP_441551.1_5 Reverse -362 -378 5.76105 0.297
NP_441319.1_5 Forward -83 -64 12.3892 0.25
NP_441469.1_8 Reverse -74 -83 16.126 0.00797
NP_441469.1_8 Reverse -365 -374 10.9145 0.191
NP_441469.1_8 Reverse -245 -254 10.9145 0.191
NP_441469.1_8 Forward -85 -76 6.5879 0.227
NP_441469.1_8 Forward -315 -306 6.48957 0.227
NP_441469.1_8 Reverse -304 -313 6.48957 0.227
NP_442315.1_1 Reverse -370 -388 2.87075 0.294
NP_443064.1_6 Forward -314 -304 12.5669 0.0796
NP_443064.1_6 Reverse -305 -315 12.5669 0.0796
NP_443064.1_6 Reverse -75 -85 10.8217 0.13
NP_442337.1_6 Reverse -323 -342 12.5678 0.286
NP_442337.1_8 Forward -134 -115 2.3594 0.217
NP_442578.1_7 Forward -313 -306 14.5921 0.026
NP_442578.1_7 Forward -83 -76 14.5921 0.026
NP_442578.1_7 Reverse -306 -313 14.5921 0.026
NP_442578.1_7 Reverse -76 -83 14.5921 0.026
NP_442578.1_7 Forward -115 -108 12.6255 0.0418
NP_440710.1_1 Forward -92 -74 1.78911 0.135
NP_441462.1_2 Reverse -75 -85 20.2362 0.000805
NP_441462.1_2 Forward -314 -304 11.5831 0.00406
NP_441462.1_2 Reverse -305 -315 11.5831 0.00406
NP_441462.1_2 Forward -84 -74 11.5831 0.00406
NP_441462.1_2 Reverse -107 -117 0.57002 0.144
NP_441462.1_2 Forward -143 -133 -0.216628 0.192
NP_441462.1_2 Reverse -366 -376 -0.314959 0.206
NP_441621.1_7 Reverse -73 -87 14.0609 0.0266
NP_441621.1_7 Forward -86 -72 -3.34366 0.188
NP_441621.1_7 Reverse -364 -378 -6.29359 0.283
NP_441621.1_7 Reverse -64 -78 -6.29359 0.283
NP_443062.1_1 Forward -314 -296 8.64343 0.15
NP_443062.1_1 Forward -84 -66 8.35091 0.155
NP_443062.1_1 Reverse -305 -323 3.47554 0.297
NP_441601.1_4 Reverse -68 -87 -5.01543 0.293
NP_442204.1_1 Forward -88 -77 21.1015 0.0035
NP_442204.1_1 Forward -120 -109 11.3667 0.0565
NP_442204.1_1 Reverse -103 -114 3.0086 0.266
NP_442204.1_1 Forward -379 -368 2.51695 0.266
NP_442204.1_1 Forward -202 -191 0.0586712 0.284
NP_442204.1_5 Reverse -65 -84 4.52268 0.167
NP_442204.1_5 Forward -324 -305 1.37609 0.238
NP_441560.1_8 Forward -89 -70 17.4534 0.0461
NP_441560.1_10 Forward -322 -303 14.9458 0.097
NP_441351.1_8 Forward -77 -58 6.09597 0.202
NP_440516.1_8 Forward -314 -305 16.9127 0.00442
NP_440516.1_8 Reverse -305 -314 16.9127 0.00442
NP_440516.1_8 Forward -84 -75 16.9127 0.00442
NP_440516.1_8 Reverse -75 -84 16.9127 0.00442
NP_440516.1_8 Reverse -358 -367 -0.491928 0.262
NP_440516.1_8 Reverse -246 -255 -0.590259 0.283
NP_442428.1_5 Forward -313 -306 15.8704 0.0124
NP_442428.1_5 Reverse -306 -313 15.8704 0.0124
NP_442428.1_5 Forward -83 -76 15.8704 0.0124
NP_442428.1_5 Reverse -76 -83 15.8704 0.0124
NP_442428.1_5 Forward -374 -367 4.36568 0.271
NP_442428.1_5 Reverse -367 -374 4.36568 0.271
NP_442428.1_5 Forward -254 -247 4.36568 0.271
NP_442428.1_5 Reverse -247 -254 4.36568 0.271
NP_440818.1_6 Reverse -64 -83 7.27595 0.276
NP_441443.1_2 Forward -375 -356 -2.55715 0.26
NP_441443.1_2 Forward -367 -348 -5.60541 0.29
NP_441790.1_3 Forward -83 -64 5.01433 0.113
NP_442120.1_10 Reverse -69 -88 -13.5702 0.286
NP_441867.1_2 Reverse -349 -368 -4.91709 0.189
NP_441867.1_2 Reverse -138 -157 -20.3551 0.291
NP_440673.1_2 Reverse -65 -84 19.8521 0.0396
NP_440673.1_2 Reverse -371 -390 12.8284 0.134
NP_440673.1_2 Reverse -356 -375 8.24345 0.275
NP_440673.1_3 Forward -312 -305 12.4288 0.0426
NP_440673.1_3 Forward -82 -75 12.4288 0.0426
NP_440673.1_3 Reverse -307 -314 12.4288 0.0426
NP_440673.1_3 Reverse -77 -84 12.4288 0.0426
NP_440673.1_3 Reverse -109 -116 10.1672 0.149
NP_440673.1_3 Forward -365 -358 8.98723 0.203
NP_440673.1_7 Reverse -64 -83 4.62101 0.185
NP_440865.1_9 Reverse -128 -147 -8.94866 0.273
NP_440865.1_9 Forward -90 -71 -9.73531 0.299
NP_441052.1_2 Forward -314 -304 19.9412 0.00106
NP_441052.1_2 Reverse -305 -315 19.9412 0.00106
NP_441052.1_2 Forward -116 -106 13.5497 0.0285
NP_441052.1_2 Forward -84 -74 10.5014 0.0285
NP_441052.1_2 Reverse -75 -85 10.4031 0.0285
NP_441052.1_2 Forward -261 -251 5.78156 0.103
NP_441052.1_2 Reverse -330 -340 5.09324 0.132
NP_441052.1_2 Forward -255 -245 4.79825 0.145
NP_442219.1_9 Forward -313 -304 17.7976 0.00718
NP_442219.1_9 Reverse -306 -315 17.7976 0.00718
NP_442219.1_9 Forward -83 -74 8.35786 0.0681
NP_442219.1_9 Reverse -76 -85 8.25953 0.0681
NP_440436.1_4 Forward -83 -74 18.1905 0.00233
NP_440436.1_4 Forward -313 -304 17.2072 0.00233
NP_440436.1_4 Reverse -306 -315 17.2072 0.00233
NP_440436.1_4 Reverse -76 -85 9.24241 0.0871
NP_441884.1_8 Reverse -74 -93 -1.47551 0.138
NP_441884.1_9 Reverse -72 -91 -3.04881 0.0594
NP_441884.1_9 Forward -87 -68 -12.5869 0.138
NP_442864.1_4 Forward -37 -19 13.0972 0.18
NP_440314.1_9 Forward -374 -355 -6.39206 0.228
NP_441719.1_4 Forward -313 -306 16.3621 0.0124
NP_441719.1_4 Reverse -306 -313 16.3621 0.0124
NP_441719.1_4 Forward -83 -76 16.3621 0.0124
NP_441719.1_4 Reverse -76 -83 16.3621 0.0124
NP_441719.1_4 Forward -115 -108 3.77569 0.285
NP_441733.1_10 Reverse -72 -85 10.5407 0.106
NP_441733.1_10 Forward -87 -74 5.82081 0.203
NP_441004.1_1 Reverse -352 -371 -14.2585 0.265
NP_441004.1_1 Reverse -69 -88 -18.1918 0.298
NP_441004.1_2 Reverse -347 -366 1.37609 0.22
NP_441004.1_3 Reverse -343 -362 1.37609 0.292
NP_441004.1_4 Reverse -355 -365 19.7446 0.0335
NP_441004.1_4 Reverse -363 -373 10.4031 0.254
NP_442366.1_3 Reverse -304 -322 -3.22577 0.244
NP_442366.1_3 Reverse -74 -92 -3.6191 0.253
NP_442366.1_5 Forward -317 -307 14.8275 0.0375
NP_442366.1_5 Forward -52 -42 12.3692 0.132
NP_441437.1_1 Reverse -76 -95 9.0459 0.264
NP_442873.1_3 Reverse -65 -84 4.32522 0.269
NP_442873.1_9 Forward -324 -305 7.37347 0.236
NP_440296.1_10 Reverse -72 -91 -5.40875 0.225
NP_440296.1_10 Reverse -347 -366 -6.1954 0.225
NP_440296.1_10 Reverse -363 -382 -13.3736 0.269
NP_441115.1_4 Reverse -223 -241 11.1298 0.151
NP_442206.1_3 Reverse -235 -253 10.4422 0.286
NP_442206.1_10 Reverse -75 -90 4.30646 0.178
NP_442206.1_10 Reverse -366 -381 0.27489 0.267
NP_442854.1_4 Forward -121 -102 12.4867 0.243
NP_440328.1_4 Reverse -101 -120 15.2408 0.0338
NP_440328.1_4 Reverse -69 -88 6.88262 0.129
NP_440328.1_4 Forward -122 -103 2.0644 0.211
NP_443054.1_2 Forward -86 -72 19.7641 0.0121
NP_443054.1_2 Reverse -303 -317 9.04604 0.102
NP_443054.1_2 Forward -376 -362 4.71948 0.24
NP_443054.1_2 Forward -256 -242 -0.590395 0.299
NP_442430.1_4 Reverse -73 -92 14.8474 0.186
NP_442430.1_10 Forward -94 -75 11.5033 0.245
NP_442308.1_4 Forward -90 -71 0.982764 0.267
NP_440864.1_9 Reverse -102 -121 -4.6221 0.218
NP_441851.1_10 Reverse -74 -84 16.008 0.00552
NP_441851.1_10 Forward -315 -305 15.8113 0.00552
NP_441851.1_10 Reverse -304 -314 15.8113 0.00552
NP_441851.1_10 Forward -85 -75 8.53483 0.114
NP_441851.1_10 Reverse -365 -375 7.35486 0.142
NP_441851.1_10 Reverse -201 -211 4.10993 0.287
NP_442208.1_5 Forward -83 -64 -4.32711 0.258
NP_442814.1_2 Forward -145 -126 4.916 0.269
NP_442622.1_1 Forward -256 -237 -5.80207 0.257
NP_442622.1_1 Forward -85 -66 -11.1119 0.257
NP_442622.1_5 Reverse -73 -92 -2.65548 0.171
NP_442622.1_8 Forward -314 -296 0.805796 0.0626
NP_442622.1_8 Forward -255 -237 -19.1554 0.296
NP_441501.1_9 Reverse -281 -300 13.9616 0.296
NP_442856.1_7 Reverse -66 -85 4.81767 0.131
NP_442856.1_7 Forward -125 -106 -0.885524 0.211
NP_442856.1_7 Reverse -296 -315 -5.01543 0.27
NP_442515.1_1 Forward -315 -301 9.73436 0.0603
NP_442515.1_1 Reverse -304 -318 -4.91696 0.298
NP_441396.1_5 Reverse -195 -204 7.47288 0.252
NP_440593.1_3 Reverse -70 -89 3.83436 0.149
NP_440593.1_9 Reverse -63 -77 10.1277 0.24
NP_440165.1_5 Reverse -74 -93 2.65439 0.104
NP_440165.1_5 Forward -85 -66 -6.09707 0.231
NP_441046.1_2 Reverse -325 -344 0.687771 0.263
NP_441046.1_2 Forward -350 -331 -0.590531 0.282
NP_441349.1_10 Reverse -295 -314 7.07928 0.0326
NP_441349.1_10 Forward -126 -107 3.93269 0.0612
NP_441349.1_10 Forward -324 -305 -0.590531 0.0947
NP_441349.1_10 Forward -94 -75 -9.44032 0.292
NP_441409.1_6 Forward -320 -301 -10.1286 0.2
NP_441409.1_6 Forward -261 -242 -13.3736 0.236
NP_442314.1_1 Reverse -355 -373 7.88563 0.139
NP_442314.1_1 Reverse -235 -253 1.49411 0.231
NP_440432.1_9 Forward -83 -68 9.02635 0.0427
NP_440432.1_9 Forward -374 -359 7.05973 0.0441
NP_440432.1_9 Forward -254 -239 5.58476 0.0538
NP_440432.1_9 Forward -313 -298 -1.20007 0.167
NP_440432.1_9 Reverse -76 -91 -2.08505 0.167
NP_442843.1_1 Forward -254 -235 3.6377 0.154
NP_442843.1_1 Reverse -220 -239 -7.67036 0.25
NP_439960.1_10 Forward -91 -73 13.4905 0.0769
NP_442944.1_9 Reverse -296 -315 16.4207 0.228
NP_440474.1_8 Forward -83 -69 9.73373 0.156
NP_442450.1_5 Forward -316 -306 7.55152 0.13
NP_442168.1_5 Forward -271 -252 -3.73712 0.291
NP_440588.1_2 Forward -93 -74 -1.7705 0.157
NP_440588.1_2 Forward -125 -106 -3.93378 0.2
NP_440588.1_2 Forward -264 -245 -4.91709 0.233
NP_442006.1_2 Reverse -66 -83 -5.76269 0.146
NP_442006.1_2 Reverse -357 -374 -7.72931 0.182
NP_442006.1_2 Reverse -237 -254 -7.82764 0.185
NP_442006.1_2 Reverse -246 -263 -16.3824 0.25
NP_442006.1_2 Reverse -349 -366 -17.2674 0.271
NP_442006.1_3 Reverse -352 -370 1.59244 0.238
NP_441003.1_9 Forward -264 -245 6.09597 0.254
NP_441003.1_9 Forward -99 -80 3.73603 0.291
NP_440483.1_1 Forward -82 -63 7.27595 0.154
NP_440483.1_1 Forward -380 -361 -6.39206 0.248
NP_442243.1_1 Forward -122 -104 2.18168 0.204
NP_441570.1_1 Reverse -75 -93 9.16393 0.0121
NP_441570.1_1 Forward -314 -296 2.28076 0.0252
NP_441570.1_1 Reverse -305 -323 0.314141 0.0395
NP_441570.1_1 Forward -84 -66 -1.75081 0.0591
NP_441570.1_1 Forward -143 -125 -16.7954 0.254
NP_441078.1_4 Forward -314 -305 19.6659 0.0007
NP_441078.1_4 Reverse -305 -314 19.6659 0.0007
NP_441078.1_4 Forward -84 -75 19.6659 0.0007
NP_441078.1_4 Reverse -75 -84 19.6659 0.0007
NP_441078.1_4 Forward -116 -107 0.393051 0.205
NP_441078.1_4 Reverse -107 -116 -0.000272808 0.205
NP_441078.1_4 Reverse -330 -339 -1.6719 0.266
NP_441078.1_4 Reverse -246 -255 -1.6719 0.266
NP_441078.1_4 Forward -375 -366 -1.6719 0.266
NP_441078.1_4 Reverse -366 -375 -1.77023 0.266
NP_441078.1_4 Forward -255 -246 -1.77023 0.266
NP_442729.1_5 Reverse -245 -255 8.92815 0.235
NP_442729.1_8 Reverse -71 -84 8.47575 0.125
NP_442729.1_8 Reverse -198 -211 7.49244 0.15
NP_441539.1_8 Forward -314 -295 16.5191 0.168
NP_440707.1_6 Forward -92 -73 14.8466 0.172
NP_440526.1_3 Forward -83 -72 11.7595 0.0646
NP_440526.1_3 Forward -313 -302 10.2846 0.0646
NP_440526.1_3 Reverse -306 -317 10.2846 0.0646
NP_440526.1_3 Forward -374 -363 1.72983 0.267
NP_441432.1_8 Reverse -304 -313 16.8143 0.00595
NP_441432.1_8 Forward -315 -306 16.8143 0.00595
NP_441432.1_8 Forward -85 -76 16.8143 0.00595
NP_441432.1_8 Reverse -251 -260 8.25953 0.0755
NP_441432.1_8 Reverse -74 -83 8.25953 0.0755
NP_441432.1_8 Reverse -329 -338 5.21127 0.185
NP_441432.1_8 Forward -117 -108 4.22796 0.235
NP_441432.1_8 Reverse -357 -366 3.83464 0.243
NP_441432.1_8 Forward -321 -312 2.55633 0.298
NP_442320.1_8 Reverse -69 -83 14.7492 0.0132
NP_442320.1_8 Forward -320 -306 6.29277 0.029
NP_442320.1_8 Reverse -299 -313 -3.24533 0.113
NP_442344.1_7 Forward -83 -64 2.75272 0.0638
NP_441732.1_2 Forward -88 -72 3.20513 0.0141
NP_441732.1_2 Forward -120 -104 -6.7263 0.0495
NP_441732.1_2 Forward -318 -302 -6.82463 0.0533
NP_441732.1_2 Reverse -326 -342 -15.7728 0.16
NP_442540.1_5 Forward -89 -70 12.1917 0.233
NP_440629.1_6 Forward -90 -71 12.9934 0.271
NP_442003.1_4 Forward -313 -294 10.3242 0.288
NP_442003.1_4 Reverse -331 -350 9.24257 0.3
NP_442003.1_9 Forward -83 -64 12.9791 0.167
NP_440760.1_1 Reverse -305 -324 -13.2752 0.1
NP_440760.1_1 Forward -314 -295 -14.3569 0.129
NP_440760.1_1 Reverse -75 -94 -21.4367 0.237
NP_440760.1_1 Forward -84 -65 -22.9117 0.274
NP_440760.1_1 Forward -116 -97 -23.1083 0.283
NP_442797.1_7 Reverse -67 -85 6.70565 0.201
NP_442797.1_7 Forward -146 -128 3.55906 0.234
NP_442797.1_7 Forward -91 -73 3.06741 0.236
NP_440199.1_10 Forward -317 -307 7.25653 0.231
NP_440199.1_10 Reverse -302 -312 7.25653 0.231
NP_440199.1_10 Reverse -333 -343 7.05986 0.242
NP_441945.1_10 Forward -234 -215 13.5691 0.185
NP_441805.1_1 Forward -203 -184 5.89931 0.0876
NP_440913.1_1 Forward -86 -68 14.6705 0.116
NP_440913.1_1 Reverse -73 -91 9.26226 0.179
NP_440913.1_1 Reverse -364 -382 9.0656 0.179
NP_440913.1_1 Reverse -244 -262 8.18062 0.19
NP_440913.1_1 Reverse -303 -321 4.05072 0.283
NP_442751.1_2 Reverse -208 -227 5.70185 0.25
NP_441023.1_1 Reverse -107 -125 10.8356 0.262
NP_441072.1_2 Reverse -294 -313 21.7306 0.0147
NP_440713.1_4 Forward -94 -75 9.53756 0.143
NP_440713.1_4 Reverse -242 -261 6.68596 0.187
NP_440713.1_4 Reverse -295 -314 6.29264 0.193
NP_442489.1_2 Reverse -294 -313 5.11266 0.202
NP_442489.1_7 Forward -314 -305 20.1576 0.000695
NP_442489.1_7 Reverse -305 -314 20.1576 0.000695
NP_442489.1_7 Forward -84 -75 20.1576 0.000695
NP_442489.1_7 Reverse -75 -84 20.1576 0.000695
NP_442489.1_7 Reverse -107 -116 7.47288 0.0613
NP_442489.1_7 Forward -116 -107 0.688044 0.152
NP_442489.1_7 Forward -375 -366 -1.6719 0.235
NP_442489.1_7 Reverse -330 -339 -1.6719 0.235
NP_442489.1_7 Reverse -246 -255 -1.6719 0.235
NP_442489.1_7 Forward -255 -246 -1.77023 0.247
NP_442489.1_7 Reverse -366 -375 -1.77023 0.247
NP_442489.1_7 Forward -339 -330 -1.96689 0.28
NP_440565.1_7 Reverse -196 -215 3.73603 0.246
NP_441706.1_10 Forward -317 -298 12.6841 0.166
NP_440559.1_1 Forward -313 -304 17.4043 0.00658
NP_440559.1_1 Reverse -306 -315 17.4043 0.00658
NP_440559.1_1 Forward -83 -74 8.75118 0.0586
NP_440559.1_1 Reverse -76 -85 8.65285 0.0586
NP_440559.1_1 Forward -115 -106 4.62128 0.24
NP_441659.2_8 Reverse -75 -85 20.9245 0.000805
NP_441659.2_8 Forward -314 -304 18.1713 0.00133
NP_441659.2_8 Reverse -305 -315 18.1713 0.00133
NP_441659.2_8 Forward -84 -74 11.9764 0.0147
NP_441659.2_8 Forward -375 -365 5.28991 0.112
NP_441659.2_8 Reverse -107 -117 1.455 0.24
NP_442913.1_10 Reverse -66 -85 9.14423 0.0462
NP_442913.1_10 Reverse -98 -117 5.50599 0.0713
NP_442913.1_10 Forward -323 -304 -1.18052 0.167
NP_442008.1_2 Reverse -131 -150 10.4225 0.148
NP_442776.1_1 Forward -95 -76 3.04771 0.294
NP_440779.1_5 Forward -375 -358 -4.97604 0.12
NP_440779.1_5 Forward -84 -67 -5.27103 0.14
NP_442346.1_5 Forward -315 -305 16.6963 0.00248
NP_442346.1_5 Reverse -304 -314 16.6963 0.00248
NP_442346.1_5 Forward -85 -75 16.303 0.00248
NP_442346.1_5 Reverse -365 -375 15.5163 0.00546
NP_442346.1_5 Forward -376 -366 12.1731 0.0475
NP_442346.1_5 Forward -256 -246 10.5014 0.0934
NP_442346.1_5 Reverse -74 -84 9.02648 0.118
NP_442346.1_5 Reverse -329 -339 8.33817 0.14
NP_442346.1_5 Reverse -245 -255 7.55152 0.165
NP_442346.1_5 Forward -103 -93 6.37155 0.205
NP_440545.1_3 Reverse -71 -88 8.39697 0.0444
NP_440545.1_3 Forward -88 -71 8.00365 0.0471
NP_440545.1_3 Reverse -362 -379 1.8088 0.112
NP_440545.1_3 Reverse -103 -120 1.61214 0.116
NP_440545.1_3 Reverse -242 -259 -0.649475 0.157
NP_440831.1_3 Reverse -66 -85 5.61052 0.28
NP_440831.1_3 Reverse -349 -368 4.73683 0.298
NP_441786.1_10 Forward -323 -304 5.80098 0.287
NP_440459.1_2 Reverse -57 -74 9.28195 0.23
NP_440459.1_2 Reverse -296 -313 8.88863 0.246
NP_440459.1_2 Forward -86 -69 7.512 0.288
NP_440459.1_7 Reverse -73 -87 17.3641 0.0994
NP_441653.1_2 Reverse -64 -83 5.46229 0.245
NP_440010.1_4 Reverse -242 -261 -1.18128 0.267
NP_440010.1_10 Reverse -354 -373 8.06259 0.221
NP_440010.1_10 Reverse -63 -82 3.73603 0.25
NP_441943.1_5 Reverse -146 -165 14.1692 0.288
NP_442603.1_9 Forward -382 -364 16.7354 0.173
NP_442603.1_9 Forward -205 -187 1.78911 0.293
NP_441888.1_7 Forward -89 -75 3.93283 0.225
NP_441888.1_7 Reverse -70 -84 2.5562 0.225
NP_441888.1_7 Reverse -241 -255 0.392915 0.299
NP_440449.1_6 Reverse -67 -85 7.2832 0.227
NP_440449.1_6 Forward -375 -357 5.72699 0.271
NP_441948.1_4 Forward -91 -73 -0.0791831 0.138
NP_441948.1_4 Reverse -68 -86 -2.14413 0.16
NP_441047.1_2 Reverse -76 -95 1.67108 0.239
NP_440170.1_6 Forward -121 -102 11.7992 0.283
NP_441833.1_4 Forward -313 -306 15.9687 0.0124
NP_441833.1_4 Reverse -306 -313 15.9687 0.0124
NP_441833.1_4 Forward -83 -76 15.9687 0.0124
NP_441833.1_4 Reverse -76 -83 15.9687 0.0124
NP_441112.1_6 Forward -94 -75 -3.93378 0.296
NP_441112.1_6 Forward -208 -189 -4.13045 0.296
NP_442162.1_9 Forward -313 -306 16.2637 0.0124
NP_442162.1_9 Reverse -306 -313 16.2637 0.0124
NP_442162.1_9 Forward -83 -76 16.2637 0.0124
NP_442162.1_9 Reverse -76 -83 16.2637 0.0124
NP_442055.1_6 Forward -230 -211 21.0423 0.201
NP_440671.1_2 Reverse -110 -124 16.8142 0.136
NP_440671.1_4 Reverse -124 -138 9.93102 0.168
NP_440671.1_4 Forward -320 -306 8.45605 0.198
NP_440671.1_4 Reverse -299 -313 5.80112 0.271
NP_440224.1_1 Forward -95 -76 -1.7705 0.184
NP_440224.1_1 Forward -127 -108 -2.36049 0.211
NP_440772.1_8 Reverse -299 -318 7.96426 0.268
NP_442199.1_5 Forward -92 -73 1.57275 0.164
NP_442199.1_5 Forward -53 -34 0.491109 0.172
NP_442140.1_3 Forward -83 -73 17.4829 0.0159
NP_442140.1_3 Reverse -306 -316 12.2714 0.0632
NP_442140.1_3 Forward -313 -303 10.3048 0.0902
NP_442140.1_3 Forward -374 -364 10.0098 0.0949
NP_442140.1_3 Forward -254 -244 6.76487 0.159
NP_442140.1_3 Reverse -76 -86 4.69992 0.238
NP_440875.1_9 Forward -82 -72 17.619 0.0104
NP_440875.1_9 Reverse -77 -87 16.5483 0.0145
NP_440875.1_9 Reverse -109 -119 12.4602 0.117
NP_440875.1_9 Reverse -368 -378 9.05339 0.233
NP_440875.1_9 Forward -312 -302 7.69067 0.255
NP_441813.1_5 Reverse -303 -313 18.1713 0.00743
NP_441813.1_5 Forward -86 -76 18.1713 0.00743
NP_441813.1_5 Reverse -73 -83 10.0098 0.0208
NP_441813.1_5 Forward -316 -306 8.63316 0.0367
NP_439901.1_1 Reverse -230 -249 3.24438 0.268
NP_441259.1_8 Forward -81 -62 10.815 0.264
NP_440590.1_4 Forward -83 -70 21.7504 0.00377
NP_440590.1_4 Reverse -306 -319 19.1938 0.00669
NP_440590.1_4 Forward -313 -300 13.1956 0.013
NP_440590.1_4 Reverse -27 -40 8.77074 0.042
NP_440590.1_4 Reverse -76 -89 4.44418 0.0601
NP_440590.1_4 Forward -115 -102 0.805932 0.143
NP_440567.1_1 Forward -83 -69 17.3058 0.0153
NP_440567.1_1 Reverse -76 -90 7.86607 0.0642
NP_440567.1_1 Reverse -306 -320 6.3911 0.0837
NP_442497.1_10 Reverse -76 -85 17.601 0.00813
NP_442497.1_10 Forward -313 -304 10.4228 0.0087
NP_442497.1_10 Forward -83 -74 10.4228 0.0087
NP_442497.1_10 Reverse -306 -315 10.4228 0.0087
NP_442497.1_10 Forward -374 -365 0.29472 0.199
NP_442497.1_10 Forward -254 -245 0.29472 0.199
NP_440821.1_4 Reverse -73 -83 18.7612 0.00422
NP_440821.1_4 Reverse -303 -313 9.41981 0.0286
NP_440821.1_4 Forward -316 -306 9.41981 0.0286
NP_440821.1_4 Forward -86 -76 2.24165 0.131
NP_440821.1_4 Reverse -364 -374 -0.0199663 0.217
NP_441239.1_9 Reverse -73 -85 16.0669 0.0175
NP_441239.1_9 Forward -86 -74 15.5753 0.0186
NP_441239.1_9 Forward -257 -245 15.4769 0.0197
NP_441239.1_9 Forward -377 -365 15.0836 0.0244
NP_441239.1_9 Reverse -364 -376 10.4621 0.0783
NP_441239.1_9 Forward -369 -357 8.00379 0.145
NP_441239.1_9 Reverse -303 -315 5.25052 0.223
NP_441239.1_9 Forward -248 -236 4.66053 0.248
NP_441239.1_9 Forward -316 -304 3.38223 0.285
NP_441239.1_9 Reverse -244 -256 3.18557 0.292
NP_440156.1_1 Forward -198 -184 19.3128 0.208
NP_441892.1_1 Forward -323 -306 15.0835 0.0315
NP_441892.1_1 Forward -93 -76 6.82368 0.0931
NP_441892.1_1 Reverse -66 -83 5.25038 0.105
NP_441892.1_1 Reverse -296 -313 3.77542 0.119
NP_441892.1_1 Forward -384 -367 2.10379 0.144
NP_441892.1_1 Reverse -237 -254 0.137172 0.173
NP_441892.1_1 Forward -146 -129 -4.58271 0.264
NP_441892.1_1 Reverse -125 -142 -4.77938 0.268
NP_440665.1_2 Reverse -193 -212 -4.6221 0.246
NP_440604.1_6 Reverse -75 -94 2.94938 0.137
NP_442270.1_9 Forward -325 -306 -6.39206 0.207
NP_442270.1_9 Forward -331 -312 -10.227 0.253
NP_442643.1_3 Reverse -268 -287 -4.13045 0.261
NP_443035.1_10 Forward -253 -236 5.64371 0.273
NP_440354.1_5 Reverse -104 -123 3.24438 0.239
NP_442138.1_10 Forward -314 -295 0.982764 0.131
NP_442138.1_10 Reverse -75 -94 -1.7705 0.187
NP_442138.1_10 Forward -84 -65 -7.37537 0.288
NP_442052.1_8 Reverse -364 -374 12.1731 0.285
NP_441782.1_5 Forward -92 -73 9.14423 0.256
NP_441782.1_5 Reverse -297 -316 7.57094 0.283
NP_440546.1_4 Reverse -75 -85 13.5365 0.0459
NP_440546.1_4 Reverse -366 -376 12.9547 0.0572
NP_440546.1_4 Reverse -246 -256 12.4699 0.0679
NP_440546.1_4 Forward -84 -74 11.8882 0.0679
NP_440546.1_4 Forward -375 -365 11.4034 0.0841
NP_440546.1_4 Forward -314 -304 10.046 0.109
NP_440546.1_4 Reverse -305 -315 10.046 0.109
NP_440546.1_4 Forward -255 -245 7.91294 0.214
NP_440546.1_4 Forward -77 -67 7.71902 0.224
NP_441230.1_5 Reverse -70 -89 13.4708 0.0635
NP_441230.1_5 Forward -252 -233 -0.787193 0.292
NP_440462.1_6 Forward -86 -76 18.7612 0.00454
NP_440462.1_6 Reverse -73 -83 17.9746 0.00578
NP_440462.1_6 Reverse -303 -313 9.61647 0.0429
NP_440462.1_6 Forward -118 -108 5.78156 0.138
NP_440462.1_6 Forward -316 -306 1.35667 0.294
NP_442611.1_1 Forward -84 -65 8.84924 0.127
NP_442611.1_1 Reverse -75 -94 -1.57384 0.282
NP_440868.1_4 Forward -88 -76 8.00379 0.0602
NP_440868.1_4 Reverse -301 -313 7.80712 0.0637
NP_440868.1_4 Reverse -71 -83 2.98891 0.142
NP_440868.1_4 Forward -318 -306 -0.846001 0.282
NP_442499.1_1 Forward -374 -355 9.93088 0.203
NP_442402.1_4 Forward -218 -199 -9.83437 0.293
NP_442402.1_10 Forward -208 -198 11.3859 0.257
NP_441848.1_4 Reverse -149 -165 8.12362 0.288
NP_441084.1_6 Forward -86 -72 12.4467 0.16
NP_441084.1_6 Forward -377 -363 10.7015 0.231
NP_441084.1_6 Forward -118 -104 10.1198 0.254
NP_441084.1_6 Reverse -328 -342 9.34412 0.287
NP_440653.1_10 Forward -83 -64 2.0644 0.29
NP_440696.1_3 Reverse -75 -93 -1.16082 0.251
NP_440696.1_3 Forward -143 -125 -2.24246 0.274
NP_441843.2_9 Forward -82 -64 13.7017 0.205
NP_442039.1_4 Forward -313 -306 15.1821 0.0124
NP_442039.1_4 Reverse -306 -313 15.1821 0.0124
NP_442039.1_4 Forward -83 -76 15.1821 0.0124
NP_442039.1_4 Reverse -76 -83 15.1821 0.0124
NP_441811.1_8 Forward -320 -306 6.09611 0.287
NP_441180.1_1 Forward -362 -343 17.8948 0.248
NP_441926.1_3 Forward -314 -298 7.33503 0.17
NP_440825.1_2 Forward -384 -365 8.06259 0.236
NP_440825.1_6 Reverse -348 -367 7.27595 0.285
NP_440825.1_7 Reverse -306 -316 12.9096 0.152
NP_442837.1_3 Forward -313 -306 15.7721 0.0124
NP_442837.1_3 Reverse -306 -313 15.7721 0.0124
NP_442837.1_3 Forward -83 -76 15.7721 0.0124
NP_442837.1_3 Reverse -76 -83 15.7721 0.0124
NP_442837.1_3 Reverse -108 -115 9.87221 0.106
NP_440160.1_9 Reverse -75 -94 11.4058 0.216
NP_442053.1_1 Forward -314 -305 18.3876 0.0007
NP_442053.1_1 Reverse -305 -314 18.3876 0.0007
NP_442053.1_1 Forward -84 -75 18.3876 0.0007
NP_442053.1_1 Reverse -75 -84 18.3876 0.0007
NP_442053.1_1 Reverse -107 -116 6.5879 0.124
NP_442053.1_1 Forward -143 -134 4.22796 0.261
NP_440505.1_3 Reverse -303 -313 18.3679 0.00213
NP_440505.1_3 Forward -86 -76 17.188 0.00332
NP_440505.1_3 Reverse -73 -83 14.1397 0.0235
NP_440505.1_3 Forward -316 -306 9.22315 0.122
NP_440505.1_7 Reverse -100 -119 14.2574 0.146
NP_440505.1_7 Reverse -68 -87 3.6377 0.209
NP_440505.1_7 Forward -88 -69 0.0977854 0.259
NP_440505.1_7 Reverse -368 -387 -1.57384 0.276
NP_441102.1_1 Reverse -337 -356 3.24438 0.294
NP_441252.1_6 Reverse -355 -362 11.9372 0.25
NP_441203.1_1 Reverse -108 -127 -4.81876 0.0834
NP_440013.1_2 Forward -321 -307 21.3374 0.0588
NP_440914.1_1 Forward -314 -304 17.5935 0.000537
NP_440914.1_1 Reverse -305 -315 17.5935 0.000537
NP_440914.1_1 Reverse -75 -85 16.3248 0.00196
NP_440914.1_1 Reverse -48 -58 9.39583 0.186
NP_440914.1_1 Forward -84 -74 8.6151 0.186
NP_440914.1_1 Forward -116 -106 6.07773 0.297
NP_441011.1_6 Forward -35 -16 20.4523 0.0574
NP_441011.1_8 Forward -83 -74 16.9127 0.00602
NP_441011.1_8 Reverse -76 -85 16.6177 0.00602
NP_441011.1_8 Forward -313 -304 8.25953 0.144
NP_441011.1_8 Reverse -306 -315 8.25953 0.144
NP_441011.1_8 Reverse -37 -46 5.80125 0.227
NP_442533.1_1 Reverse -318 -337 -16.1268 0.263
NP_442533.1_1 Reverse -129 -148 -17.3068 0.285
NP_442533.1_6 Forward -314 -305 17.2076 0.00137
NP_442533.1_6 Reverse -305 -314 17.2076 0.00137
NP_442533.1_6 Forward -84 -75 17.2076 0.00137
NP_442533.1_6 Reverse -75 -84 17.2076 0.00137
NP_442533.1_6 Reverse -366 -375 14.4544 0.013
NP_442533.1_6 Reverse -246 -255 7.17789 0.0948
NP_442533.1_6 Forward -375 -366 6.78456 0.103
NP_442533.1_6 Forward -255 -246 6.68623 0.105
NP_442533.1_6 Forward -339 -330 5.70292 0.132
NP_442533.1_6 Forward -116 -107 4.91628 0.165
NP_442533.1_6 Forward -127 -118 1.67135 0.293
NP_442232.1_3 Forward -322 -303 -13.9635 0.286
NP_442322.1_4 Forward -383 -366 9.28121 0.141
NP_442322.1_4 Forward -263 -246 3.18472 0.205
NP_442322.1_4 Forward -92 -75 0.82479 0.21
NP_443016.1_1 Reverse -240 -259 -7.57203 0.277
NP_441219.1_6 Reverse -65 -83 12.4089 0.192
NP_441482.1_7 Forward -90 -76 16.3225 0.00702
NP_441482.1_7 Forward -320 -306 1.08123 0.0554
NP_441482.1_7 Reverse -128 -142 -10.6202 0.211
NP_439944.1_3 Forward -236 -217 16.2241 0.105
NP_439944.1_9 Forward -313 -303 10.5014 0.0887
NP_439944.1_9 Reverse -306 -316 10.5014 0.0887
NP_439944.1_9 Forward -83 -73 10.4031 0.0887
NP_439944.1_9 Reverse -76 -86 9.12481 0.1
NP_439944.1_9 Forward -374 -364 5.38824 0.254
NP_440816.1_7 Forward -259 -240 11.6025 0.218
NP_441028.1_6 Forward -208 -198 6.37109 0.23
NP_441028.1_6 Forward -152 -142 4.10949 0.278
NP_440116.1_5 Reverse -104 -121 2.79211 0.255
NP_440116.1_8 Reverse -306 -325 -7.08038 0.222
NP_440116.1_8 Forward -83 -64 -8.65367 0.256
NP_440115.1_6 Forward -87 -77 14.0414 0.0615
NP_440115.1_6 Forward -119 -109 11.1898 0.115
NP_440115.1_6 Reverse -302 -312 6.8632 0.167
NP_440115.1_6 Reverse -235 -245 4.69992 0.288
NP_440007.1_9 Reverse -248 -262 7.76774 0.2
NP_440007.1_9 Forward -88 -74 2.06454 0.281
NP_440007.1_9 Forward -318 -304 1.08123 0.29
NP_440007.1_9 Reverse -242 -256 0.88457 0.29
NP_439965.1_7 Forward -97 -78 10.6116 0.294
NP_441602.1_3 Forward -89 -70 9.63589 0.117
NP_441602.1_3 Reverse -70 -89 -3.73712 0.252
NP_441602.1_4 Forward -95 -76 12.2908 0.278
NP_441972.1_5 Reverse -306 -325 -0.0988766 0.161
NP_441972.1_5 Forward -83 -64 -8.16202 0.258
NP_441972.1_5 Reverse -49 -68 -9.34199 0.283
NP_441106.1_1 Forward -85 -76 18.486 0.0028
NP_441106.1_1 Reverse -74 -83 18.191 0.0028
NP_441106.1_1 Forward -315 -306 9.63616 0.0311
NP_441106.1_1 Reverse -304 -313 9.63616 0.0311
NP_441106.1_1 Forward -376 -367 4.62128 0.213
NP_440429.1_2 Forward -89 -70 10.7175 0.267
NP_439903.1_5 Reverse -282 -301 14.8577 0.223
NP_439903.1_6 Reverse -302 -321 7.57013 0.151
NP_439903.1_6 Forward -348 -329 6.58682 0.167
NP_439903.1_6 Reverse -72 -91 5.80018 0.176
NP_439903.1_6 Forward -264 -245 -1.27961 0.295
NP_442928.1_3 Forward -382 -363 11.1637 0.293
NP_442928.1_6 Reverse -107 -120 18.4072 0.247
NP_442306.1_10 Forward -89 -70 -19.0768 0.197
NP_442306.1_10 Forward -380 -361 -21.1417 0.247
NP_440797.1_2 Forward -325 -306 14.323 0.215
NP_441286.1_1 Forward -315 -303 12.9203 0.00815
NP_441286.1_1 Reverse -304 -316 12.9203 0.00815
NP_441286.1_1 Forward -85 -73 5.34885 0.0259
NP_441286.1_1 Reverse -74 -86 -3.59927 0.145
NP_442674.1_3 Forward -322 -303 9.24175 0.177
NP_440092.1_9 Forward -379 -360 16.1257 0.235
NP_440670.1_8 Forward -314 -305 18.3876 0.000699
NP_440670.1_8 Reverse -305 -314 18.3876 0.000699
NP_440670.1_8 Forward -84 -75 18.3876 0.000699
NP_440670.1_8 Reverse -75 -84 18.3876 0.000699
NP_441705.1_4 Reverse -101 -120 7.37428 0.279
NP_441930.1_2 Reverse -357 -367 14.828 0.19
NP_440886.1_7 Reverse -74 -84 17.7774 0.0011
NP_440886.1_7 Forward -85 -75 8.04271 0.0805
NP_440886.1_7 Forward -315 -305 7.94438 0.0805
NP_440886.1_7 Reverse -304 -314 7.94438 0.0805
NP_440828.1_4 Forward -265 -246 2.35861 0.152
NP_440828.1_4 Forward -85 -66 -3.04956 0.229
NP_440828.1_4 Forward -376 -357 -8.35941 0.296
NP_442614.1_2 Reverse -144 -158 6.6861 0.287
NP_442614.1_2 Forward -314 -300 5.80112 0.297
NP_442072.1_9 Forward -85 -67 -3.52077 0.0363
NP_442072.1_9 Reverse -304 -322 -23.3836 0.292
NP_440907.2_8 Forward -83 -73 17.4824 0.00685
NP_440907.2_8 Reverse -76 -86 9.616 0.103
NP_440907.2_8 Reverse -306 -316 7.64939 0.117
NP_441021.1_1 Reverse -312 -331 -5.01543 0.172
NP_441021.1_1 Reverse -306 -325 -11.7019 0.272
NP_441463.1_3 Forward -67 -48 -9.44032 0.28
NP_441463.1_3 Reverse -65 -84 -9.73531 0.284
NP_441463.1_6 Forward -377 -363 6.41593 0.273
NP_441626.1_2 Forward -313 -306 15.7721 0.0124
NP_441626.1_2 Reverse -306 -313 15.7721 0.0124
NP_441626.1_2 Forward -83 -76 15.7721 0.0124
NP_441626.1_2 Reverse -76 -83 15.7721 0.0124
NP_442211.1_3 Forward -326 -307 6.98569 0.29
NP_442365.1_5 Forward -374 -355 10.5209 0.183
NP_442362.1_1 Forward -84 -65 8.16093 0.288
NP_440107.1_5 Forward -91 -72 -2.36049 0.178
NP_442794.1_1 Forward -318 -306 12.4287 0.0721
NP_442794.1_1 Forward -88 -76 10.5604 0.0721
NP_442615.1_1 Forward -323 -305 -0.7675 0.121
NP_442615.1_1 Reverse -66 -84 -2.24246 0.141
NP_442615.1_1 Forward -93 -75 -7.06068 0.273
NP_441962.1_4 Forward -89 -70 -0.295539 0.117
NP_441962.1_4 Forward -380 -361 -9.34199 0.215
NP_441962.1_4 Forward -319 -300 -10.0303 0.223
NP_441962.1_9 Reverse -101 -120 9.73422 0.258
NP_440387.1_1 Reverse -75 -91 6.64671 0.0282
NP_440387.1_1 Reverse -305 -321 3.99177 0.0487
NP_440387.1_1 Forward -116 -100 2.32015 0.0827
NP_440387.1_1 Forward -84 -68 -0.531451 0.139
NP_441431.1_2 Forward -87 -73 13.1753 0.0952
NP_441431.1_2 Forward -378 -364 11.7003 0.135
NP_441431.1_2 Reverse -72 -86 9.24208 0.19
NP_441431.1_2 Reverse -302 -316 8.16044 0.222
NP_441488.1_7 Forward -90 -71 15.7324 0.0543
NP_441488.1_8 Forward -319 -305 11.2087 0.146
NP_441488.1_8 Forward -89 -75 9.04542 0.169
NP_441993.1_1 Forward -320 -301 10.6204 0.124
NP_441993.1_1 Reverse -352 -371 6.0399 0.188
NP_441993.1_1 Reverse -360 -379 5.45515 0.201
NP_441993.1_1 Reverse -69 -88 5.35769 0.205
NP_441993.1_1 Reverse -75 -94 3.60346 0.231
NP_441993.1_1 Forward -63 -44 3.506 0.233
NP_441993.1_1 Reverse -305 -324 3.506 0.233
NP_442224.1_1 Reverse -73 -92 -4.42544 0.233
NP_441174.1_2 Forward -87 -73 19.8624 0.00567
NP_440467.1_8 Reverse -234 -253 10.1275 0.289
NP_440114.1_10 Forward -314 -300 8.55439 0.2
NP_440114.1_10 Forward -375 -361 8.35772 0.207
NP_440114.1_10 Reverse -358 -372 8.06273 0.217
NP_440114.1_10 Forward -84 -70 6.88276 0.253
NP_442323.1_7 Forward -89 -70 6.29183 0.195
NP_441500.1_8 Forward -296 -282 18.2053 0.261
NP_440287.1_6 Reverse -66 -85 1.96607 0.257
NP_440293.1_3 Reverse -364 -383 13.5691 0.104
NP_440293.1_3 Reverse -73 -92 0.58944 0.216
NP_440293.1_3 Reverse -350 -369 -5.9004 0.285
NP_440293.1_10 Reverse -355 -374 0.392778 0.219
NP_440766.1_4 Reverse -71 -85 8.35772 0.0871
NP_440766.1_4 Forward -88 -74 7.76774 0.0871
NP_439988.1_3 Reverse -367 -381 9.5377 0.247
NP_439988.1_3 Forward -80 -66 7.57108 0.274
NP_439988.1_3 Reverse -354 -368 4.22782 0.295
NP_439988.1_4 Forward -91 -72 19.174 0.125
NP_441237.1_9 Reverse -306 -316 14.828 0.0242
NP_441311.1_2 Forward -90 -76 12.192 0.236
NP_441133.1_1 Reverse -106 -125 12.0942 0.273
NP_439910.1_2 Reverse -297 -314 -21.6923 0.184
NP_440502.1_3 Reverse -4 -14 14.6665 0.209
NP_442867.1_8 Forward -253 -234 12.0942 0.197
NP_440457.1_1 Forward -88 -76 7.70879 0.101
NP_440457.1_1 Reverse -71 -83 5.34885 0.141
NP_440457.1_1 Reverse -301 -313 -0.649339 0.271
NP_440798.1_2 Forward -361 -347 15.3386 0.235
NP_440798.1_6 Forward -83 -70 3.85419 0.147
NP_441984.1_3 Reverse -301 -319 9.95058 0.195
NP_441984.1_6 Reverse -240 -252 15.3786 0.219
NP_441332.1_6 Forward -360 -350 13.0021 0.197
NP_441436.1_2 Reverse -26 -45 -3.73712 0.28
NP_441436.1_6 Forward -84 -65 14.8474 0.152
NP_440473.1_1 Forward -258 -239 13.5712 0.188
NP_440473.1_1 Forward -378 -359 12.7999 0.213
NP_440473.1_1 Forward -119 -100 10.8718 0.289
NP_440473.1_9 Reverse -355 -374 1.96607 0.0985
NP_442509.1_9 Forward -84 -74 16.2041 0.00739
NP_442509.1_9 Forward -314 -304 8.14104 0.192
NP_442509.1_9 Reverse -305 -315 8.14104 0.192
NP_442509.1_9 Reverse -75 -85 8.04271 0.192
NP_440660.1_7 Reverse -376 -395 -3.04881 0.298
NP_441496.1_3 Forward -160 -141 18.9765 0.113
NP_440734.1_9 Reverse -65 -84 16.5191 0.144
NP_440554.1_4 Reverse -76 -86 17.9746 0.0131
NP_440554.1_4 Forward -83 -73 13.943 0.0218
NP_440554.1_4 Forward -313 -303 8.92815 0.0646
NP_440554.1_4 Reverse -367 -377 7.35486 0.103
NP_441325.1_3 Reverse -288 -307 8.35759 0.3
NP_441885.1_5 Forward -314 -304 20.9245 0.000538
NP_441885.1_5 Reverse -305 -315 20.9245 0.000538
NP_441885.1_5 Forward -84 -74 11.4848 0.00668
NP_441885.1_5 Reverse -75 -85 11.3864 0.00668
NP_441885.1_5 Forward -116 -106 2.04498 0.0868
NP_442228.1_8 Reverse -15 -34 13.4708 0.289
NP_440478.1_9 Forward -92 -73 7.96426 0.278
NP_440478.1_10 Reverse -73 -87 14.5526 0.107
NP_442341.1_7 Reverse -304 -318 18.0925 0.0111
NP_442341.1_7 Forward -85 -71 13.5693 0.0338
NP_442341.1_7 Reverse -74 -88 1.67122 0.282
NP_442341.1_7 Forward -315 -301 1.47456 0.288
NP_442341.1_9 Reverse -303 -317 10.717 0.133
NP_442341.1_9 Reverse -164 -178 7.96378 0.182
NP_442341.1_9 Forward -118 -104 6.0955 0.243
NP_442341.1_9 Forward -145 -131 5.89884 0.252
NP_442341.1_9 Forward -263 -249 5.1122 0.279
NP_441756.1_5 Reverse -71 -90 13.4708 0.0932
NP_441756.1_5 Forward -145 -126 -1.57384 0.258
NP_441756.1_5 Forward -88 -69 -4.52377 0.295
NP_441173.1_9 Forward -207 -199 10.1471 0.261
NP_442395.2_4 Forward -23 -4 0.981987 0.255
NP_442395.2_4 Reverse -311 -330 -0.0996487 0.282
NP_440423.1_6 Reverse -297 -316 -5.40875 0.134
NP_440423.1_6 Reverse -350 -369 -19.9617 0.248
NP_440423.1_6 Reverse -67 -86 -20.7484 0.268
NP_443000.1_7 Forward -86 -76 20.3345 0.00223
NP_443000.1_7 Reverse -303 -313 19.9412 0.00223
NP_443000.1_7 Forward -316 -306 10.3048 0.0345
NP_443000.1_7 Forward -118 -108 7.74818 0.0666
NP_443000.1_7 Reverse -73 -83 2.04498 0.226
NP_443000.1_7 Reverse -250 -260 1.94665 0.226
NP_442513.1_5 Reverse -67 -86 8.06178 0.274
NP_441842.1_10 Reverse -68 -82 18.1908 0.0173
NP_441842.1_10 Forward -321 -307 8.75105 0.211
NP_440275.1_3 Reverse -73 -83 17.9746 0.0082
NP_440275.1_3 Forward -86 -76 16.1063 0.0155
NP_440275.1_3 Reverse -303 -313 15.123 0.0182
NP_440275.1_3 Forward -316 -306 8.04317 0.0602
NP_440091.1_1 Reverse -71 -83 12.6253 0.0353
NP_440091.1_1 Reverse -301 -313 8.88877 0.0567
NP_440091.1_1 Forward -318 -306 1.31728 0.198
NP_440679.1_10 Forward -231 -212 -18.9784 0.279
NP_441359.1_5 Forward -87 -68 0.58944 0.29
NP_442451.1_2 Reverse -67 -86 -0.39387 0.158
NP_439962.1_4 Forward -383 -364 8.45592 0.134
NP_439962.1_4 Forward -92 -73 3.6377 0.187
NP_439962.1_4 Reverse -67 -86 3.04771 0.195
NP_439962.1_4 Reverse -211 -230 -0.197208 0.197
NP_439962.1_4 Reverse -64 -83 -6.78538 0.285
NP_440175.1_4 Reverse -73 -92 -9.93197 0.171
NP_440175.1_4 Reverse -364 -383 -11.3086 0.186
NP_440175.1_7 Reverse -71 -89 9.07034 0.282
NP_442495.1_4 Reverse -111 -121 16.303 0.0771
NP_442495.1_4 Reverse -79 -89 14.4347 0.16
NP_440149.1_8 Reverse -305 -324 1.96607 0.116
NP_440149.1_8 Reverse -330 -349 1.47442 0.124
NP_440149.1_8 Reverse -75 -94 -3.3438 0.187
NP_442214.1_1 Reverse -10 -29 7.57094 0.298
NP_441105.1_3 Forward -95 -76 4.42435 0.0794
NP_441105.1_3 Forward -325 -306 0.982764 0.118
NP_441105.1_3 Reverse -300 -319 -4.42544 0.2
NP_441105.1_3 Reverse -241 -260 -6.78538 0.241
NP_440216.1_1 Forward -84 -70 8.25939 0.0061
NP_440216.1_1 Forward -314 -300 8.06273 0.0068
NP_440216.1_1 Reverse -75 -89 7.27608 0.00942
NP_440216.1_1 Reverse -107 -121 -2.26202 0.0484
NP_440216.1_1 Reverse -134 -148 -3.83532 0.09
NP_440216.1_1 Reverse -305 -319 -9.63684 0.145
NP_440216.1_6 Reverse -68 -84 4.87675 0.189
NP_440172.1_1 Reverse -75 -85 17.5813 0.00421
NP_440172.1_1 Forward -314 -304 15.0247 0.00945
NP_440172.1_1 Reverse -305 -315 15.0247 0.00945
NP_440172.1_1 Forward -84 -74 8.73149 0.0586
NP_440172.1_1 Reverse -366 -376 7.45319 0.0789
NP_440172.1_1 Reverse -246 -256 6.17489 0.11
NP_440172.1_1 Reverse -252 -262 3.42162 0.228
NP_440172.1_1 Forward -116 -106 2.43831 0.279
NP_440172.1_1 Forward -339 -329 2.04498 0.286
NP_440167.1_3 Reverse -65 -84 9.53756 0.251
NP_442015.1_10 Forward -88 -75 13.4906 0.0354
NP_442015.1_10 Forward -318 -305 11.3273 0.0372
NP_442015.1_10 Reverse -103 -116 8.08242 0.0725
NP_442015.1_10 Reverse -71 -84 3.95252 0.178
NP_442015.1_10 Reverse -301 -314 2.87088 0.187
NP_442015.1_10 Forward -120 -107 1.10092 0.213
NP_441226.1_7 Forward -313 -306 14.4934 0.0123
NP_441226.1_7 Reverse -306 -313 14.4934 0.0123
NP_441226.1_7 Forward -83 -76 14.4934 0.0123
NP_441226.1_7 Reverse -76 -83 14.4934 0.0123
NP_441226.1_7 Reverse -238 -245 6.52862 0.253
NP_442222.1_3 Forward -153 -134 11.1109 0.299
NP_441111.1_7 Forward -313 -305 18.7023 0.00294
NP_441111.1_7 Forward -83 -75 18.7023 0.00294
NP_441111.1_7 Reverse -306 -314 18.7023 0.00294
NP_441111.1_7 Reverse -76 -84 18.7023 0.00294
NP_442379.1_10 Reverse -68 -85 -3.10775 0.248
NP_441766.1_2 Forward -314 -305 17.5026 0.00297
NP_441766.1_2 Reverse -305 -314 17.5026 0.00297
NP_441766.1_2 Forward -84 -75 17.5026 0.00297
NP_441766.1_2 Reverse -75 -84 17.5026 0.00297
NP_442417.1_5 Reverse -75 -89 6.98109 0.197
NP_440416.1_1 Forward -314 -295 -4.22878 0.128
NP_440416.1_1 Reverse -75 -94 -14.3569 0.287
NP_440416.1_9 Reverse -68 -87 -5.11376 0.0791
NP_440416.1_9 Forward -91 -72 -5.21209 0.0791
NP_440416.1_9 Forward -321 -302 -5.9004 0.0846
NP_440416.1_9 Forward -150 -131 -7.17871 0.0972
NP_440416.1_9 Forward -262 -243 -13.7669 0.169
NP_440416.1_9 Reverse -100 -119 -19.0768 0.269
NP_443052.1_8 Reverse -65 -84 13.6675 0.011
NP_443052.1_9 Reverse -58 -77 -5.50708 0.271
NP_441940.1_4 Reverse -244 -263 10.8159 0.266
NP_442154.1_1 Reverse -364 -382 -14.7305 0.218
NP_441430.1_6 Reverse -70 -89 15.1424 0.153
NP_440261.1_5 Forward -83 -70 -1.06236 0.0655
NP_440261.1_5 Reverse -76 -89 -2.73398 0.0924
NP_440261.1_5 Forward -254 -241 -4.40561 0.147
NP_440261.1_5 Forward -313 -300 -4.60227 0.158
NP_440261.1_5 Forward -374 -361 -12.1738 0.272
NP_440988.1_2 Reverse -220 -238 7.4923 0.299
NP_440988.1_10 Forward -31 -17 6.93189 0.228
NP_440988.1_10 Reverse -328 -342 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCAAGCTTTAACCTTAGCCGCCCAAGCCATGGCCCCATTGCCCCATCCTCCCAAACTGTTGGCCATTACCTTGCTCACTAGCATTGGCGATCGCCAGTTACGGGAAGAGTTACAACAACCCTTAGCCGTGGATGATTACGTCAACGCCATGGCCCGGTTGGCCCGAAATGCTGGCATTGATGGAGCGGTGTGTTCCCCCCAGGAAGTGGCTAAACTGAGGCAAACCTGCGGCCCTGAATTTTTACTGGTTACCCCCGGCGTGCGGCCTCTCTGGTCGGCCCCAGGCGATCAACAACGGGTCATGATTCCCGCCCAGGCGATCGCCGCTGGGGCCAATTATGTGGTCATTGGTCGACCCATCACTGCTGATCCTAGTCCCGAAGCCGCTTGGGAAAGATT

CDS

ATGCCAAGACCTTGCTGTTTAAAATTGTTGGGCTTCTCCTCGGTAGTCAAATTTGGCCTATCTGTCACTGGCTTTGCCTTGATATTGGTCACAGGCCTGGGTTTAAGCTCCGCCCAAGCCAGAAATAGCCGCTCCCCCAACGGAGGCCACTGCCAACAACCGTTAGCGGAATTGATGCCCCCCCTACTGGACGCACTGCCCAGTTATACCAATCGGGTCATGCAACGGAGTCAAATTGGTGGCGTTCCTTTGAGAACTTACATTTTGATTGCTGGCAATGCGGATTTTGATCCCCTGCCCCTAGCTCAACAACAGTGGCAAACGGAAGTACCGGATACCACTAAACAGGTTTTTTTCACCACCCTGGAAAGAAGCTACACCGACCAACGGGCGATCGCCAGCCAGAATTTTTACTGGGCATTTTTTGTGCAAACGGAGCAGGGTTGGCAATTGGCCTTACTGTACCAACAATTAGGGGGAAGCTCCCCGGATCAGCCCCCTTCTCCCCGACGGGATGCCAGCACCGGGGCGATCGCCCAAGGCATTCGTTTATGGTTGAGGGATTGTCAGGCAGGGGTATTTGCTGCTAGTTGA

Protein

MPRPCCLKLLGFSSVVKFGLSVTGFALILVTGLGLSSAQARNSRSPNGGHCQQPLAELMPPLLDALPSYTNRVMQRSQIGGVPLRTYILIAGNADFDPLPLAQQQWQTEVPDTTKQVFFTTLERSYTDQRAIASQNFYWAFFVQTEQGWQLALLYQQLGGSSPDQPPSPRRDASTGAIAQGIRLWLRDCQAGVFAAS