Your browser is old and dusty. Try Google Chrome!

Details for sll0838

ORF sll0838
Accession NP_441133.1
Symbol pyrF
Category Pyrimidine ribonucleotide biosynthesis
Definition orotidine 5' monophosphate decarboxylase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -262 -248 17.9942 0.0206
NP_441061.1_2 Reverse -243 -257 -1.67204 0.269
NP_440557.1_1 Forward -262 -243 13.0775 0.0759
NP_440795.1_7 Forward -262 -255 14.6904 0.0123
NP_440795.1_7 Reverse -255 -262 14.6904 0.0123
NP_441418.1_6 Forward -263 -244 -0.885524 0.0111
NP_441418.1_6 Reverse -254 -273 -29.5982 0.23
NP_441418.1_6 Reverse -261 -280 -30.5815 0.286
NP_440815.1_5 Reverse -254 -273 8.55425 0.237
NP_442291.1_5 Reverse -253 -269 4.28677 0.0943
NP_441453.1_1 Reverse -247 -265 10.3431 0.135
NP_441453.1_4 Reverse -254 -262 16.539 0.00633
NP_441453.1_4 Forward -263 -255 16.539 0.00633
NP_441453.1_7 Reverse -57 -64 13.4121 0.23
NP_441623.1_1 Reverse -319 -337 -3.42244 0.258
NP_442151.1_6 Reverse -254 -268 17.6008 0.00997
NP_442151.1_6 Forward -263 -249 7.17775 0.206
NP_442151.1_6 Forward -257 -243 5.30946 0.284
NP_441818.1_1 Reverse -255 -266 10.1862 0.232
NP_440226.1_1 Reverse -254 -273 17.8957 0.0175
NP_440226.1_1 Forward -263 -244 8.65258 0.0836
NP_441630.1_3 Forward -271 -252 25.6638 0.00476
NP_440996.1_3 Forward -264 -246 10.7372 0.247
NP_443002.1_5 Forward -34 -16 10.9331 0.256
NP_442173.1_1 Forward -262 -254 15.4574 0.00633
NP_442173.1_1 Reverse -255 -263 15.4574 0.00633
NP_442752.1_4 Forward -263 -256 13.8055 0.0199
NP_442752.1_4 Reverse -254 -261 13.8055 0.0199
NP_443027.1_4 Reverse -252 -262 14.828 0.0437
NP_441812.1_3 Forward -264 -250 8.06273 0.254
NP_442975.1_10 Reverse -250 -264 14.0603 0.0459
NP_442975.1_10 Forward -267 -253 2.45727 0.274
NP_440784.1_7 Forward -262 -255 15.9687 0.0123
NP_440784.1_7 Reverse -255 -262 15.9687 0.0123
NP_439979.1_7 Forward -105 -88 13.7068 0.267
NP_442062.1_8 Forward -263 -253 19.4496 0.000558
NP_442062.1_8 Reverse -254 -264 17.3846 0.00193
NP_440304.1_4 Reverse -252 -262 10.8948 0.051
NP_440304.1_4 Reverse -318 -328 5.68323 0.196
NP_440304.1_4 Forward -265 -255 1.84832 0.299
NP_442242.1_4 Forward -262 -255 14.3954 0.0124
NP_442242.1_4 Reverse -255 -262 14.3954 0.0124
NP_440044.1_8 Reverse -255 -274 3.93269 0.124
NP_441208.1_9 Forward -266 -252 11.5043 0.15
NP_441594.1_6 Reverse -245 -264 1.67108 0.264
NP_440132.1_1 Forward -265 -247 8.7706 0.263
NP_442110.1_7 Forward -263 -249 12.0943 0.0586
NP_442110.1_7 Reverse -254 -268 0.0979218 0.267
NP_440300.1_1 Reverse -129 -148 7.96345 0.255
NP_441083.1_5 Reverse -254 -264 20.3345 0.00053
NP_441083.1_5 Forward -263 -253 11.3864 0.0159
NP_442827.1_8 Forward -271 -252 -1.27961 0.245
NP_441149.1_9 Forward -36 -17 0.392004 0.239
NP_441434.1_7 Reverse -256 -270 2.85119 0.268
NP_441738.1_2 Forward -261 -254 15.28 0.0102
NP_441738.1_2 Reverse -256 -263 15.28 0.0102
NP_441558.1_5 Forward -265 -246 5.99764 0.232
NP_440209.1_1 Reverse -254 -262 18.1123 0.00295
NP_440209.1_1 Forward -263 -255 18.1123 0.00295
NP_442136.1_4 Reverse -349 -368 4.91521 0.295
NP_442889.1_8 Reverse -251 -265 13.5686 0.0588
NP_442889.1_8 Reverse -132 -146 7.66879 0.143
NP_442889.1_8 Forward -377 -363 6.39049 0.192
NP_440447.1_6 Forward -150 -132 4.14905 0.18
NP_440178.1_7 Reverse -253 -272 -15.3402 0.161
NP_440178.1_7 Forward -264 -245 -20.65 0.196
NP_440178.1_7 Reverse -205 -224 -22.6167 0.268
NP_441716.1_1 Forward -263 -249 3.63784 0.259
NP_441327.1_5 Forward -339 -330 16.6177 0.111
NP_442111.1_4 Forward -264 -250 19.6658 0.00373
NP_440343.1_1 Forward -162 -143 13.3725 0.218
NP_440906.1_5 Forward -262 -255 15.8704 0.0124
NP_440906.1_5 Reverse -255 -262 15.8704 0.0124
NP_441209.1_8 Forward -311 -293 7.59982 0.275
NP_440747.1_10 Forward -266 -254 14.9853 0.00221
NP_440747.1_10 Reverse -251 -263 7.70879 0.00236
NP_441130.1_10 Reverse -252 -266 10.9143 0.109
NP_441486.1_1 Forward -266 -252 20.0591 0.00312
NP_441486.1_1 Reverse -251 -265 13.7659 0.00763
NP_441486.1_1 Forward -332 -318 -2.85201 0.175
NP_442634.1_4 Forward -265 -251 -1.67204 0.149
NP_441014.1_10 Forward -264 -245 10.4217 0.118
NP_442848.1_1 Reverse -248 -262 -2.26202 0.263
NP_441012.1_4 Reverse -91 -104 11.229 0.252
NP_441012.1_4 Reverse -250 -263 7.19745 0.272
NP_443018.1_3 Forward -262 -255 14.8871 0.0123
NP_443018.1_3 Reverse -255 -262 14.8871 0.0123
NP_441634.1_8 Forward -265 -251 -3.147 0.295
NP_441634.1_8 Reverse -265 -279 -4.4253 0.295
NP_440376.1_1 Forward -263 -254 19.4693 0.000692
NP_440376.1_1 Reverse -254 -263 19.4693 0.000692
NP_441857.1_5 Forward -270 -252 7.98396 0.185
NP_441588.1_4 Reverse -256 -266 18.1713 0.0143
NP_442687.1_7 Reverse -253 -263 15.8113 0.0125
NP_442687.1_7 Forward -264 -254 8.92815 0.0994
NP_442191.1_4 Forward -262 -248 16.6166 0.034
NP_440533.1_9 Forward -263 -244 15.4374 0.0735
NP_440667.1_2 Reverse -317 -336 -8.06369 0.289
NP_441763.1_10 Reverse -243 -262 5.60352 0.284
NP_442658.1_1 Reverse -252 -262 15.9091 0.00966
NP_442658.1_1 Forward -265 -255 6.76441 0.214
NP_442161.1_7 Forward -39 -20 7.17762 0.184
NP_442782.1_2 Forward -263 -249 10.521 0.173
NP_441414.1_9 Forward -263 -244 -5.11376 0.169
NP_439959.1_3 Forward -70 -51 12.7825 0.215
NP_442937.1_5 Forward -268 -249 12.7825 0.101
NP_441958.1_5 Forward -264 -254 12.2714 0.00183
NP_441958.1_5 Reverse -253 -263 12.2714 0.00183
NP_442486.1_6 Reverse -242 -261 -5.80207 0.279
NP_440203.1_5 Reverse -245 -255 14.2375 0.0886
NP_440995.1_8 Forward -273 -254 8.25926 0.264
NP_440984.1_7 Forward -268 -254 15.0442 0.0615
NP_439990.1_5 Forward -149 -136 6.80412 0.221
NP_442911.1_2 Reverse -244 -263 22.4189 0.00418
NP_440858.1_1 Forward -167 -148 -5.40875 0.281
NP_443055.1_6 Forward -271 -253 1.5917 0.227
NP_443055.1_6 Reverse -164 -182 -0.473239 0.261
NP_440388.1_7 Forward -232 -213 3.04771 0.251
NP_441129.1_8 Forward -71 -52 14.1591 0.195
NP_441099.1_5 Reverse -244 -263 -0.295539 0.0908
NP_442002.1_9 Reverse -253 -260 10.7572 0.185
NP_441294.1_7 Forward -267 -253 9.25063 0.256
NP_440411.1_10 Forward -265 -246 10.2617 0.275
NP_441646.1_1 Reverse -247 -266 2.3594 0.218
NP_442438.1_10 Reverse -249 -263 20.0591 0.0124
NP_442438.1_10 Forward -268 -254 -0.0987402 0.248
NP_441000.1_6 Reverse -253 -267 3.63784 0.108
NP_442771.1_1 Forward -265 -247 2.67408 0.0677
NP_440147.1_4 Forward -265 -252 10.049 0.0355
NP_440147.1_4 Reverse -252 -265 3.46087 0.187
NP_441175.1_7 Forward -263 -244 5.30933 0.283
NP_441550.1_8 Forward -265 -255 14.6309 0.0132
NP_441550.1_8 Reverse -252 -262 6.0761 0.214
NP_441916.1_7 Forward -263 -253 18.4663 0.00144
NP_441916.1_7 Reverse -254 -264 10.3048 0.0261
NP_441916.1_10 Reverse -246 -265 16.8141 0.0888
NP_440206.1_4 Reverse -244 -263 -2.45958 0.298
NP_441041.1_4 Forward -263 -244 23.6972 0.00403
NP_441041.1_4 Reverse -14 -33 1.37609 0.0808
NP_441041.1_4 Forward -144 -125 -12.7836 0.274
NP_441041.1_7 Forward -266 -254 11.8878 0.0689
NP_441041.1_7 Reverse -251 -263 7.61196 0.162
NP_442004.1_6 Forward -263 -249 10.0294 0.14
NP_441725.1_4 Reverse -249 -263 2.94893 0.279
NP_441725.1_5 Forward -262 -252 11.2881 0.0247
NP_441725.1_5 Reverse -255 -265 2.04498 0.115
NP_441725.1_5 Forward -328 -318 -0.806614 0.271
NP_439966.1_7 Reverse -252 -262 18.4657 0.00473
NP_439966.1_7 Forward -265 -255 7.25606 0.15
NP_439966.1_9 Reverse -252 -261 0.983037 0.253
NP_442941.1_3 Forward -262 -252 11.4848 0.0116
NP_442941.1_3 Reverse -255 -265 11.0914 0.0116
NP_440289.1_2 Reverse -251 -264 11.819 0.0171
NP_440289.1_2 Forward -266 -253 -2.144 0.251
NP_440802.1_8 Forward -373 -354 15.4374 0.278
NP_442281.1_1 Reverse -249 -263 18.4851 0.0043
NP_442281.1_1 Forward -268 -254 17.8952 0.00513
NP_442575.1_8 Reverse -57 -76 -4.32711 0.261
NP_440437.1_1 Reverse -248 -267 6.68596 0.0724
NP_440437.1_9 Forward -391 -372 5.40766 0.244
NP_441556.1_4 Reverse -245 -264 15.3075 0.16
NP_440498.1_1 Reverse -245 -263 8.96727 0.0786
NP_442982.1_5 Reverse -244 -263 -2.75381 0.289
NP_441644.1_6 Reverse -254 -264 17.3841 0.00127
NP_441644.1_6 Forward -263 -253 10.1076 0.0628
NP_441644.1_6 Forward -257 -247 6.56775 0.154
NP_442215.1_2 Reverse -252 -268 7.92501 0.0666
NP_442215.1_2 Forward -265 -249 6.54838 0.0702
NP_442215.1_2 Forward -74 -58 -6.62797 0.277
NP_442029.1_6 Forward -268 -249 7.47261 0.224
NP_440253.1_2 Reverse -254 -272 -1.45582 0.242
NP_440929.1_8 Forward -263 -254 19.2726 0.000701
NP_440929.1_8 Reverse -254 -263 19.2726 0.000701
NP_442933.1_10 Forward -263 -254 17.601 0.00325
NP_442933.1_10 Reverse -254 -263 17.601 0.00325
NP_441751.2_8 Forward -262 -248 -1.5737 0.129
NP_442926.1_5 Reverse -249 -268 11.241 0.221
NP_442554.1_8 Reverse -255 -265 15.3197 0.00882
NP_442554.1_8 Forward -262 -252 13.8447 0.0145
NP_441762.1_7 Reverse -253 -265 9.57708 0.0142
NP_441762.1_7 Forward -264 -252 2.89058 0.0676
NP_441762.1_7 Forward -223 -211 -6.74586 0.284
NP_442142.1_4 Reverse -251 -264 17.1282 0.0264
NP_442142.1_4 Forward -266 -253 13.49 0.0348
NP_442142.1_4 Reverse -245 -258 3.65697 0.248
NP_442292.1_1 Reverse -255 -264 18.486 0.00229
NP_442292.1_1 Forward -262 -253 9.63616 0.0183
NP_440919.1_7 Forward -39 -21 7.47548 0.228
NP_441899.1_4 Forward -395 -376 18.0924 0.233
NP_441024.1_7 Reverse -230 -248 9.6548 0.287
NP_442381.1_8 Forward -266 -247 -15.1435 0.298
NP_441711.1_4 Forward -272 -253 10.3242 0.13
NP_443009.1_5 Forward -264 -253 18.3477 0.00265
NP_442250.1_5 Reverse -164 -175 18.6427 0.108
NP_441715.1_4 Forward -262 -252 16.303 0.0117
NP_441715.1_4 Reverse -255 -265 7.94484 0.107
NP_440183.1_9 Reverse -91 -110 -12.7836 0.26
NP_441198.1_5 Reverse -256 -269 11.7201 0.255
NP_440379.1_5 Forward -107 -88 -9.53865 0.264
NP_440464.1_10 Reverse -255 -265 13.0082 0.169
NP_441468.1_1 Forward -262 -255 15.8704 0.0124
NP_441468.1_1 Reverse -255 -262 15.8704 0.0124
NP_441569.1_10 Forward -386 -368 19.6853 0.268
NP_441020.2_6 Forward -265 -248 18.5251 0.0115
NP_441020.2_6 Reverse -252 -269 7.02034 0.245
NP_441015.1_10 Reverse -50 -69 -9.63698 0.282
NP_441673.1_1 Forward -263 -254 20.8459 0.000698
NP_441673.1_1 Reverse -254 -263 20.8459 0.000698
NP_441826.1_2 Reverse -248 -262 4.03116 0.105
NP_441826.1_2 Forward -269 -255 -2.26202 0.269
NP_441330.1_1 Forward -268 -249 -2.85214 0.0791
NP_442490.1_9 Reverse -242 -261 -7.76869 0.278
NP_441764.1_8 Forward -339 -329 12.4592 0.284
NP_442868.1_6 Forward -265 -255 9.81313 0.038
NP_442868.1_6 Reverse -252 -262 0.963343 0.205
NP_442719.1_2 Reverse -42 -60 -10.1096 0.269
NP_441056.1_1 Forward -263 -244 -5.21209 0.257
NP_441612.1_2 Reverse -254 -264 8.54929 0.21
NP_443058.1_7 Forward -264 -245 7.17762 0.233
NP_442361.1_3 Reverse -248 -261 18.0139 0.0481
NP_442361.1_3 Forward -269 -256 8.47575 0.285
NP_442808.1_1 Reverse -253 -263 18.4657 0.00201
NP_442808.1_1 Forward -264 -254 8.63269 0.0481
NP_442808.1_1 Forward -278 -268 3.32285 0.244
NP_442808.1_1 Forward -206 -196 3.22451 0.247
NP_440596.1_2 Reverse -372 -386 19.6658 0.0118
NP_440145.1_3 Forward -225 -206 2.45773 0.118
NP_442820.1_3 Forward -385 -375 14.9258 0.277
NP_442542.1_9 Forward -270 -256 4.62054 0.292
NP_442050.1_5 Reverse -252 -262 9.12434 0.193
NP_442050.1_5 Forward -265 -255 7.64939 0.243
NP_440558.1_2 Reverse -245 -264 2.26107 0.169
NP_441518.1_3 Forward -273 -254 -1.7705 0.111
NP_441518.1_3 Reverse -244 -263 -8.45701 0.186
NP_441878.1_6 Forward -264 -254 10.4031 0.0176
NP_441878.1_6 Reverse -253 -263 10.4031 0.0176
NP_441878.1_6 Reverse -319 -329 -7.19813 0.21
NP_441036.1_8 Reverse -253 -263 17.7779 0.000554
NP_441036.1_8 Forward -264 -254 8.33817 0.174
NP_442650.1_2 Forward -263 -249 6.98109 0.13
NP_441557.1_5 Forward -263 -254 19.9609 0.000699
NP_441557.1_5 Reverse -254 -263 19.9609 0.000699
NP_441445.1_1 Forward -272 -253 10.4225 0.0952
NP_441445.1_1 Reverse -245 -264 2.26107 0.238
NP_442419.1_2 Forward -268 -249 -3.04881 0.249
NP_441308.1_8 Reverse -252 -262 10.1081 0.22
NP_442469.1_8 Reverse -194 -208 18.3875 0.167
NP_442183.1_1 Forward -263 -249 16.9125 0.0129
NP_442166.1_7 Forward -262 -248 10.0294 0.19
NP_441574.1_1 Forward -263 -244 -5.80207 0.268
NP_442347.1_2 Reverse -255 -264 12.4878 0.056
NP_442347.1_2 Forward -262 -253 11.1111 0.056
NP_442645.1_2 Forward -223 -204 -12.6852 0.144
NP_442645.1_2 Reverse -246 -265 -14.7502 0.18
NP_442645.1_2 Forward -271 -252 -22.125 0.29
NP_442888.1_6 Forward -274 -255 10.1275 0.158
NP_442888.1_9 Forward -263 -244 13.1758 0.279
NP_441037.1_4 Forward -265 -255 7.9999 0.237
NP_441037.1_4 Reverse -252 -262 7.02532 0.237
NP_442594.1_10 Forward -29 -10 9.7334 0.28
NP_441633.1_3 Forward -265 -252 8.47575 0.0377
NP_441633.1_3 Reverse -252 -265 -3.71729 0.177
NP_441633.1_3 Forward -25 -12 -6.56889 0.259
NP_442764.1_6 Reverse -256 -274 11.3272 0.163
NP_440136.1_2 Forward -262 -255 15.9687 0.0123
NP_440136.1_2 Reverse -255 -262 15.9687 0.0123
NP_442998.1_5 Reverse -30 -40 14.0414 0.151
NP_442998.1_5 Forward -338 -328 12.7631 0.159
NP_442998.1_5 Forward -237 -227 12.0747 0.176
NP_442998.1_5 Forward -339 -329 9.61647 0.238
NP_442998.1_10 Forward -261 -254 15.5754 0.0102
NP_442998.1_10 Reverse -256 -263 15.5754 0.0102
NP_440899.1_8 Forward -39 -20 -9.73531 0.268
NP_440899.1_8 Forward -38 -19 -10.6203 0.281
NP_440299.1_1 Reverse -250 -263 20.1765 0.00128
NP_440299.1_1 Forward -27 -14 5.13193 0.187
NP_440299.1_1 Forward -267 -254 4.44361 0.207
NP_441799.1_1 Forward -267 -253 16.1252 0.0153
NP_441799.1_1 Reverse -250 -264 4.03056 0.269
NP_441007.1_10 Forward -268 -255 0.707601 0.219
NP_442201.1_10 Forward -274 -255 -5.01543 0.155
NP_442333.2_5 Forward -274 -255 -15.6352 0.299
NP_440256.1_1 Forward -266 -247 6.39097 0.0301
NP_440256.1_1 Reverse -251 -270 -0.39387 0.0928
NP_441559.1_8 Reverse -249 -263 2.5562 0.143
NP_441559.1_8 Reverse -222 -236 -6.39192 0.277
NP_440915.1_6 Reverse -250 -264 5.70279 0.0879
NP_441296.1_9 Forward -33 -20 19.4882 0.0761
NP_440748.1_5 Reverse -245 -264 2.65439 0.214
NP_440306.1_8 Reverse -293 -312 6.48849 0.204
NP_440695.1_5 Forward -263 -244 7.66927 0.15
NP_441939.1_3 Forward -262 -243 9.43923 0.145
NP_442993.1_1 Forward -263 -247 -8.98791 0.178
NP_442386.1_9 Reverse -253 -262 15.7322 0.0144
NP_442386.1_9 Forward -264 -255 13.8639 0.0289
NP_441750.1_4 Reverse -250 -269 7.47261 0.159
NP_441340.1_5 Forward -262 -255 15.6737 0.0124
NP_441340.1_5 Reverse -255 -262 15.6737 0.0124
NP_441340.1_9 Forward -339 -329 8.25522 0.256
NP_442791.1_5 Forward -271 -252 -10.522 0.279
NP_440168.1_4 Reverse -244 -263 -4.32711 0.255
NP_442240.1_2 Forward -262 -243 -14.3569 0.178
NP_441027.1_1 Reverse -161 -175 12.782 0.27
NP_440586.1_8 Forward -262 -255 13.2151 0.026
NP_440586.1_8 Reverse -255 -262 13.2151 0.026
NP_440586.1_8 Reverse -307 -314 5.93863 0.283
NP_442251.1_6 Forward -262 -255 15.2804 0.0124
NP_442251.1_6 Reverse -255 -262 15.2804 0.0124
NP_440192.1_5 Reverse -266 -285 8.35759 0.204
NP_440192.1_5 Forward -264 -245 7.37428 0.212
NP_441262.1_3 Reverse -254 -261 14.7888 0.0223
NP_441262.1_3 Forward -263 -256 14.7888 0.0223
NP_443051.1_1 Reverse -253 -262 10.4228 0.00754
NP_443051.1_1 Forward -264 -255 10.4228 0.00754
NP_441595.1_2 Forward -303 -290 8.36957 0.292
NP_443039.1_1 Reverse -222 -241 16.7157 0.205
NP_443039.1_7 Forward -34 -20 5.89884 0.205
NP_440439.1_1 Reverse -251 -264 8.37742 0.0537
NP_441522.1_2 Forward -284 -266 15.7521 0.187
NP_440372.1_2 Forward -262 -255 16.3621 0.0124
NP_440372.1_2 Reverse -255 -262 16.3621 0.0124
NP_442783.1_8 Reverse -137 -156 16.8132 0.183
NP_441789.1_7 Forward -70 -51 -5.01617 0.293
NP_440819.1_5 Forward -339 -331 7.68924 0.266
NP_441803.1_2 Reverse -249 -268 17.6007 0.0309
NP_439977.1_5 Reverse -248 -267 -2.95047 0.293
NP_440139.1_1 Forward -269 -250 4.81688 0.17
NP_442384.1_10 Forward -263 -250 15.7522 0.00946
NP_442384.1_10 Forward -215 -202 1.69091 0.249
NP_442384.1_10 Reverse -254 -267 1.10092 0.268
NP_442339.1_3 Forward -307 -289 11.8189 0.297
NP_441018.1_3 Reverse -230 -249 9.53674 0.294
NP_441018.1_7 Forward -267 -248 10.8159 0.194
NP_442262.1_10 Forward -262 -255 14.1988 0.0123
NP_442262.1_10 Reverse -255 -262 14.1988 0.0123
NP_441689.1_5 Reverse -252 -262 8.53436 0.132
NP_441689.1_5 Forward -265 -255 5.78111 0.197
NP_440163.1_10 Reverse -251 -261 16.303 0.0762
NP_440344.1_10 Reverse -247 -264 11.0519 0.00647
NP_440344.1_10 Forward -270 -253 -3.20608 0.0802
NP_440531.1_6 Forward -271 -252 8.45592 0.0844
NP_440531.1_8 Forward -389 -370 7.57094 0.221
NP_441060.1_1 Reverse -287 -306 11.5967 0.294
NP_442750.1_3 Forward -176 -157 -10.3253 0.236
NP_440297.1_9 Forward -262 -252 9.32148 0.0917
NP_440297.1_9 Forward -328 -318 0.176696 0.282
NP_440297.1_9 Reverse -255 -265 -0.118297 0.282
NP_442280.1_10 Forward -33 -15 5.74663 0.283
NP_442378.1_7 Reverse -135 -148 19.2915 0.171
NP_440999.1_2 Reverse -249 -268 13.6675 0.177
NP_440999.1_9 Reverse -250 -264 13.1759 0.0329
NP_440999.1_9 Forward -65 -51 -0.000409212 0.195
NP_440888.1_2 Forward -263 -249 15.8302 0.00862
NP_440888.1_2 Reverse -254 -268 10.3237 0.0974
NP_440600.1_4 Forward -271 -253 -1.25915 0.163
NP_440491.1_1 Reverse -251 -270 12.4721 0.151
NP_440491.1_1 Forward -266 -247 8.18396 0.249
NP_440491.1_9 Forward -355 -336 7.27595 0.147
NP_441543.1_2 Forward -262 -253 18.486 0.00236
NP_441543.1_2 Reverse -255 -264 16.9127 0.00359
NP_442845.1_2 Forward -263 -249 7.07942 0.199
NP_442845.1_2 Forward -187 -173 4.32615 0.261
NP_442845.1_2 Forward -269 -255 3.63784 0.282
NP_441551.1_5 Reverse -196 -212 12.2509 0.157
NP_441319.1_3 Reverse -142 -161 12.6841 0.256
NP_441469.1_8 Reverse -253 -262 16.126 0.00797
NP_441469.1_8 Forward -264 -255 6.48957 0.227
NP_442315.1_2 Reverse -94 -106 10.8554 0.291
NP_443064.1_6 Reverse -254 -264 12.5669 0.0796
NP_442578.1_7 Forward -262 -255 14.5921 0.026
NP_442578.1_7 Reverse -255 -262 14.5921 0.026
NP_440220.1_4 Forward -36 -17 -1.37794 0.264
NP_441462.1_2 Forward -263 -253 11.5831 0.00406
NP_441462.1_2 Reverse -254 -264 11.5831 0.00406
NP_441621.1_7 Forward -265 -251 -3.44199 0.188
NP_443062.1_1 Forward -263 -245 15.2739 0.0395
NP_442204.1_1 Reverse -250 -261 9.69511 0.0736
NP_440516.1_8 Forward -263 -254 16.9127 0.00442
NP_440516.1_8 Reverse -254 -263 16.9127 0.00442
NP_442428.1_4 Forward -264 -245 5.60432 0.211
NP_442428.1_5 Forward -262 -255 15.8704 0.0124
NP_442428.1_5 Reverse -255 -262 15.8704 0.0124
NP_441790.1_3 Forward -262 -243 4.32602 0.113
NP_440673.1_3 Forward -261 -254 12.4288 0.0426
NP_440673.1_3 Reverse -256 -263 12.4288 0.0426
NP_441052.1_2 Reverse -254 -264 19.9412 0.00106
NP_441052.1_2 Forward -263 -253 10.5014 0.0285
NP_441052.1_2 Forward -374 -364 0.963343 0.255
NP_440992.1_2 Forward -227 -208 8.94757 0.279
NP_442219.1_8 Forward -339 -320 8.26374 0.251
NP_442219.1_9 Reverse -255 -264 17.7976 0.00718
NP_442219.1_9 Forward -262 -253 8.35786 0.0681
NP_440436.1_4 Forward -262 -253 18.1905 0.00233
NP_440436.1_4 Reverse -255 -264 17.2072 0.00233
NP_441884.1_9 Reverse -251 -270 -12.8819 0.138
NP_441719.1_4 Forward -262 -255 16.3621 0.0124
NP_441719.1_4 Reverse -255 -262 16.3621 0.0124
NP_441733.1_10 Forward -266 -253 9.85238 0.106
NP_441004.1_1 Forward -269 -250 -14.9469 0.271
NP_442813.1_5 Forward -45 -26 7.17762 0.196
NP_442366.1_3 Forward -264 -246 5.03403 0.0899
NP_442366.1_3 Reverse -253 -271 2.47742 0.129
NP_442366.1_5 Forward -266 -256 14.8275 0.0375
NP_440129.1_10 Reverse -247 -261 6.6861 0.177
NP_442873.1_3 Reverse -244 -263 14.6499 0.105
NP_440296.1_10 Reverse -251 -270 -13.6686 0.269
NP_442206.1_10 Forward -263 -248 4.60145 0.178
NP_440094.1_9 Forward -264 -245 -1.7705 0.207
NP_443054.1_2 Reverse -252 -266 11.3077 0.0761
NP_443054.1_2 Forward -272 -258 -0.393733 0.294
NP_442430.1_10 Reverse -244 -263 15.2399 0.127
NP_441851.1_10 Reverse -253 -263 16.008 0.00552
NP_441851.1_10 Forward -264 -254 15.8113 0.00552
NP_442856.1_7 Reverse -245 -264 -2.45882 0.236
NP_442515.1_1 Forward -264 -250 -4.81863 0.298
NP_440593.1_3 Forward -268 -249 7.47261 0.109
NP_441982.1_6 Forward -159 -150 15.2546 0.274
NP_441046.1_2 Forward -139 -120 1.0811 0.261
NP_440940.1_7 Reverse -244 -262 14.178 0.0779
NP_441349.1_10 Forward -273 -254 -7.86702 0.261
NP_441409.1_6 Reverse -314 -333 -1.47551 0.0765
NP_441409.1_6 Reverse -248 -267 -6.98204 0.14
NP_440432.1_9 Reverse -255 -270 9.02635 0.0427
NP_440432.1_9 Forward -121 -106 -5.23164 0.241
NP_442843.1_1 Reverse -26 -45 -10.522 0.278
NP_440431.1_3 Reverse -147 -166 -3.3438 0.178
NP_442450.1_5 Reverse -252 -262 9.32148 0.115
NP_442450.1_5 Forward -265 -255 7.55152 0.13
NP_441570.1_1 Reverse -254 -272 8.47561 0.0138
NP_441570.1_1 Forward -263 -245 -0.177514 0.0437
NP_440078.1_10 Forward -263 -244 6.09597 0.224
NP_441078.1_4 Forward -263 -254 19.6659 0.0007
NP_441078.1_4 Reverse -254 -263 19.6659 0.0007
NP_442729.1_8 Reverse -250 -263 8.08242 0.125
NP_441663.1_8 Forward -68 -49 -1.08219 0.239
NP_440526.1_3 Reverse -255 -266 10.2846 0.0646
NP_440526.1_3 Reverse -214 -225 7.53132 0.143
NP_441432.1_8 Forward -264 -255 16.8143 0.00595
NP_441432.1_8 Reverse -253 -262 8.25953 0.0755
NP_442320.1_8 Reverse -248 -262 6.88276 0.0227
NP_442320.1_8 Forward -269 -255 3.93283 0.0564
NP_442344.1_7 Forward -262 -243 -8.85033 0.229
NP_441732.1_2 Reverse -250 -266 1.92682 0.0254
NP_442343.1_1 Forward -280 -261 17.0107 0.271
NP_440760.1_1 Forward -263 -244 -9.047 0.082
NP_442797.1_7 Forward -223 -205 -0.570838 0.284
NP_440199.1_10 Forward -266 -256 7.25653 0.231
NP_441072.1_2 Forward -274 -255 10.5209 0.2
NP_440713.1_4 Reverse -244 -263 3.24438 0.248
NP_442489.1_7 Forward -263 -254 20.1576 0.000695
NP_442489.1_7 Reverse -254 -263 20.1576 0.000695
NP_440559.1_1 Reverse -255 -264 17.4043 0.00658
NP_440559.1_1 Forward -262 -253 8.75118 0.0586
NP_441659.2_8 Reverse -254 -264 18.1713 0.00133
NP_441659.2_8 Forward -263 -253 11.9764 0.0147
NP_441022.1_1 Reverse -144 -153 14.5198 0.183
NP_441022.1_1 Forward -155 -146 12.6973 0.232
NP_441040.1_2 Forward -265 -246 -9.44032 0.236
NP_440442.1_3 Reverse -247 -261 16.7159 0.23
NP_440779.1_5 Reverse -254 -271 -5.46769 0.149
NP_442346.1_5 Forward -264 -254 16.6963 0.00248
NP_442346.1_5 Reverse -253 -263 9.02648 0.118
NP_442346.1_5 Reverse -13 -23 5.5849 0.238
NP_440352.1_5 Forward -347 -328 11.7797 0.254
NP_440545.1_3 Forward -267 -250 9.47861 0.0393
NP_440025.1_1 Forward -267 -248 5.80098 0.283
NP_441629.1_3 Forward -270 -251 4.81688 0.218
NP_441629.1_3 Forward -79 -60 -4.72118 0.297
NP_440555.1_1 Forward -83 -64 2.94938 0.294
NP_442934.1_9 Forward -349 -331 17.6204 0.169
NP_440459.1_2 Forward -272 -255 11.0519 0.183
NP_440459.1_3 Reverse -276 -295 10.2259 0.152
NP_441653.1_2 Reverse -243 -262 9.13438 0.161
NP_440010.1_4 Reverse -244 -263 8.55343 0.181
NP_440010.1_4 Forward -267 -248 0.981987 0.243
NP_440010.1_4 Reverse -247 -266 -3.04956 0.294
NP_440010.1_10 Forward -83 -64 1.67108 0.295
NP_442311.1_5 Forward -227 -208 3.44104 0.247
NP_440847.1_3 Reverse -165 -179 14.9452 0.188
NP_441888.1_7 Reverse -249 -263 3.93283 0.225
NP_441948.1_4 Forward -270 -252 6.41066 0.0644
NP_441833.1_4 Forward -262 -255 15.9687 0.0124
NP_441833.1_4 Reverse -255 -262 15.9687 0.0124
NP_441895.1_10 Forward -240 -221 -27.6315 0.282
NP_441112.1_6 Forward -273 -254 -2.95047 0.296
NP_442162.1_9 Forward -262 -255 16.2637 0.0124
NP_442162.1_9 Reverse -255 -262 16.2637 0.0124
NP_440671.1_4 Reverse -248 -262 14.0609 0.0698
NP_440224.1_1 Forward -274 -255 5.60432 0.132
NP_440772.1_6 Forward -106 -87 6.39097 0.294
NP_442199.1_5 Reverse -246 -265 5.70265 0.0936
NP_442140.1_3 Reverse -255 -265 12.2714 0.0632
NP_442140.1_3 Forward -262 -252 8.33817 0.119
NP_442140.1_3 Reverse -173 -183 5.87989 0.194
NP_440875.1_9 Forward -261 -251 9.05339 0.233
NP_440875.1_9 Reverse -367 -377 8.76138 0.233
NP_440875.1_9 Reverse -193 -203 7.39866 0.267
NP_441813.1_5 Reverse -252 -262 17.188 0.00979
NP_441813.1_5 Forward -265 -255 8.63316 0.0367
NP_440590.1_4 Reverse -255 -268 9.36073 0.0365
NP_440590.1_4 Forward -262 -249 4.8375 0.0585
NP_440590.1_4 Forward -221 -208 -5.38892 0.277
NP_440567.1_1 Forward -262 -248 15.3392 0.0177
NP_440567.1_1 Reverse -255 -269 6.29277 0.085
NP_442497.1_10 Forward -262 -253 10.4228 0.0087
NP_442497.1_10 Reverse -255 -264 10.4228 0.0087
NP_440821.1_4 Reverse -252 -262 19.0562 0.00399
NP_440821.1_4 Forward -265 -255 9.41981 0.0286
NP_441239.1_9 Reverse -252 -264 13.3137 0.037
NP_441239.1_9 Forward -265 -253 5.93884 0.202
NP_441892.1_1 Forward -272 -255 14.6902 0.032
NP_440665.1_1 Forward -104 -85 -15.0452 0.264
NP_440604.1_6 Forward -263 -244 -3.3438 0.225
NP_442138.1_10 Reverse -254 -273 2.3594 0.12
NP_442138.1_10 Forward -263 -244 -2.85214 0.22
NP_440546.1_4 Forward -263 -253 11.8882 0.0679
NP_440546.1_4 Reverse -254 -264 10.046 0.109
NP_441230.1_5 Forward -268 -249 9.24257 0.128
NP_440462.1_6 Reverse -252 -262 15.418 0.0142
NP_440462.1_6 Forward -265 -255 1.35667 0.294
NP_442611.1_1 Forward -263 -244 3.14605 0.213
NP_442592.1_3 Reverse -265 -284 7.96426 0.298
NP_440868.1_4 Reverse -250 -262 8.6921 0.0582
NP_440868.1_4 Forward -267 -255 5.93884 0.0879
NP_440401.1_9 Forward -273 -266 14.5917 0.287
NP_441249.1_3 Forward -224 -205 -0.000545616 0.289
NP_442402.1_4 Reverse -230 -249 -3.54122 0.217
NP_442402.1_9 Forward -388 -369 8.84924 0.278
NP_442402.1_10 Reverse -136 -146 14.3359 0.18
NP_439942.1_2 Forward -283 -264 15.3173 0.228
NP_442039.1_4 Forward -262 -255 15.1821 0.0124
NP_442039.1_4 Reverse -255 -262 15.1821 0.0124
NP_442039.1_7 Forward -313 -303 7.45319 0.276
NP_442039.1_10 Reverse -219 -237 13.6864 0.227
NP_441811.1_1 Reverse -165 -184 9.14423 0.269
NP_440753.1_5 Forward -89 -70 14.6508 0.122
NP_442679.1_1 Reverse -18 -37 -3.04881 0.248
NP_442409.1_10 Forward -37 -23 14.1586 0.293
NP_440825.1_6 Forward -183 -164 7.96426 0.285
NP_440825.1_7 Reverse -255 -265 12.9096 0.152
NP_442837.1_3 Forward -262 -255 15.7721 0.0124
NP_442837.1_3 Reverse -255 -262 15.7721 0.0124
NP_442053.1_1 Forward -263 -254 18.3876 0.0007
NP_442053.1_1 Reverse -254 -263 18.3876 0.0007
NP_440505.1_3 Reverse -252 -262 13.8447 0.0247
NP_440505.1_3 Forward -265 -255 9.22315 0.122
NP_442360.1_5 Forward -180 -170 13.5497 0.278
NP_441701.1_3 Forward -96 -79 6.82368 0.275
NP_441203.1_1 Reverse -194 -213 -20.1584 0.297
NP_440013.1_1 Reverse -350 -369 11.7 0.222
NP_440914.1_1 Reverse -254 -264 17.5935 0.000537
NP_440914.1_1 Forward -263 -253 8.6151 0.186
NP_440914.1_1 Forward -205 -195 6.27291 0.288
NP_441011.1_8 Forward -262 -253 16.9127 0.00602
NP_441011.1_8 Reverse -255 -264 8.25953 0.144
NP_442101.1_10 Forward -271 -252 -5.21209 0.164
NP_442533.1_6 Forward -263 -254 17.2076 0.00137
NP_442533.1_6 Reverse -254 -263 17.2076 0.00137
NP_442533.1_6 Forward -378 -369 9.4395 0.0624
NP_442229.1_1 Forward -265 -251 7.27547 0.196
NP_443016.1_1 Reverse -166 -185 -5.01543 0.24
NP_441482.1_7 Reverse -248 -262 10.0294 0.0135
NP_439944.1_9 Reverse -255 -265 10.5014 0.0887
NP_439944.1_9 Forward -262 -252 10.3048 0.0887
NP_439944.1_9 Reverse -114 -124 8.33817 0.111
NP_441028.1_6 Reverse -331 -341 12.0743 0.192
NP_441028.1_6 Reverse -229 -239 5.19112 0.265
NP_441527.1_4 Forward -241 -222 -8.83343 0.251
NP_441527.1_4 Forward -349 -330 -12.2711 0.285
NP_440007.1_9 Reverse -250 -264 3.73617 0.267
NP_441059.1_2 Forward -102 -83 -7.27704 0.291
NP_443045.1_5 Forward -256 -243 14.727 0.253
NP_441602.1_4 Reverse -243 -262 10.4225 0.278
NP_442673.1_6 Forward -307 -288 11.5064 0.295
NP_441170.1_4 Reverse -361 -379 2.96908 0.283
NP_441972.1_5 Reverse -255 -274 4.22769 0.108
NP_441972.1_5 Reverse -243 -262 -7.37537 0.248
NP_441106.1_1 Reverse -253 -262 18.191 0.0028
NP_441106.1_1 Forward -264 -255 9.63616 0.0311
NP_439903.1_6 Reverse -245 -264 -1.18128 0.293
NP_441286.1_1 Forward -264 -252 14.4936 0.00418
NP_441286.1_1 Reverse -253 -265 3.38223 0.0467
NP_441286.1_1 Forward -330 -318 -6.45087 0.265
NP_442674.1_3 Forward -271 -252 9.43841 0.174
NP_440670.1_8 Forward -263 -254 18.3876 0.000699
NP_440670.1_8 Reverse -254 -263 18.3876 0.000699
NP_441705.1_3 Forward -158 -139 -6.88371 0.299
NP_440886.1_7 Reverse -253 -263 17.7774 0.0011
NP_440886.1_7 Forward -102 -92 9.12434 0.0805
NP_440886.1_7 Forward -264 -254 7.94438 0.0805
NP_442382.1_7 Forward -276 -257 5.50599 0.252
NP_442072.1_9 Forward -264 -246 -13.7472 0.121
NP_441753.1_10 Reverse -245 -264 4.81767 0.193
NP_440907.2_8 Forward -262 -252 7.84605 0.117
NP_440907.2_8 Reverse -255 -265 7.64939 0.117
NP_441463.1_3 Reverse -244 -263 0.687771 0.13
NP_441463.1_6 Forward -265 -251 5.54623 0.287
NP_441626.1_2 Forward -262 -255 15.7721 0.0124
NP_441626.1_2 Reverse -255 -262 15.7721 0.0124
NP_440107.1_2 Reverse -249 -268 6.78429 0.299
NP_442794.1_1 Reverse -250 -262 10.1671 0.0721
NP_442794.1_1 Forward -267 -255 2.69391 0.286
NP_442615.1_1 Forward -272 -254 -3.12744 0.156
NP_442615.1_1 Reverse -245 -263 -6.56903 0.252
NP_441962.1_4 Reverse -64 -83 -9.73531 0.22
NP_441962.1_9 Reverse -143 -162 10.9142 0.258
NP_440387.1_1 Forward -263 -247 21.888 0.00209
NP_441431.1_2 Reverse -251 -265 11.5037 0.136
NP_441836.1_2 Reverse -46 -65 -5.99873 0.29
NP_441193.1_6 Reverse -255 -274 1.47442 0.285
NP_441993.1_1 Forward -263 -244 8.28142 0.15
NP_441993.1_1 Forward -269 -250 0.777198 0.292
NP_440114.1_10 Reverse -254 -268 9.83269 0.16
NP_440114.1_10 Reverse -261 -275 5.70279 0.296
NP_442323.1_7 Reverse -142 -161 1.57197 0.278
NP_440766.1_4 Reverse -250 -264 8.25939 0.0871
NP_441237.1_9 Reverse -255 -265 14.828 0.0242
NP_441133.1_1 Forward -263 -244 13.2741 0.243
NP_439910.1_2 Reverse -246 -263 -11.8592 0.0788
NP_440457.1_1 Reverse -250 -262 8.29878 0.101
NP_440798.1_6 Reverse -255 -268 5.52582 0.14
NP_442509.1_9 Forward -263 -253 16.2041 0.00739
NP_442509.1_9 Reverse -254 -264 8.14104 0.192
NP_440554.1_4 Forward -262 -252 14.6313 0.02
NP_441885.1_5 Reverse -254 -264 20.9245 0.000538
NP_441885.1_5 Forward -263 -253 11.4848 0.00668
NP_442128.1_6 Forward -306 -292 19.4691 0.156
NP_442341.1_7 Forward -264 -250 17.7975 0.0111
NP_442341.1_7 Reverse -253 -267 8.35772 0.0881
NP_442341.1_9 Reverse -252 -266 14.4536 0.068
NP_441756.1_5 Reverse -250 -269 5.60432 0.183
NP_442534.1_7 Forward -323 -304 11.1109 0.192
NP_440191.1_4 Reverse -230 -240 13.2451 0.282
NP_443000.1_7 Forward -265 -255 10.3048 0.0345
NP_443000.1_7 Reverse -252 -262 8.73149 0.0437
NP_440507.2_3 Reverse -245 -264 10.2251 0.208
NP_442513.1_5 Forward -271 -252 9.7334 0.266
NP_441842.1_10 Forward -270 -256 12.1926 0.107
NP_440275.1_3 Reverse -252 -262 8.4365 0.0602
NP_440275.1_3 Forward -265 -255 8.04317 0.0602
NP_440275.1_3 Forward -60 -50 1.455 0.29
NP_440091.1_1 Forward -267 -255 8.88877 0.0567
NP_440091.1_1 Reverse -250 -262 1.41561 0.197
NP_440149.1_8 Forward -263 -244 5.11266 0.0776
NP_440149.1_8 Reverse -254 -273 -5.01543 0.218
NP_441105.1_3 Forward -268 -249 3.6377 0.089
NP_441105.1_3 Reverse -243 -262 -3.3438 0.177
NP_442373.1_2 Forward -266 -247 -10.1286 0.272
NP_440216.1_1 Reverse -254 -268 8.06273 0.0068
NP_440216.1_1 Forward -263 -249 -2.26202 0.0484
NP_440172.1_1 Reverse -254 -264 15.0247 0.00945
NP_440172.1_1 Forward -263 -253 8.73149 0.0586
NP_442371.1_1 Forward -340 -330 14.0409 0.191
NP_442015.1_10 Reverse -250 -263 19.1938 0.00444
NP_442015.1_10 Forward -267 -254 1.59258 0.204
NP_441045.1_4 Forward -238 -219 13.2741 0.274
NP_441226.1_7 Forward -262 -255 14.4934 0.0123
NP_441226.1_7 Reverse -255 -262 14.4934 0.0123
NP_441111.1_7 Forward -262 -254 18.7023 0.00294
NP_441111.1_7 Reverse -255 -263 18.7023 0.00294
NP_442379.1_10 Reverse -247 -264 -2.81276 0.245
NP_441766.1_2 Forward -263 -254 17.5026 0.00297
NP_441766.1_2 Reverse -254 -263 17.5026 0.00297
NP_442417.1_5 Forward -263 -249 12.0943 0.0981
NP_440416.1_9 Reverse -247 -266 -2.75381 0.0719
NP_440416.1_9 Forward -270 -251 -10.817 0.146
NP_443052.1_8 Reverse -244 -263 -9.14533 0.186
NP_440885.1_2 Reverse -148 -167 17.0107 0.113
NP_440591.1_5 Reverse -164 -183 10.9134 0.218
NP_440591.1_9 Forward -264 -246 8.67227 0.179
NP_442154.1_1 Reverse -90 -108 -17.5821 0.26
NP_440261.1_5 Forward -262 -249 -10.5021 0.201
NP_440261.1_5 Reverse -255 -268 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGAAAGCAGAAGAGCAGTTCTGGCCGGCCCTCAACAATATTGGTTTGATTGAATACGAACAGGGAAAAATTGACACCGCCCTCAAACGTTGGCAAGAAGTGATCAAAATTGACTCCGAACAACCGGAACCCCAATTGGCGATCGCCGTGGCGTTGTATAAACAGGGCAAAACGGAGGAAGGATTGCGGAAGGCCCAGGATGCCCTCAATTTAGATAGTCGCTATGGGGAAATTGATTTCCTGGTCAAAAATCTTTGGGGAGAGCAGTTAATTGCAGATACGAAAGCCCTATTTGCTACCCCTACCATGGTGGAAGTATTGCGTACTTTGCCGCCCCCCAGTGACGACCTGTAAAAGCTCGAATTTTCCCATTCCTCTGCCATAACTCCTCAACTTTGCC

CDS

ATGACCCCAGACCAAGTAATTGTTGCCCTAGATGTGCCGGATTTACCCAAGGCGATCGCCTTAGTGGATCGTTTGCCAGGGGTAGGTTTTTGGAAGGTGGGGCTGGAATTATTTGTGGGGGCGGGGCCGGTCATTTTGGCGGAGTTAAAAGACCGGGGTAAAAGGATTTTTTTGGATCTGAAATTCCATGACATTCCCAATACGATGTTGGGGGCCTGCCTGTCTGCCAGTCGGTACGAAGTGGATTTACTCACTCTCCATGCCACTGCGGGAAGTCAAGCTTTAACCTTAGCCGCCCAAGCCATGGCCCCATTGCCCCATCCTCCCAAACTGTTGGCCATTACCTTGCTCACTAGCATTGGCGATCGCCAGTTACGGGAAGAGTTACAACAACCCTTAGCCGTGGATGATTACGTCAACGCCATGGCCCGGTTGGCCCGAAATGCTGGCATTGATGGAGCGGTGTGTTCCCCCCAGGAAGTGGCTAAACTGAGGCAAACCTGCGGCCCTGAATTTTTACTGGTTACCCCCGGCGTGCGGCCTCTCTGGTCGGCCCCAGGCGATCAACAACGGGTCATGATTCCCGCCCAGGCGATCGCCGCTGGGGCCAATTATGTGGTCATTGGTCGACCCATCACTGCTGATCCTAGTCCCGAAGCCGCTTGGGAAAGATTATGCCAAGACCTTGCTGTTTAA

Protein

MTPDQVIVALDVPDLPKAIALVDRLPGVGFWKVGLELFVGAGPVILAELKDRGKRIFLDLKFHDIPNTMLGACLSASRYEVDLLTLHATAGSQALTLAAQAMAPLPHPPKLLAITLLTSIGDRQLREELQQPLAVDDYVNAMARLARNAGIDGAVCSPQEVAKLRQTCGPEFLLVTPGVRPLWSAPGDQQRVMIPAQAIAAGANYVVIGRPITADPSPEAAWERLCQDLAV