Your browser is old and dusty. Try Google Chrome!

Details for sll0822

ORF sll0822
Accession NP_442464.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -288 -274 11.6026 0.051
NP_440557.1_1 Forward -288 -269 -1.08219 0.27
NP_440795.1_7 Forward -288 -281 14.6904 0.0123
NP_440795.1_7 Reverse -281 -288 14.6904 0.0123
NP_441418.1_6 Forward -289 -270 -20.4534 0.114
NP_442291.1_5 Forward -290 -274 -0.924775 0.19
NP_442272.1_2 Reverse -133 -152 10.4559 0.25
NP_440897.1_6 Reverse -280 -299 2.9486 0.156
NP_441453.1_4 Reverse -280 -288 16.539 0.00633
NP_441453.1_4 Forward -289 -281 16.539 0.00633
NP_441453.1_7 Reverse -303 -310 14.1988 0.175
NP_442151.1_6 Forward -289 -275 10.816 0.114
NP_441818.1_1 Forward -288 -277 9.20294 0.25
NP_440226.1_1 Reverse -280 -299 3.04771 0.241
NP_441098.1_3 Reverse -135 -154 -7.07608 0.285
NP_442173.1_1 Forward -288 -280 15.4574 0.00633
NP_442173.1_1 Reverse -281 -289 15.4574 0.00633
NP_442752.1_4 Forward -289 -282 13.8055 0.0199
NP_442752.1_4 Reverse -280 -287 13.8055 0.0199
NP_442752.1_4 Reverse -373 -380 7.90559 0.144
NP_443027.1_4 Reverse -278 -288 16.2046 0.0437
NP_443027.1_4 Reverse -188 -198 7.25653 0.24
NP_443027.1_4 Forward -291 -281 5.87989 0.294
NP_441812.1_3 Forward -290 -276 16.2242 0.0755
NP_442975.1_10 Forward -166 -152 11.7003 0.0497
NP_442975.1_10 Reverse -276 -290 3.63724 0.252
NP_442975.1_10 Forward -293 -279 3.04726 0.263
NP_440784.1_7 Forward -288 -281 15.9687 0.0123
NP_440784.1_7 Reverse -281 -288 15.9687 0.0123
NP_442909.1_7 Forward -288 -274 13.1753 0.128
NP_440061.1_9 Forward -384 -370 11.1104 0.117
NP_440878.1_9 Forward -299 -280 5.11266 0.174
NP_442062.1_8 Reverse -280 -290 19.4496 0.000558
NP_442062.1_8 Forward -289 -279 10.3048 0.0493
NP_440304.1_4 Reverse -278 -288 19.9412 0.00364
NP_440304.1_4 Forward -291 -281 1.84832 0.299
NP_442242.1_4 Forward -288 -281 14.3954 0.0124
NP_442242.1_4 Reverse -281 -288 14.3954 0.0124
NP_440044.1_8 Forward -288 -269 1.76941 0.164
NP_441781.1_7 Forward -289 -270 4.62101 0.186
NP_441619.1_8 Forward -306 -292 10.422 0.185
NP_441208.1_9 Forward -292 -278 8.55439 0.219
NP_441594.1_6 Reverse -271 -290 0.786102 0.281
NP_442110.1_7 Forward -289 -275 10.4227 0.0684
NP_441925.1_4 Forward -389 -370 -13.7676 0.259
NP_441083.1_5 Reverse -280 -290 11.3864 0.0159
NP_441083.1_5 Forward -289 -279 11.2881 0.0159
NP_441083.1_5 Forward -371 -361 5.48657 0.116
NP_441083.1_5 Reverse -287 -297 0.0783647 0.245
NP_439957.1_5 Forward -150 -131 8.55425 0.273
NP_442827.1_8 Reverse -272 -291 3.44025 0.146
NP_441434.1_1 Reverse -136 -150 10.4202 0.233
NP_441434.1_7 Reverse -282 -296 1.96621 0.288
NP_440109.1_7 Forward -117 -98 18.6823 0.135
NP_441738.1_2 Forward -287 -280 15.28 0.0102
NP_441738.1_2 Reverse -282 -289 15.28 0.0102
NP_441558.1_5 Reverse -278 -297 12.0942 0.0717
NP_441558.1_5 Forward -298 -279 3.83436 0.296
NP_441942.1_6 Reverse -273 -292 17.7819 0.23
NP_440209.1_1 Reverse -280 -288 18.1123 0.00295
NP_440209.1_1 Forward -289 -281 18.1123 0.00295
NP_441713.1_1 Forward -295 -276 4.32602 0.0568
NP_441713.1_1 Reverse -274 -293 -16.4218 0.283
NP_441713.1_2 Reverse -34 -53 15.4374 0.291
NP_440178.1_7 Forward -290 -271 -21.83 0.241
NP_442706.1_9 Forward -363 -344 10.1275 0.23
NP_442111.1_4 Reverse -279 -293 15.1426 0.0243
NP_441163.1_1 Forward -297 -280 8.69123 0.226
NP_440906.1_5 Forward -288 -281 15.8704 0.0124
NP_440906.1_5 Reverse -281 -288 15.8704 0.0124
NP_440832.1_5 Reverse -356 -375 20.2556 0.155
NP_440747.1_10 Forward -292 -280 15.1819 0.00196
NP_440747.1_10 Reverse -277 -289 -1.92764 0.0192
NP_440747.1_10 Forward -299 -287 -12.3507 0.27
NP_441486.1_1 Reverse -277 -291 13.1759 0.00897
NP_441486.1_1 Forward -292 -278 3.24451 0.0638
NP_440944.1_2 Reverse -350 -369 -3.93378 0.296
NP_442634.1_4 Reverse -278 -292 -1.47537 0.149
NP_442634.1_4 Forward -291 -277 -2.06536 0.149
NP_441265.1_3 Forward -295 -281 3.14618 0.181
NP_442848.1_1 Reverse -274 -288 -2.26202 0.263
NP_443018.1_3 Forward -288 -281 14.8871 0.0123
NP_443018.1_3 Reverse -281 -288 14.8871 0.0123
NP_441316.1_7 Reverse -278 -293 2.33984 0.154
NP_441316.1_7 Forward -291 -276 -3.36336 0.273
NP_441634.1_1 Reverse -275 -294 -3.63879 0.275
NP_440376.1_1 Forward -289 -280 19.4693 0.000692
NP_440376.1_1 Reverse -280 -289 19.4693 0.000692
NP_440376.1_1 Reverse -339 -348 0.393051 0.279
NP_441588.1_4 Reverse -282 -292 7.35486 0.178
NP_443065.1_6 Forward -293 -274 6.4893 0.208
NP_442687.1_7 Forward -290 -280 15.8113 0.0125
NP_442687.1_7 Reverse -279 -289 9.02648 0.0994
NP_442191.1_4 Reverse -340 -354 11.6718 0.247
NP_441846.1_10 Reverse -362 -381 -23.305 0.282
NP_440642.1_10 Forward -48 -34 8.75042 0.198
NP_441422.1_7 Forward -291 -274 2.10379 0.115
NP_440236.1_2 Reverse -195 -213 -4.01242 0.277
NP_442658.1_1 Forward -291 -281 15.9091 0.00966
NP_442658.1_1 Reverse -278 -288 13.0576 0.04
NP_442782.1_2 Reverse -280 -294 1.47456 0.281
NP_442782.1_2 Reverse -362 -376 0.491246 0.289
NP_442205.1_9 Reverse -274 -290 17.2665 0.0219
NP_442205.1_9 Reverse -377 -393 4.68009 0.148
NP_441414.1_9 Reverse -280 -299 7.27595 0.0358
NP_441414.1_9 Forward -20 -1 -4.22878 0.15
NP_442937.1_5 Reverse -269 -288 8.55425 0.219
NP_441958.1_5 Reverse -279 -289 21.2195 0.000805
NP_441958.1_5 Forward -290 -280 12.2714 0.00183
NP_440203.1_1 Forward -288 -269 16.5191 0.27
NP_440203.1_5 Forward -286 -276 11.6809 0.182
NP_439905.1_1 Forward -288 -275 10.934 0.204
NP_440984.1_7 Forward -294 -280 9.73436 0.127
NP_439990.1_8 Forward -22 -3 2.45773 0.283
NP_442911.1_2 Forward -299 -280 -2.26216 0.096
NP_441580.1_6 Reverse -263 -282 -6.78538 0.235
NP_440153.1_5 Forward -288 -274 3.53951 0.208
NP_440153.1_6 Forward -290 -271 13.3725 0.222
NP_442002.1_9 Forward -290 -283 10.7572 0.185
NP_442013.1_1 Forward -291 -272 10.1275 0.276
NP_441294.1_7 Reverse -283 -297 9.73057 0.229
NP_441294.1_7 Forward -293 -279 9.53859 0.241
NP_441646.1_1 Forward -296 -277 3.04771 0.21
NP_441646.1_7 Forward -271 -257 15.0442 0.252
NP_442438.1_10 Forward -294 -280 14.0609 0.0322
NP_442438.1_10 Reverse -275 -289 3.34284 0.163
NP_442438.1_10 Forward -395 -381 1.67122 0.19
NP_440377.1_1 Reverse -114 -131 10.5973 0.293
NP_441000.1_6 Reverse -279 -293 -3.34366 0.221
NP_441000.1_6 Forward -290 -276 -5.70361 0.29
NP_442771.1_1 Reverse -278 -296 -5.78238 0.166
NP_441674.1_2 Reverse -267 -286 9.83255 0.197
NP_440147.1_4 Forward -291 -278 12.0157 0.0326
NP_440147.1_4 Reverse -278 -291 2.47756 0.208
NP_441295.1_4 Forward -271 -252 -0.885524 0.29
NP_441550.1_8 Reverse -278 -288 13.0576 0.0273
NP_441550.1_8 Forward -291 -281 8.3377 0.124
NP_441916.1_7 Forward -289 -279 18.9579 0.00144
NP_441916.1_7 Reverse -280 -290 18.4663 0.00144
NP_440465.1_4 Forward -290 -271 12.3892 0.217
NP_441041.1_4 Reverse -280 -299 -7.08038 0.181
NP_441041.1_7 Forward -292 -280 15.6777 0.0222
NP_442396.1_5 Forward -293 -280 8.37742 0.157
NP_441547.1_2 Reverse -269 -287 3.06741 0.291
NP_442004.1_6 Forward -289 -275 17.9942 0.0534
NP_441725.1_5 Forward -288 -278 11.1898 0.0247
NP_441725.1_5 Reverse -281 -291 2.04498 0.115
NP_439966.1_7 Reverse -278 -288 14.8275 0.0177
NP_439966.1_7 Forward -291 -281 9.91099 0.0968
NP_439966.1_7 Forward -350 -340 4.01116 0.295
NP_439966.1_9 Forward -291 -282 0.884706 0.253
NP_440736.1_3 Reverse -278 -297 8.94757 0.145
NP_442941.1_3 Forward -288 -278 19.9412 0.00262
NP_442941.1_3 Reverse -281 -291 2.63497 0.14
NP_440289.1_2 Reverse -277 -290 -2.73398 0.262
NP_440289.1_2 Forward -292 -279 -3.71729 0.267
NP_440260.1_8 Reverse -346 -364 -1.25915 0.232
NP_442281.1_1 Forward -294 -280 12.487 0.0369
NP_442281.1_1 Reverse -275 -289 6.39049 0.127
NP_440437.1_1 Forward -295 -276 -0.4922 0.181
NP_441556.1_10 Forward -295 -281 10.1245 0.275
NP_440498.1_1 Forward -298 -280 17.7187 0.0181
NP_440498.1_1 Reverse -271 -289 -0.570838 0.218
NP_440375.1_8 Reverse -281 -300 10.8159 0.138
NP_441644.1_6 Forward -289 -279 19.0557 0.000803
NP_441644.1_6 Reverse -280 -290 10.1076 0.0628
NP_441644.1_6 Forward -169 -159 4.10949 0.249
NP_442215.1_2 Reverse -326 -342 -2.49807 0.198
NP_442215.1_2 Reverse -278 -294 -2.49807 0.198
NP_442215.1_2 Forward -291 -275 -4.56302 0.235
NP_442215.1_2 Reverse -9 -25 -7.0213 0.284
NP_442029.1_10 Forward -356 -337 12.9791 0.158
NP_440929.1_8 Forward -289 -280 19.2726 0.000701
NP_440929.1_8 Reverse -280 -289 19.2726 0.000701
NP_442933.1_10 Forward -289 -280 17.601 0.00325
NP_442933.1_10 Reverse -280 -289 17.601 0.00325
NP_442933.1_10 Forward -296 -287 3.63797 0.293
NP_441751.2_8 Forward -288 -274 13.9626 0.0133
NP_442926.1_5 Forward -294 -275 23.9581 0.00685
NP_442554.1_8 Forward -288 -278 16.9913 0.0065
NP_442554.1_8 Reverse -281 -291 13.2547 0.0187
NP_441762.1_7 Reverse -279 -291 10.2654 0.0142
NP_441762.1_7 Forward -290 -278 2.20226 0.0676
NP_442142.1_4 Forward -292 -279 14.4733 0.0311
NP_442142.1_4 Reverse -277 -290 8.2785 0.118
NP_442292.1_1 Forward -288 -279 17.5026 0.00435
NP_442292.1_1 Reverse -281 -290 9.63616 0.0183
NP_442476.1_6 Reverse -281 -295 11.8976 0.0525
NP_443009.1_5 Reverse -279 -290 19.626 0.00102
NP_443009.1_5 Forward -290 -279 7.82632 0.118
NP_442408.2_1 Forward -289 -270 -0.0988766 0.204
NP_441371.1_3 Reverse -168 -186 8.08229 0.277
NP_441715.1_4 Forward -288 -278 14.238 0.0295
NP_441715.1_4 Reverse -281 -291 9.41981 0.097
NP_440279.1_8 Forward -184 -165 11.8975 0.281
NP_442076.1_5 Reverse -154 -173 6.68596 0.256
NP_440183.1_10 Reverse -320 -334 21.0666 0.0824
NP_441198.1_8 Reverse -278 -288 13.2713 0.108
NP_441468.1_1 Forward -288 -281 15.8704 0.0124
NP_441468.1_1 Reverse -281 -288 15.8704 0.0124
NP_441020.2_6 Reverse -278 -295 7.41366 0.232
NP_441015.1_10 Reverse -275 -294 13.7658 0.0564
NP_441673.1_1 Forward -289 -280 20.8459 0.000698
NP_441673.1_1 Reverse -280 -289 20.8459 0.000698
NP_442253.1_5 Reverse -346 -363 -1.43612 0.256
NP_441826.1_2 Forward -295 -281 3.44117 0.11
NP_441826.1_2 Reverse -274 -288 -4.32697 0.295
NP_442490.1_9 Reverse -268 -287 4.81767 0.165
NP_442868.1_6 Reverse -278 -288 1.06167 0.205
NP_442868.1_6 Forward -291 -281 0.865012 0.205
NP_442719.1_2 Forward -327 -309 -5.48809 0.219
NP_442719.1_2 Forward -61 -43 -8.733 0.255
NP_441251.1_7 Reverse -107 -120 15.6539 0.266
NP_442808.1_1 Forward -290 -280 18.4657 0.00201
NP_442808.1_1 Reverse -279 -289 8.73102 0.0481
NP_442808.1_1 Forward -372 -362 8.14104 0.0564
NP_440145.1_3 Reverse -329 -348 -5.11376 0.258
NP_442542.1_2 Forward -373 -360 8.9674 0.142
NP_442542.1_9 Reverse -273 -287 7.96378 0.178
NP_442050.1_5 Reverse -278 -288 18.0724 0.00365
NP_442789.1_4 Forward -232 -213 -4.22878 0.259
NP_441878.1_6 Reverse -279 -289 10.5014 0.0176
NP_441878.1_6 Forward -290 -280 10.4031 0.0176
NP_441878.1_6 Reverse -256 -266 -7.29646 0.217
NP_441878.1_6 Forward -267 -257 -7.59145 0.245
NP_441878.1_10 Reverse -348 -362 11.701 0.289
NP_441036.1_8 Forward -290 -280 17.7779 0.000554
NP_441036.1_8 Reverse -279 -289 15.713 0.00724
NP_441036.1_8 Reverse -286 -296 5.68323 0.265
NP_441557.1_5 Forward -289 -280 19.9609 0.000699
NP_441557.1_5 Reverse -280 -289 19.9609 0.000699
NP_441557.1_8 Forward -379 -369 10.4026 0.289
NP_441445.1_1 Reverse -353 -372 0.982764 0.264
NP_441445.1_8 Reverse -162 -181 -12.3902 0.277
NP_441445.1_8 Reverse -336 -355 -12.4886 0.277
NP_441308.1_8 Reverse -278 -288 13.353 0.218
NP_440101.1_3 Forward -294 -275 10.5209 0.121
NP_440101.1_3 Reverse -275 -294 1.47442 0.274
NP_442183.1_1 Forward -289 -275 17.5025 0.0107
NP_442464.1_1 Forward -231 -212 30.6787 0.0001
NP_442464.1_2 Forward -255 -236 23.0089 0.0135
NP_442464.1_6 Forward -279 -260 26.9421 0.00384
NP_441549.1_9 Reverse -276 -294 4.73903 0.0925
NP_442347.1_2 Reverse -281 -290 11.1111 0.056
NP_442347.1_2 Forward -288 -279 3.34298 0.284
NP_442645.1_2 Reverse -272 -291 -6.49039 0.0893
NP_442645.1_2 Forward -291 -272 -18.8801 0.28
NP_442645.1_2 Forward -304 -285 -22.0267 0.29
NP_441037.1_4 Forward -291 -281 14.7245 0.028
NP_441037.1_4 Reverse -278 -288 7.31769 0.237
NP_442594.1_8 Reverse -158 -177 4.12936 0.273
NP_441633.1_3 Forward -291 -278 3.26421 0.0709
NP_441633.1_3 Forward -384 -371 -4.11062 0.181
NP_441633.1_3 Reverse -278 -291 -5.78224 0.236
NP_440136.1_2 Forward -288 -281 15.9687 0.0123
NP_440136.1_2 Reverse -281 -288 15.9687 0.0123
NP_442590.1_10 Forward -296 -277 5.60432 0.258
NP_442998.1_10 Forward -287 -280 15.5754 0.0102
NP_442998.1_10 Reverse -282 -289 15.5754 0.0102
NP_440899.1_2 Reverse -269 -288 7.96345 0.209
NP_440899.1_8 Forward -62 -43 -3.93378 0.231
NP_440299.1_1 Forward -293 -280 16.4399 0.0101
NP_440299.1_1 Reverse -305 -318 2.67367 0.279
NP_441799.1_1 Reverse -276 -290 19.7634 0.00609
NP_441799.1_1 Forward -293 -279 16.4202 0.0151
NP_441007.1_10 Reverse -275 -288 12.9006 0.0499
NP_442333.2_5 Reverse -269 -288 -14.7502 0.282
NP_440256.1_1 Forward -292 -273 0.0977854 0.087
NP_440256.1_1 Reverse -277 -296 -7.86702 0.247
NP_441090.1_6 Reverse -160 -174 22.714 0.0687
NP_441559.1_8 Forward -294 -280 0.0979218 0.17
NP_440915.1_6 Forward -293 -279 11.8976 0.0236
NP_440717.1_3 Forward -384 -370 8.84875 0.255
NP_442785.1_7 Reverse -278 -292 9.73436 0.244
NP_441866.1_6 Forward -291 -272 11.8967 0.19
NP_441866.1_6 Forward -69 -50 10.7167 0.218
NP_441939.1_3 Forward -288 -269 7.57094 0.198
NP_441199.1_6 Forward -293 -274 0.982764 0.228
NP_441494.1_6 Reverse -275 -288 8.57408 0.23
NP_442993.1_1 Forward -289 -273 6.35172 0.0399
NP_442386.1_9 Forward -290 -281 15.7322 0.0144
NP_442386.1_9 Reverse -279 -288 6.39082 0.219
NP_441340.1_5 Forward -288 -281 15.6737 0.0124
NP_441340.1_5 Reverse -281 -288 15.6737 0.0124
NP_442506.1_2 Reverse -269 -288 5.01433 0.269
NP_440586.1_1 Reverse -273 -292 -1.96717 0.249
NP_440586.1_8 Forward -288 -281 13.2151 0.026
NP_440586.1_8 Reverse -281 -288 13.2151 0.026
NP_440586.1_8 Forward -168 -161 7.02027 0.279
NP_442251.1_6 Forward -288 -281 15.2804 0.0124
NP_442251.1_6 Reverse -281 -288 15.2804 0.0124
NP_442959.1_5 Reverse -143 -162 12.0942 0.222
NP_440684.1_9 Reverse -274 -288 6.88276 0.288
NP_441262.1_3 Reverse -280 -287 14.7888 0.0223
NP_441262.1_3 Forward -289 -282 14.7888 0.0223
NP_440027.1_3 Forward -358 -340 9.26148 0.186
NP_443051.1_1 Reverse -279 -288 19.5676 0.00335
NP_443051.1_1 Forward -290 -281 10.4228 0.00754
NP_439937.1_8 Reverse -269 -288 3.83436 0.203
NP_439937.1_9 Reverse -279 -296 -16.383 0.287
NP_440408.1_7 Forward -289 -270 11.9958 0.212
NP_440439.1_1 Reverse -277 -290 18.5055 0.0105
NP_440439.1_1 Forward -292 -279 8.27909 0.0547
NP_440372.1_2 Forward -288 -281 16.3621 0.0124
NP_440372.1_2 Reverse -281 -288 16.3621 0.0124
NP_440171.1_3 Reverse -367 -386 1.37609 0.294
NP_441789.1_7 Forward -380 -361 -4.62285 0.284
NP_440819.1_5 Reverse -317 -325 7.98423 0.228
NP_441803.1_2 Forward -288 -269 1.67108 0.228
NP_441803.1_2 Reverse -275 -294 0.196116 0.258
NP_440139.1_1 Reverse -274 -293 2.35861 0.235
NP_441572.1_7 Forward -295 -276 5.99764 0.0851
NP_441572.1_7 Reverse -274 -293 2.65439 0.13
NP_440267.1_2 Reverse -207 -221 6.58715 0.228
NP_440267.1_2 Forward -67 -53 6.19383 0.239
NP_440267.1_2 Reverse -323 -337 5.70218 0.259
NP_442384.1_10 Forward -289 -276 15.1623 0.0113
NP_442384.1_10 Reverse -280 -293 14.7689 0.0132
NP_442384.1_10 Reverse -274 -287 4.05085 0.17
NP_441604.1_4 Reverse -301 -320 -6.88371 0.293
NP_441604.1_4 Forward -297 -278 -7.08038 0.293
NP_442262.1_10 Forward -288 -281 14.1988 0.0123
NP_442262.1_10 Reverse -281 -288 14.1988 0.0123
NP_442262.1_10 Reverse -18 -25 7.6106 0.274
NP_441689.1_5 Reverse -278 -288 17.8758 0.0158
NP_440344.1_10 Reverse -273 -290 -9.89259 0.16
NP_440282.1_10 Reverse -270 -289 6.39097 0.125
NP_440531.1_6 Reverse -272 -291 8.94757 0.0842
NP_442123.1_3 Forward -289 -270 12.6841 0.196
NP_440189.1_2 Reverse -272 -291 1.17943 0.268
NP_441965.1_10 Reverse -277 -293 10.8749 0.107
NP_442693.1_7 Reverse -338 -357 13.5691 0.202
NP_440297.1_9 Forward -288 -278 9.22315 0.0917
NP_440297.1_9 Reverse -281 -291 -0.118297 0.282
NP_441592.1_4 Reverse -280 -299 -0.688862 0.246
NP_440894.1_7 Forward -328 -309 16.2232 0.121
NP_440999.1_9 Forward -293 -279 0.982901 0.172
NP_440888.1_2 Forward -289 -275 13.1753 0.0324
NP_440888.1_2 Reverse -280 -294 9.04542 0.139
NP_441543.1_2 Reverse -281 -290 18.486 0.00236
NP_441543.1_2 Forward -288 -279 15.9293 0.00518
NP_441543.1_3 Forward -383 -369 10.2254 0.212
NP_442845.1_2 Reverse -274 -288 18.8791 0.0608
NP_442845.1_2 Forward -295 -281 5.01447 0.247
NP_441551.1_5 Forward -293 -277 12.4475 0.152
NP_440982.1_1 Forward -380 -361 8.75009 0.278
NP_441469.1_8 Forward -290 -281 16.126 0.00797
NP_441469.1_8 Reverse -279 -288 6.5879 0.227
NP_443064.1_6 Forward -289 -279 10.8217 0.13
NP_442578.1_7 Forward -288 -281 14.5921 0.026
NP_442578.1_7 Reverse -281 -288 14.5921 0.026
NP_440710.1_1 Forward -240 -222 -9.12563 0.294
NP_441462.1_2 Forward -289 -279 20.2362 0.000805
NP_441462.1_2 Reverse -280 -290 11.5831 0.00406
NP_441621.1_7 Reverse -278 -292 -3.147 0.188
NP_441621.1_7 Forward -291 -277 -5.70361 0.26
NP_443062.1_1 Reverse -280 -298 6.98581 0.188
NP_443062.1_1 Forward -199 -181 4.64563 0.255
NP_442204.1_1 Reverse -276 -287 7.63016 0.123
NP_442204.1_5 Forward -299 -280 7.47261 0.128
NP_440255.1_5 Reverse -20 -34 14.7174 0.296
NP_440516.1_2 Forward -295 -277 -1.84914 0.292
NP_440516.1_8 Forward -289 -280 16.9127 0.00442
NP_440516.1_8 Reverse -280 -289 16.9127 0.00442
NP_440516.1_8 Reverse -362 -371 7.07956 0.0867
NP_442428.1_4 Reverse -256 -275 3.44104 0.242
NP_442428.1_5 Forward -288 -281 15.8704 0.0124
NP_442428.1_5 Reverse -281 -288 15.8704 0.0124
NP_440673.1_2 Reverse -270 -289 11.0725 0.188
NP_440673.1_3 Forward -287 -280 12.4288 0.0426
NP_440673.1_3 Reverse -282 -289 12.4288 0.0426
NP_440865.1_9 Reverse -274 -293 -0.688862 0.167
NP_441052.1_2 Reverse -280 -290 10.5014 0.0285
NP_441052.1_2 Forward -289 -279 10.4031 0.0285
NP_441052.1_2 Forward -337 -327 1.84832 0.225
NP_442219.1_9 Reverse -281 -290 8.35786 0.0681
NP_442219.1_9 Forward -288 -279 8.25953 0.0681
NP_440436.1_4 Reverse -281 -290 18.1905 0.00233
NP_440436.1_4 Forward -288 -279 9.24241 0.0871
NP_440436.1_4 Forward -178 -169 7.76745 0.124
NP_441884.1_9 Forward -292 -273 -23.895 0.284
NP_440314.1_9 Reverse -288 -307 -9.14533 0.26
NP_442577.1_10 Forward -160 -141 8.06178 0.216
NP_441719.1_4 Forward -288 -281 16.3621 0.0124
NP_441719.1_4 Reverse -281 -288 16.3621 0.0124
NP_441004.1_4 Forward -399 -389 8.63316 0.269
NP_442366.1_3 Reverse -348 -366 0.412472 0.172
NP_442366.1_3 Forward -290 -272 -2.53746 0.229
NP_442366.1_3 Reverse -279 -297 -2.73412 0.232
NP_442366.1_5 Forward -292 -282 11.9759 0.148
NP_440296.1_10 Forward -292 -273 -13.5702 0.269
NP_441115.1_4 Reverse -279 -297 14.2763 0.0592
NP_442694.1_4 Forward -216 -207 13.8644 0.217
NP_442206.1_7 Forward -291 -272 14.6508 0.254
NP_440328.1_4 Forward -295 -276 0.196116 0.258
NP_443054.1_2 Reverse -278 -292 11.0127 0.0761
NP_441851.1_10 Forward -290 -280 16.008 0.00552
NP_441851.1_10 Reverse -279 -289 8.53483 0.114
NP_440495.1_8 Reverse -173 -192 5.89931 0.212
NP_442515.1_1 Forward -290 -276 2.2612 0.14
NP_441683.1_7 Forward -90 -71 -8.65367 0.284
NP_440593.1_3 Forward -288 -269 9.43923 0.107
NP_441349.1_10 Forward -299 -280 7.7676 0.0292
NP_441349.1_10 Reverse -270 -289 -1.67217 0.106
NP_441107.1_6 Forward -349 -337 21.1801 0.119
NP_440474.1_8 Forward -288 -274 14.0603 0.0658
NP_442450.1_5 Reverse -278 -288 9.41981 0.115
NP_442450.1_5 Forward -291 -281 7.55152 0.13
NP_440588.1_2 Reverse -271 -290 18.1907 0.0104
NP_440588.1_2 Forward -298 -279 17.699 0.0104
NP_440588.1_2 Forward -292 -273 0.687771 0.146
NP_441570.1_1 Forward -289 -271 -5.78238 0.0761
NP_441570.1_1 Reverse -274 -292 -8.73231 0.12
NP_441570.1_1 Reverse -280 -298 -16.3038 0.242
NP_441078.1_4 Forward -289 -280 19.6659 0.0007
NP_441078.1_4 Reverse -280 -289 19.6659 0.0007
NP_441432.1_8 Reverse -279 -288 16.8143 0.00595
NP_441432.1_8 Forward -290 -281 8.25953 0.0755
NP_441432.1_8 Reverse -361 -370 2.94966 0.28
NP_442320.1_8 Forward -295 -281 -2.26202 0.0871
NP_442344.1_7 Reverse -281 -300 2.3594 0.0638
NP_441732.1_2 Forward -293 -277 -7.61128 0.0861
NP_441732.1_2 Reverse -276 -292 -7.70961 0.0885
NP_442815.1_2 Reverse -191 -209 2.28076 0.296
NP_440760.1_1 Forward -289 -270 -14.1602 0.125
NP_440199.1_10 Reverse -277 -287 12.9597 0.114
NP_440199.1_10 Reverse -359 -369 8.63316 0.231
NP_441072.1_2 Forward -300 -281 13.4708 0.163
NP_441072.1_2 Reverse -149 -168 11.2092 0.188
NP_441072.1_2 Reverse -276 -295 8.75091 0.238
NP_440280.1_6 Reverse -160 -179 22.3206 0.0723
NP_440713.1_3 Reverse -334 -353 1.57275 0.28
NP_440713.1_4 Reverse -270 -289 7.37428 0.182
NP_442489.1_7 Forward -289 -280 20.1576 0.000695
NP_442489.1_7 Reverse -280 -289 20.1576 0.000695
NP_442489.1_7 Forward -296 -287 -1.96689 0.28
NP_442079.1_6 Reverse -272 -291 23.9922 0.00688
NP_440559.1_1 Reverse -281 -290 8.75118 0.0586
NP_440559.1_1 Forward -288 -279 8.65285 0.0586
NP_441659.2_8 Forward -289 -279 20.9245 0.000805
NP_441659.2_8 Reverse -280 -290 11.9764 0.0147
NP_442913.1_10 Forward -298 -279 -2.45882 0.186
NP_441040.1_5 Forward -294 -275 9.24257 0.226
NP_442346.1_5 Reverse -279 -289 16.303 0.00248
NP_442346.1_5 Forward -290 -280 9.02648 0.118
NP_440545.1_3 Forward -293 -276 13.9035 0.0166
NP_440545.1_3 Reverse -276 -293 -2.12444 0.179
NP_441856.1_3 Reverse -277 -296 1.17943 0.213
NP_440831.1_3 Reverse -271 -290 4.93098 0.294
NP_440486.1_6 Reverse -159 -178 6.68596 0.283
NP_440459.1_2 Reverse -278 -295 10.2653 0.204
NP_442311.1_8 Forward -275 -256 9.0459 0.278
NP_441948.1_4 Forward -355 -337 -5.78238 0.278
NP_441833.1_4 Forward -288 -281 15.9687 0.0124
NP_441833.1_4 Reverse -281 -288 15.9687 0.0124
NP_441329.1_6 Reverse -192 -211 -2.72194 0.294
NP_442162.1_9 Forward -288 -281 16.2637 0.0124
NP_442162.1_9 Reverse -281 -288 16.2637 0.0124
NP_440671.1_4 Forward -295 -281 7.86607 0.207
NP_442140.1_3 Reverse -281 -291 16.2046 0.0255
NP_441696.1_6 Forward -288 -269 -0.295539 0.294
NP_440875.1_9 Reverse -282 -292 9.15072 0.233
NP_441813.1_5 Reverse -278 -288 15.9097 0.01
NP_441813.1_5 Forward -291 -281 9.91146 0.021
NP_440590.1_4 Reverse -281 -294 1.78924 0.111
NP_440590.1_4 Forward -288 -275 -5.38892 0.277
NP_440567.1_1 Reverse -281 -295 18.8791 0.0136
NP_440567.1_1 Forward -288 -274 14.2576 0.0187
NP_440567.1_6 Forward -288 -269 6.88262 0.228
NP_442497.1_10 Forward -288 -279 17.601 0.00813
NP_442497.1_10 Reverse -281 -290 10.4228 0.0087
NP_440821.1_4 Reverse -278 -288 11.0914 0.0146
NP_440821.1_4 Forward -291 -281 10.2065 0.0163
NP_441239.1_9 Reverse -278 -290 14.6903 0.0258
NP_441239.1_9 Forward -291 -279 12.3303 0.0477
NP_441239.1_9 Forward -384 -372 6.33216 0.193
NP_441239.1_9 Forward -350 -338 2.98891 0.3
NP_441892.1_1 Reverse -271 -288 -3.40274 0.239
NP_441892.1_10 Forward -215 -196 18.879 0.147
NP_442270.1_9 Forward -294 -275 -5.60541 0.207
NP_442270.1_9 Reverse -269 -288 -7.4737 0.213
NP_442270.1_9 Forward -173 -154 -11.5053 0.272
NP_440212.1_9 Forward -153 -134 1.81064 0.262
NP_440354.1_5 Forward -292 -273 9.24257 0.174
NP_440546.1_4 Forward -289 -279 13.5365 0.0459
NP_440546.1_4 Reverse -280 -290 11.8882 0.0679
NP_440546.1_4 Reverse -362 -372 8.20381 0.199
NP_440462.1_6 Reverse -278 -288 16.893 0.00853
NP_440462.1_6 Forward -291 -281 9.02648 0.0498
NP_442465.1_6 Reverse -19 -38 18.1908 0.295
NP_442611.1_1 Reverse -280 -299 12.7825 0.07
NP_440868.1_4 Reverse -276 -288 17.7386 0.0124
NP_440868.1_4 Forward -293 -281 15.7719 0.0164
NP_441474.1_1 Forward -381 -362 -2.36125 0.275
NP_441848.1_7 Forward -57 -38 -4.72118 0.298
NP_440696.1_6 Reverse -361 -380 5.11266 0.282
NP_442039.1_4 Forward -288 -281 15.1821 0.0124
NP_442039.1_4 Reverse -281 -288 15.1821 0.0124
NP_441811.1_8 Reverse -274 -288 10.1277 0.22
NP_440825.1_7 Reverse -281 -291 12.4217 0.155
NP_442696.1_6 Forward -179 -160 -13.1769 0.265
NP_442837.1_3 Forward -288 -281 15.7721 0.0124
NP_442837.1_3 Reverse -281 -288 15.7721 0.0124
NP_439994.1_3 Forward -290 -271 9.02386 0.264
NP_442053.1_1 Forward -289 -280 18.3876 0.0007
NP_442053.1_1 Reverse -280 -289 18.3876 0.0007
NP_442053.1_1 Reverse -287 -296 5.80125 0.164
NP_440505.1_3 Reverse -278 -288 15.123 0.014
NP_440505.1_3 Forward -291 -281 6.76487 0.169
NP_441701.1_3 Reverse -346 -363 12.8219 0.204
NP_441203.1_1 Reverse -281 -300 -18.9784 0.297
NP_442532.1_7 Forward -289 -275 4.42448 0.171
NP_440914.1_1 Forward -289 -279 16.3248 0.00196
NP_440914.1_1 Reverse -280 -290 8.6151 0.186
NP_440914.1_7 Reverse -128 -147 13.4162 0.18
NP_441011.1_8 Reverse -281 -290 16.9127 0.00602
NP_441011.1_8 Forward -288 -279 16.6177 0.00602
NP_442101.1_10 Forward -297 -278 -5.11376 0.158
NP_442533.1_6 Forward -289 -280 17.2076 0.00137
NP_442533.1_6 Reverse -280 -289 17.2076 0.00137
NP_442533.1_6 Forward -348 -339 2.55633 0.25
NP_442533.1_6 Forward -169 -160 2.26134 0.266
NP_442533.1_6 Reverse -287 -296 1.86802 0.284
NP_442232.1_3 Reverse -272 -291 -13.3736 0.282
NP_442229.1_1 Reverse -278 -292 8.55376 0.184
NP_441482.1_7 Reverse -274 -288 -1.47537 0.0721
NP_439944.1_9 Forward -288 -278 17.6796 0.00347
NP_441697.1_5 Forward -153 -134 -6.15965 0.232
NP_441697.1_5 Forward -132 -113 -7.49654 0.246
NP_440116.1_8 Reverse -281 -300 -8.65367 0.256
NP_441527.1_5 Reverse -278 -297 14.3475 0.287
NP_440115.1_6 Reverse -277 -287 6.46988 0.181
NP_439965.1_1 Forward -298 -279 -5.31042 0.209
NP_441680.1_4 Reverse -304 -323 0.392778 0.246
NP_441972.1_5 Forward -282 -263 -2.16383 0.178
NP_441972.1_5 Forward -381 -362 -9.83364 0.293
NP_441106.1_1 Reverse -279 -288 18.486 0.0028
NP_441106.1_1 Forward -290 -281 18.191 0.0028
NP_441106.1_9 Reverse -1 -11 15.2213 0.289
NP_439903.1_6 Forward -292 -273 9.24175 0.124
NP_442306.1_10 Reverse -275 -294 -19.7651 0.2
NP_441286.1_1 Forward -290 -278 4.8572 0.0272
NP_441286.1_1 Reverse -279 -291 -3.40261 0.145
NP_440670.1_8 Forward -289 -280 18.3876 0.000699
NP_440670.1_8 Reverse -280 -289 18.3876 0.000699
NP_441930.1_1 Forward -293 -274 5.40766 0.283
NP_440886.1_7 Forward -290 -280 17.7774 0.0011
NP_440886.1_7 Reverse -279 -289 8.04271 0.0805
NP_440828.1_1 Forward -380 -361 6.58682 0.197
NP_442614.1_2 Reverse -280 -294 7.47274 0.273
NP_442614.1_2 Forward -289 -275 7.27608 0.275
NP_439995.1_5 Forward -299 -280 5.80098 0.276
NP_442072.1_9 Forward -297 -279 -14.1405 0.133
NP_442072.1_9 Reverse -279 -297 -21.712 0.212
NP_440907.2_8 Reverse -281 -291 14.2375 0.0312
NP_440907.2_8 Forward -288 -278 9.51767 0.103
NP_442264.1_5 Forward -289 -275 11.996 0.253
NP_441021.1_1 Forward -288 -269 -6.09707 0.177
NP_441463.1_3 Forward -231 -212 -10.522 0.296
NP_441463.1_6 Reverse -278 -292 7.7688 0.252
NP_441626.1_2 Forward -288 -281 15.7721 0.0124
NP_441626.1_2 Reverse -281 -288 15.7721 0.0124
NP_442794.1_1 Forward -293 -281 2.69391 0.286
NP_441401.1_9 Reverse -111 -129 16.9788 0.234
NP_442615.1_1 Forward -298 -280 15.1621 0.00922
NP_442615.1_1 Reverse -271 -289 -1.75081 0.132
NP_440387.1_1 Forward -289 -273 14.4149 0.00649
NP_440387.1_1 Reverse -280 -296 6.64671 0.0282
NP_441431.1_2 Forward -292 -278 7.96378 0.23
NP_441431.1_2 Reverse -277 -291 7.96378 0.23
NP_441521.1_2 Forward -386 -369 14.0994 0.296
NP_441174.1_2 Reverse -277 -291 16.8142 0.062
NP_440114.1_10 Forward -289 -275 18.7808 0.00482
NP_440114.1_10 Reverse -170 -184 7.66941 0.229
NP_441425.1_2 Forward -152 -133 10.7406 0.299
NP_441156.1_5 Reverse -208 -218 16.1594 0.23
NP_440766.1_4 Reverse -276 -290 6.6861 0.0991
NP_442743.1_5 Forward -288 -269 10.6192 0.143
NP_442743.1_5 Reverse -275 -294 4.12936 0.231
NP_440457.1_1 Forward -293 -281 2.10393 0.217
NP_440457.1_1 Reverse -276 -288 1.90727 0.223
NP_440457.1_1 Reverse -369 -381 0.23564 0.25
NP_440798.1_6 Reverse -281 -294 21.8488 0.0101
NP_441984.1_3 Reverse -252 -270 5.23069 0.293
NP_440473.1_1 Reverse -277 -296 11.2574 0.28
NP_442509.1_9 Reverse -280 -290 16.2041 0.00739
NP_442509.1_9 Forward -289 -279 8.04271 0.192
NP_442514.1_5 Reverse -261 -280 -5.1145 0.254
NP_441159.1_1 Reverse -230 -249 -2.36049 0.226
NP_440554.1_4 Forward -288 -278 16.1063 0.0189
NP_440554.1_4 Reverse -281 -291 7.35486 0.103
NP_440554.1_4 Forward -347 -337 2.43831 0.265
NP_442862.1_3 Reverse -48 -65 4.95539 0.28
NP_441885.1_5 Reverse -280 -290 11.4848 0.00668
NP_441885.1_5 Forward -289 -279 11.3864 0.00668
NP_440478.1_10 Forward -291 -277 7.76774 0.257
NP_440478.1_10 Forward -302 -288 5.99778 0.3
NP_442703.1_4 Reverse -280 -299 2.26028 0.283
NP_442341.1_5 Reverse -260 -279 11.0125 0.295
NP_442341.1_7 Forward -290 -276 6.3911 0.127
NP_442341.1_7 Forward -21 -7 4.71948 0.181
NP_442341.1_9 Forward -291 -277 12.2903 0.108
NP_442341.1_9 Reverse -278 -292 10.422 0.135
NP_442395.2_4 Reverse -279 -298 10.1267 0.101
NP_440409.1_1 Reverse -272 -291 -1.18052 0.225
NP_440191.1_2 Forward -335 -316 5.89851 0.118
NP_440423.1_6 Reverse -272 -291 -16.0285 0.229
NP_443000.1_7 Reverse -278 -288 17.4829 0.00719
NP_443000.1_7 Forward -291 -281 1.94665 0.226
NP_441842.1_10 Reverse -273 -287 6.88276 0.271
NP_440275.1_3 Reverse -278 -288 9.12481 0.055
NP_440275.1_3 Forward -291 -281 8.33817 0.0602
NP_440275.1_3 Reverse -337 -347 2.24165 0.269
NP_440091.1_1 Forward -293 -281 3.2839 0.163
NP_440091.1_1 Reverse -166 -178 0.530633 0.247
NP_443060.1_5 Forward -297 -278 7.37347 0.227
NP_441902.1_3 Reverse -32 -42 12.3986 0.253
NP_440679.1_10 Reverse -273 -292 -12.7836 0.213
NP_442451.1_2 Reverse -272 -291 -2.75381 0.187
NP_442451.1_2 Forward -398 -379 -5.80207 0.226
NP_442451.1_2 Reverse -9 -28 -6.58872 0.232
NP_442495.1_4 Forward -314 -304 11.5831 0.271
NP_440149.1_8 Forward -289 -270 7.96426 0.0626
NP_440149.1_8 Reverse -274 -293 0.294447 0.14
NP_440216.1_1 Reverse -280 -294 16.8142 0.00213
NP_440216.1_1 Forward -289 -275 -1.5737 0.034
NP_440216.1_1 Reverse -362 -376 -6.29359 0.141
NP_440216.1_1 Forward -296 -282 -11.3085 0.178
NP_440216.1_9 Reverse -39 -48 9.83282 0.286
NP_440172.1_1 Forward -289 -279 17.5813 0.00421
NP_440172.1_1 Reverse -280 -290 8.73149 0.0586
NP_442015.1_3 Forward -381 -362 15.3382 0.178
NP_442015.1_10 Forward -293 -280 10.4424 0.0391
NP_442015.1_10 Reverse -276 -289 1.78924 0.204
NP_441226.1_7 Forward -288 -281 14.4934 0.0123
NP_441226.1_7 Reverse -281 -288 14.4934 0.0123
NP_441226.1_7 Forward -347 -340 8.59356 0.197
NP_441111.1_7 Forward -288 -280 18.7023 0.00294
NP_441111.1_7 Reverse -281 -289 18.7023 0.00294
NP_442379.1_10 Reverse -273 -290 -3.69774 0.265
NP_441766.1_2 Forward -289 -280 17.5026 0.00297
NP_441766.1_2 Reverse -280 -289 17.5026 0.00297
NP_442969.1_4 Forward -85 -66 4.916 0.274
NP_442417.1_5 Reverse -280 -294 7.66941 0.18
NP_440416.1_9 Forward -296 -277 -7.4737 0.102
NP_440416.1_9 Forward -355 -336 -19.5684 0.276
NP_443052.1_8 Forward -299 -280 -10.9153 0.218
NP_440072.1_5 Reverse -364 -382 -0.374176 0.238
NP_440261.1_5 Reverse -281 -294 -1.06236 0.0655
NP_440261.1_5 Forward -288 -275 -2.73398 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGGGCCAATTGATATCCTCCCCTCACCCCCCGATAGGCATTAACTATGCCCGCCCGTCGCAGGGTAATCAACAGTTTTTCCAGATAGGGCCCAGGGATATTCTGTCGCTCGGCGATCGCCTTCACCGAAGCAGGGCCGTAGTCCGGTTGTAGAGCTAAATCCAGTAAGGCTTTAACACTGTAATGGCTTTTTGTTGTCAACTTCATCCCTTTAGTATAGAAGCCATCCTTGCCCATCAACTATCCCATTAAATTAACTATTTATTTGAACAAACTAGATAATTATTCCAAGAAACGTGTAATATAAGCAGGGTAGCAAGGAGCAAAAGAGTCAACCATTCCTTCGACTAATCTTCCCTTGCTTACCAATTCTGATCAATCTCAATCACCGAAAACTTGA

CDS

ATGGCTAAATCAAACGCAACCAAGCCCCTAACTGGCGAAGCATTGCTCGAGAAAGTTAAAGAATTAGGCGATCTGCCCAAAGAAGAGAAAGCTAAAATCTGCGGTTATGTAACTTCCACAAAAAAAGGCCTGCCCCGGGTCAATATGATGAAGTTCTACAACGCCTTAATGGATGCCCAAGGCATTGATTTAGACAGTTCTGCTTCCGGTCAAGGTCGGGGTGGCCGCTCCGCTAGTTACCGCATTAGCGTGCAATCCAACGGCAATCTTCTCATTGGAGCCGCCTACACAAAAAAAATGAGCCTCAACGTGGGAGATGAATTTGAAATTACCCTCGGTCGCAAACACATTCACCTCAAACAGGTGGGGGCTGACGACGAAGAAGAGTAA

Protein

MAKSNATKPLTGEALLEKVKELGDLPKEEKAKICGYVTSTKKGLPRVNMMKFYNALMDAQGIDLDSSASGQGRGGRSASYRISVQSNGNLLIGAAYTKKMSLNVGDEFEITLGRKHIHLKQVGADDEEE