Your browser is old and dusty. Try Google Chrome!

Details for sll0829

ORF sll0829
Accession NP_442452.1
Symbol
Category Other
Definition probable methyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -352 -338 16.2242 0.104
NP_441061.1_2 Reverse -338 -352 -0.0987402 0.221
NP_441418.1_3 Forward -97 -78 10.265 0.272
NP_441418.1_6 Reverse -296 -315 -11.5053 0.0517
NP_441453.1_8 Reverse -370 -387 10.5603 0.238
NP_441453.1_8 Forward -62 -45 8.00365 0.25
NP_440813.1_1 Forward -313 -299 15.9285 0.273
NP_441816.1_6 Forward -351 -339 17.1486 0.218
NP_001035873.1_1 Reverse -61 -80 18.4829 0.174
NP_442861.1_1 Reverse -132 -151 10.7175 0.295
NP_441054.1_2 Forward -357 -338 9.24257 0.299
NP_441054.1_4 Forward -368 -350 -3.42244 0.267
NP_441476.1_5 Reverse -344 -363 -4.32711 0.25
NP_442062.1_3 Forward -119 -100 -1.57384 0.26
NP_440761.1_8 Forward -382 -363 24.188 0.0143
NP_442974.1_10 Forward -392 -373 14.5516 0.267
NP_442242.1_1 Reverse -368 -387 16.0196 0.28
NP_442097.1_2 Reverse -77 -96 1.27776 0.259
NP_441208.1_9 Forward -286 -272 6.19444 0.253
NP_441594.1_6 Forward -383 -364 -0.295539 0.298
NP_441109.1_3 Forward -387 -368 25.4663 0.00846
NP_441925.1_4 Forward -135 -116 -17.3075 0.293
NP_440856.1_4 Forward -151 -132 -2.16383 0.209
NP_441083.1_5 Forward -206 -196 3.42162 0.172
NP_440343.1_3 Reverse -333 -351 12.0147 0.136
NP_440343.1_3 Reverse -339 -357 7.49153 0.208
NP_442596.1_9 Forward -241 -222 14.4541 0.283
NP_440747.1_10 Forward -383 -371 -12.1541 0.227
NP_441130.1_10 Reverse -20 -34 4.71948 0.27
NP_441880.2_10 Reverse -299 -317 7.98396 0.284
NP_440403.1_4 Forward -327 -308 -7.76869 0.248
NP_441012.1_4 Forward -253 -240 5.82081 0.29
NP_441634.1_8 Forward -382 -368 -4.7203 0.295
NP_440642.1_10 Reverse -43 -57 9.93039 0.175
NP_440642.1_10 Reverse -223 -237 7.57046 0.221
NP_441013.1_2 Forward -300 -282 -0.472507 0.267
NP_440667.1_2 Forward -352 -333 2.26107 0.203
NP_440360.1_10 Reverse -345 -359 4.22782 0.227
NP_440141.1_4 Reverse -368 -387 -3.04881 0.296
NP_440141.1_9 Forward -281 -262 2.65439 0.27
NP_442782.1_2 Forward -352 -338 9.73436 0.195
NP_440656.1_8 Reverse -269 -288 -6.98204 0.249
NP_441414.1_9 Reverse -146 -165 -3.3438 0.134
NP_440184.1_5 Forward -352 -333 3.83436 0.253
NP_441256.1_1 Reverse -368 -387 -7.76869 0.239
NP_442937.1_5 Reverse -300 -319 8.16093 0.231
NP_440203.1_5 Reverse -368 -378 13.6475 0.112
NP_440153.1_8 Reverse -343 -356 -3.02898 0.276
NP_440200.1_3 Forward -298 -279 8.06259 0.298
NP_440993.1_2 Reverse -332 -348 1.43517 0.279
NP_440602.1_8 Reverse -29 -43 12.291 0.21
NP_440809.1_9 Reverse -200 -218 -8.92897 0.287
NP_441646.1_1 Forward -341 -322 0.196116 0.254
NP_442438.1_10 Forward -178 -164 0.88457 0.213
NP_441000.1_9 Forward -241 -222 19.452 0.229
NP_441041.1_4 Forward -352 -333 -2.36049 0.111
NP_441041.1_4 Forward -358 -339 -2.45882 0.112
NP_441041.1_4 Forward -307 -288 -10.3253 0.231
NP_442004.1_6 Reverse -365 -379 6.19444 0.181
NP_441725.1_5 Reverse -344 -354 -0.609952 0.265
NP_442941.1_5 Reverse -216 -230 15.0024 0.272
NP_441678.1_9 Forward -353 -334 8.16093 0.17
NP_442281.1_1 Forward -260 -246 11.2087 0.0497
NP_442012.1_5 Forward -359 -340 -1.08219 0.288
NP_440723.1_4 Reverse -295 -314 -4.32711 0.272
NP_441556.1_10 Reverse -191 -205 14.31 0.178
NP_442029.1_6 Forward -380 -361 2.75272 0.289
NP_441751.2_8 Reverse -366 -380 -5.11362 0.194
NP_442554.1_8 Reverse -372 -382 4.50326 0.184
NP_441762.1_7 Forward -308 -296 -4.09092 0.153
NP_442142.1_4 Forward -314 -301 4.44361 0.222
NP_442292.1_5 Reverse -230 -249 -1.18052 0.257
NP_440730.1_4 Forward -244 -225 -5.40875 0.298
NP_441448.1_7 Reverse -283 -302 9.0459 0.24
NP_440183.1_9 Reverse -282 -301 -20.945 0.294
NP_441198.1_8 Forward -46 -36 10.8298 0.239
NP_441020.2_6 Forward -354 -337 5.9387 0.284
NP_441015.1_10 Forward -363 -344 -8.16202 0.272
NP_441015.1_10 Forward -351 -332 -10.6203 0.286
NP_441731.1_9 Forward -350 -333 13.7068 0.224
NP_441876.1_9 Reverse -313 -323 12.2709 0.267
NP_441826.1_2 Forward -249 -235 1.08123 0.164
NP_441826.1_2 Forward -364 -350 -2.16369 0.267
NP_441826.1_5 Reverse -287 -306 1.47442 0.29
NP_441826.1_6 Forward -59 -45 14.6509 0.194
NP_441637.1_9 Reverse -301 -319 -4.40575 0.296
NP_442490.1_9 Forward -346 -327 -7.67036 0.278
NP_441251.1_8 Forward -198 -185 12.7622 0.257
NP_442227.1_2 Forward -167 -148 1.76941 0.243
NP_442227.1_2 Reverse -348 -367 -0.590531 0.255
NP_442361.1_3 Forward -65 -52 7.49244 0.3
NP_440789.1_1 Reverse -61 -80 16.6165 0.149
NP_442808.1_1 Reverse -364 -374 3.91283 0.218
NP_441849.1_2 Forward -94 -75 0.811258 0.268
NP_442542.1_2 Forward -298 -285 4.64084 0.299
NP_442542.1_9 Forward -38 -24 6.29216 0.243
NP_442542.1_9 Reverse -295 -309 4.8172 0.285
NP_442113.1_10 Reverse -336 -355 -8.94866 0.289
NP_442903.1_2 Reverse -68 -87 12.5568 0.16
NP_440558.1_2 Reverse -334 -353 1.37609 0.181
NP_440558.1_2 Forward -383 -364 -3.24547 0.234
NP_441878.1_4 Forward -236 -217 4.52268 0.271
NP_441878.1_6 Forward -353 -343 -6.90313 0.198
NP_441590.1_4 Reverse -338 -357 3.83357 0.29
NP_440101.1_3 Forward -363 -344 2.65439 0.25
NP_441574.1_1 Forward -352 -333 -1.57384 0.22
NP_442645.1_2 Forward -349 -330 -16.0285 0.22
NP_440547.1_1 Forward -313 -294 8.25844 0.266
NP_442590.1_10 Forward -358 -339 5.70265 0.258
NP_440899.1_1 Forward -352 -333 16.6052 0.0752
NP_440899.1_8 Forward -90 -71 0.687771 0.177
NP_440299.1_6 Reverse -366 -385 7.66927 0.237
NP_441007.1_10 Forward -357 -344 0.117615 0.25
NP_440709.1_1 Forward -81 -62 6.58682 0.148
NP_441559.1_8 Reverse -303 -317 -5.60527 0.267
NP_441559.1_8 Forward -300 -286 -7.17857 0.287
NP_440915.1_6 Forward -322 -308 -0.000409212 0.179
NP_440915.1_6 Forward -351 -337 -3.147 0.29
NP_441179.1_4 Forward -129 -110 9.53674 0.225
NP_441296.1_9 Reverse -209 -222 8.67183 0.294
NP_441866.1_6 Forward -89 -70 10.0284 0.227
NP_442452.1_3 Forward -239 -220 22.0256 0.0396
NP_442452.1_5 Forward -334 -315 19.469 0.0389
NP_442452.1_8 Forward -128 -114 18.0918 0.257
NP_442452.1_10 Forward -379 -360 18.584 0.202
NP_442453.1_1 Reverse -61 -80 32.0554 0.00000921
NP_442386.1_9 Forward -256 -247 10.4224 0.129
NP_442386.1_9 Reverse -245 -254 9.34074 0.166
NP_442386.1_9 Forward -381 -372 8.2591 0.205
NP_442484.1_2 Reverse -41 -60 -1.27885 0.288
NP_440327.1_6 Forward -352 -333 3.04771 0.285
NP_440586.1_1 Forward -356 -337 -0.4922 0.237
NP_440192.1_5 Forward -359 -340 13.8641 0.116
NP_440684.1_9 Reverse -299 -313 9.2427 0.221
NP_440027.1_3 Reverse -339 -357 8.47483 0.193
NP_440027.1_3 Reverse -333 -351 2.08335 0.293
NP_439937.1_9 Reverse -285 -302 -2.12512 0.142
NP_441167.1_1 Reverse -59 -78 5.40766 0.237
NP_442239.1_8 Reverse -295 -314 6.78429 0.263
NP_441803.1_2 Forward -379 -360 0.294447 0.255
NP_442384.1_10 Reverse -332 -345 6.70579 0.0963
NP_441877.1_5 Reverse -367 -386 -2.0655 0.296
NP_441877.1_9 Forward -90 -73 1.71047 0.297
NP_442244.1_9 Reverse -333 -352 13.9625 0.162
NP_440344.1_10 Forward -32 -15 -13.5308 0.287
NP_440531.1_6 Reverse -317 -336 0.786102 0.187
NP_442910.1_1 Forward -325 -306 -8.06369 0.28
NP_441965.1_10 Reverse -368 -384 7.53169 0.146
NP_440297.1_9 Reverse -344 -354 0.373358 0.282
NP_442280.1_10 Reverse -215 -233 5.16222 0.29
NP_441592.1_4 Reverse -371 -390 4.42435 0.149
NP_441896.1_1 Reverse -61 -80 11.6017 0.203
NP_441103.1_9 Reverse -171 -181 14.8334 0.202
NP_440700.1_8 Forward -353 -339 15.2409 0.23
NP_440937.1_5 Reverse -59 -78 8.65258 0.278
NP_440999.1_9 Reverse -339 -353 -3.24533 0.289
NP_441469.1_8 Forward -256 -247 5.40793 0.272
NP_442637.1_1 Reverse -238 -257 -1.86883 0.16
NP_443064.1_6 Reverse -309 -319 11.4034 0.13
NP_440220.1_4 Reverse -233 -252 -3.14789 0.285
NP_440220.1_4 Reverse -336 -355 -3.34455 0.286
NP_442286.1_1 Reverse -35 -54 12.8808 0.139
NP_442204.1_1 Forward -378 -367 -0.137991 0.286
NP_442859.1_2 Reverse -306 -325 2.55606 0.275
NP_442120.1_10 Forward -352 -333 -8.65367 0.237
NP_442612.1_1 Reverse -8 -23 16.7945 0.214
NP_440865.1_9 Forward -380 -361 -6.58872 0.228
NP_441052.1_2 Reverse -371 -381 4.79825 0.145
NP_440992.1_2 Forward -380 -361 12.1925 0.226
NP_442219.1_9 Forward -373 -364 2.75299 0.233
NP_441884.1_9 Forward -246 -227 -21.83 0.266
NP_441884.1_9 Forward -337 -318 -23.7966 0.284
NP_441719.1_10 Forward -352 -334 3.55906 0.298
NP_441004.1_1 Forward -364 -345 -11.7019 0.241
NP_441004.1_1 Reverse -142 -161 -12.4886 0.247
NP_441004.1_2 Forward -351 -332 -0.787193 0.259
NP_441004.1_4 Forward -343 -333 7.64985 0.294
NP_442366.1_3 Reverse -245 -263 -0.964162 0.203
NP_442694.1_4 Forward -284 -275 12.9794 0.225
NP_441851.1_6 Forward -80 -61 14.2373 0.218
NP_441851.1_10 Forward -319 -309 7.84651 0.13
NP_441851.1_10 Forward -353 -343 5.19158 0.221
NP_442515.1_1 Forward -318 -304 -2.06536 0.268
NP_441396.1_5 Reverse -303 -312 7.27622 0.29
NP_441409.1_8 Forward -202 -183 10.0051 0.229
NP_442843.1_1 Forward -254 -235 -3.83545 0.23
NP_442168.1_5 Reverse -333 -352 8.16093 0.159
NP_440040.1_8 Forward -76 -57 12.1748 0.172
NP_440954.1_1 Forward -352 -333 -3.04881 0.227
NP_442729.1_5 Forward -381 -371 7.94484 0.254
NP_442348.1_2 Forward -285 -276 7.37455 0.28
NP_442443.1_4 Forward -58 -48 15.3192 0.179
NP_441333.1_1 Forward -89 -79 13.4965 0.217
NP_441732.1_2 Forward -378 -362 -17.5427 0.27
NP_440497.1_2 Forward -363 -344 6.78429 0.249
NP_440759.1_9 Reverse -72 -91 8.65258 0.224
NP_442797.1_1 Forward -38 -19 -4.52377 0.286
NP_442797.1_7 Reverse -348 -366 2.96908 0.236
NP_439900.1_4 Reverse -214 -228 18.2885 0.142
NP_440280.1_4 Forward -353 -339 14.9459 0.298
NP_440713.1_4 Forward -384 -365 3.04771 0.251
NP_441659.2_8 Reverse -343 -353 2.53664 0.198
NP_442913.1_10 Forward -326 -307 -4.42544 0.237
NP_440336.1_7 Forward -340 -321 7.87766 0.285
NP_439956.1_7 Forward -301 -282 2.55606 0.273
NP_441800.1_3 Reverse -344 -362 7.00065 0.286
NP_440352.1_4 Forward -114 -100 17.6776 0.173
NP_440545.1_3 Reverse -333 -350 -5.46769 0.25
NP_440486.1_4 Reverse -282 -300 -3.71743 0.231
NP_442828.1_2 Forward -97 -78 15.8035 0.239
NP_441888.1_7 Reverse -241 -255 15.4376 0.0743
NP_441050.1_5 Forward -356 -338 0.117479 0.253
NP_440772.1_7 Reverse -293 -312 11.9958 0.212
NP_442723.1_1 Reverse -342 -361 5.30853 0.276
NP_440875.1_9 Forward -253 -243 8.08002 0.243
NP_442089.1_6 Forward -295 -276 3.24438 0.275
NP_441239.1_9 Reverse -244 -256 8.88877 0.12
NP_441239.1_9 Reverse -239 -251 4.26721 0.256
NP_441212.1_7 Reverse -341 -360 19.2723 0.159
NP_442568.1_8 Reverse -75 -89 7.66941 0.296
NP_440400.1_1 Reverse -334 -353 -2.75457 0.287
NP_441892.1_1 Forward -383 -366 -3.50107 0.242
NP_441508.1_4 Reverse -234 -248 15.3858 0.244
NP_442643.1_1 Forward -358 -339 -12.9802 0.291
NP_441541.1_1 Forward -79 -61 -2.86277 0.264
NP_440546.1_6 Forward -356 -337 8.35759 0.259
NP_442041.1_5 Reverse -235 -254 11.5042 0.166
NP_442499.1_1 Reverse -338 -357 8.06259 0.203
NP_441474.1_1 Reverse -348 -367 2.45694 0.247
NP_440696.1_6 Forward -363 -344 8.25926 0.231
NP_442039.1_7 Forward -59 -49 9.51814 0.257
NP_441811.1_8 Reverse -302 -316 6.88276 0.259
NP_442829.1_2 Reverse -275 -291 8.81753 0.287
NP_440160.1_2 Forward -371 -352 -6.09707 0.279
NP_441701.1_3 Forward -356 -339 14.1985 0.191
NP_442009.1_9 Forward -30 -11 11.6025 0.226
NP_441408.2_7 Forward -236 -217 -2.16383 0.265
NP_440914.1_1 Reverse -332 -342 9.49342 0.186
NP_442533.1_1 Forward -364 -345 -15.6352 0.257
NP_442533.1_1 Forward -357 -338 -17.9951 0.299
NP_442533.1_6 Forward -352 -343 2.26134 0.266
NP_442533.1_6 Reverse -338 -347 1.57302 0.294
NP_442232.1_3 Forward -322 -303 -7.17871 0.194
NP_442322.1_4 Reverse -349 -366 -9.49991 0.295
NP_442322.1_4 Reverse -335 -352 -9.69657 0.296
NP_441482.1_7 Forward -380 -366 -11.4068 0.262
NP_441697.1_5 Reverse -76 -95 -9.31089 0.268
NP_440816.1_2 Forward -57 -38 8.17758 0.257
NP_441028.1_6 Forward -278 -268 7.45273 0.229
NP_441028.1_6 Reverse -47 -57 5.19112 0.265
NP_441028.1_6 Reverse -313 -323 3.71617 0.281
NP_441527.1_4 Forward -196 -177 -11.3162 0.281
NP_440007.1_9 Forward -378 -364 7.47274 0.208
NP_441972.1_5 Reverse -235 -254 -1.57384 0.177
NP_441106.1_3 Reverse -59 -78 10.9142 0.24
NP_441825.1_4 Forward -246 -236 16.1063 0.186
NP_439903.1_6 Reverse -340 -359 5.40686 0.183
NP_442588.1_6 Forward -292 -273 -0.39387 0.263
NP_442588.1_8 Reverse -295 -314 9.0459 0.238
NP_440092.1_3 Reverse -136 -155 12.1925 0.274
NP_440886.1_7 Reverse -348 -358 6.0761 0.147
NP_442382.1_7 Reverse -273 -292 18.4857 0.0484
NP_441808.1_8 Forward -380 -361 10.3242 0.236
NP_441021.1_8 Forward -226 -208 6.90232 0.198
NP_441463.1_6 Reverse -8 -22 6.3193 0.274
NP_442842.1_4 Forward -295 -276 3.34271 0.265
NP_442211.1_9 Reverse -296 -315 3.73603 0.242
NP_442365.1_7 Forward -384 -365 -6.68705 0.299
NP_442794.1_1 Reverse -42 -54 3.77555 0.286
NP_441962.1_4 Forward -319 -300 -12.7836 0.265
NP_441836.1_2 Reverse -365 -384 -0.39387 0.212
NP_441993.1_1 Forward -352 -333 8.47633 0.146
NP_442437.1_8 Reverse -242 -261 13.7658 0.133
NP_440766.1_4 Reverse -294 -308 0.491246 0.28
NP_442509.1_7 Reverse -333 -352 16.9124 0.267
NP_442509.1_9 Reverse -167 -177 7.25606 0.229
NP_442703.1_4 Reverse -332 -351 2.16195 0.283
NP_442703.1_9 Forward -146 -128 6.70565 0.244
NP_442341.1_7 Forward -318 -304 4.12949 0.2
NP_440679.1_10 Reverse -298 -317 -21.7317 0.297
NP_440866.1_5 Forward -232 -214 15.0638 0.268
NP_440880.1_5 Forward -352 -334 13.0972 0.236
NP_441105.1_3 Forward -385 -366 -6.68705 0.239
NP_441105.1_3 Reverse -326 -345 -8.35868 0.272
NP_440216.1_9 Forward -232 -223 15.536 0.128
NP_442015.1_10 Reverse -242 -255 -0.767364 0.281
NP_442252.1_4 Forward -352 -333 16.2241 0.225
NP_440416.1_9 Reverse -348 -367 -20.4534 0.285
NP_443052.1_8 Forward -327 -308 -10.3253 0.207
NP_443052.1_9 Forward -312 -293 -4.81876 0.261
NP_440072.1_5 Forward -367 -349 0.412472 0.236
NP_442154.1_1 Forward -363 -345 -15.7138 0.224
NP_442154.1_1 Forward -298 -280 -18.9587 0.288
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATGTACACTTTTGCATCCTGGCCAAGGCGTTCCAGACGGGTCGTGAGGGCGGAGGCTTGGGCTTCGGTAATCTGCAACAGGGGGGAACCACCACCGATTTCGGCGTAGTTGGCCTGGGATTTTTTCGCCCGTAGGGTAGAAATCAGCCATGCCAGGGGTTTTTGCAACCAAGGAAAAGGGAGACGAATGATTTCCGGATCCGCAAACAGGTTAAAAAGGAAGGGGCGTACATCCTCTAACTTCTCCGGTCCGCCAAGATTTAGCAGTAAGACCCCAACACGACCCATAATTGTTAAGCTTAGTAGAATGATTTTTCAGTTTCTTTACCAAGTGTAACAATAGATGGCGAAAAGGAAAGAATCCCAACCTACAAACGGCGTCCCAATTTCTTTCTAGGTT

CDS

ATGGCAACTATTTTCCGCACTTGGAGTTATCAGTATCCGTGGGTTTACGCCCTAGTTTCCCGCCTAGCGACTTTGAATGTGGGGGGAGAAGAGCGTTTCCATCAATTGCCATTGGAGAATTTAGCAATTTCACCGGGACAGAAGGTGCTGGATTTGTGTTGCGGGGGTGGCCAAGCCACTGTTTACCTAGCTCAATCTGGAGCCACGGTGGTGGGGCTGGATGCTTCCCCCAAGGCCCTGGGCAGGGCGAAAATTAATGTACCCCAGGCGACCTATGTTCAGGGTTTGGCCGAGGATTTACCCTTTGGGGAAGGGGAATTCGACCTAGTGCACACCAGCGTCGCCCTGCACGAAATGACTCCGGCACAACTACAGAGCATTATCAGCGGCGTACACCGTGTGCTCAAACCAGGAGGAATTTTTGCCTTAGTGGATTTACATCGCCCCAGTAATTGGCTATTTTGGCCGCCCTTGGCAATTTTTATGGGCCTGTTTGAAACGGAAACCGCCTGGCAGTTAATTAACACCGATTTAGGGTCATTACTGGACCAAGCTGGTTTCACAGTTGTTCGTAAGCATCTCTATGCGGGGGGCAGTTTACAGGTAATCCAGGCCAGAGCAAATAAGACTGTTAACTAA

Protein

MATIFRTWSYQYPWVYALVSRLATLNVGGEERFHQLPLENLAISPGQKVLDLCCGGGQATVYLAQSGATVVGLDASPKALGRAKINVPQATYVQGLAEDLPFGEGEFDLVHTSVALHEMTPAQLQSIISGVHRVLKPGGIFALVDLHRPSNWLFWPPLAIFMGLFETETAWQLINTDLGSLLDQAGFTVVRKHLYAGGSLQVIQARANKTVN