Your browser is old and dusty. Try Google Chrome!

Details for sll0815

ORF sll0815
Accession NP_441437.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_2 Reverse -15 -29 17.5018 0.177
NP_441480.1_10 Reverse -7 -26 10.0292 0.207
NP_442291.1_5 Reverse -133 -149 0.845183 0.158
NP_441453.1_4 Forward -143 -135 6.80426 0.121
NP_441818.1_1 Reverse -135 -146 14.2178 0.0541
NP_441630.1_3 Forward -151 -132 -0.0988766 0.285
NP_442173.1_1 Reverse -135 -143 5.72262 0.203
NP_442752.1_4 Forward -143 -136 13.8055 0.0199
NP_442752.1_4 Forward -44 -37 5.44732 0.202
NP_443027.1_4 Forward -145 -135 7.25653 0.24
NP_441812.1_3 Forward -144 -130 10.816 0.216
NP_440784.1_7 Forward -142 -135 6.23397 0.241
NP_440784.1_7 Reverse -135 -142 6.13563 0.241
NP_440061.1_9 Reverse -132 -146 11.307 0.114
NP_442062.1_8 Forward -44 -34 3.12662 0.285
NP_442242.1_4 Reverse -135 -142 10.8555 0.127
NP_442602.1_3 Reverse -214 -233 -4.13045 0.297
NP_441083.1_5 Reverse -134 -144 9.7148 0.0231
NP_441083.1_5 Reverse -35 -45 -0.904945 0.283
NP_441738.1_2 Reverse -136 -143 15.28 0.0102
NP_441738.1_2 Reverse -37 -44 10.2652 0.101
NP_440209.1_1 Reverse -134 -142 11.9175 0.0184
NP_440209.1_1 Forward -143 -135 8.57422 0.0425
NP_442889.1_1 Forward -38 -19 -15.1435 0.288
NP_442398.1_4 Reverse -84 -103 6.48849 0.279
NP_440659.1_9 Forward -152 -133 15.8307 0.133
NP_441025.1_6 Forward -370 -351 5.07832 0.222
NP_440538.1_10 Forward -272 -253 17.2074 0.157
NP_441716.1_1 Reverse -134 -148 5.21113 0.239
NP_440343.1_9 Forward -54 -35 7.57094 0.278
NP_440851.1_6 Reverse -84 -101 2.49712 0.288
NP_440906.1_5 Forward -142 -135 6.23397 0.234
NP_440906.1_5 Reverse -135 -142 6.13563 0.241
NP_440906.1_5 Reverse -5 -12 5.64398 0.292
NP_440906.1_9 Reverse -336 -355 12.6833 0.296
NP_440747.1_10 Forward -146 -134 -2.61596 0.0556
NP_440747.1_10 Reverse -131 -143 -12.2524 0.254
NP_443018.1_3 Forward -142 -135 12.6255 0.0471
NP_443018.1_3 Reverse -135 -142 5.25066 0.214
NP_441634.1_8 Forward -145 -131 2.16287 0.17
NP_440376.1_1 Forward -44 -35 3.7363 0.195
NP_440376.1_1 Forward -143 -134 0.0980582 0.285
NP_440376.1_1 Reverse -134 -143 -0.196935 0.285
NP_442687.1_7 Forward -255 -245 5.19158 0.217
NP_440642.1_8 Reverse -132 -151 13.3153 0.255
NP_441013.1_2 Forward -154 -136 -4.50408 0.299
NP_442658.1_1 Reverse -33 -43 5.68278 0.258
NP_440141.1_8 Forward -103 -84 6.19431 0.268
NP_440656.1_8 Forward -154 -135 -6.98204 0.249
NP_442544.1_2 Reverse -288 -302 8.06273 0.16
NP_441487.1_9 Forward -271 -252 -2.26216 0.293
NP_439959.1_3 Forward -155 -136 13.1758 0.215
NP_441958.1_5 Reverse -133 -143 1.55333 0.095
NP_441958.1_5 Forward -144 -134 -6.31315 0.28
NP_442836.1_5 Reverse -255 -274 2.85105 0.248
NP_442836.1_5 Forward -149 -130 2.45773 0.259
NP_440950.1_8 Reverse -345 -364 10.597 0.233
NP_440984.1_7 Forward -154 -140 4.71948 0.292
NP_439990.1_8 Forward -176 -157 -0.000545616 0.283
NP_442911.1_2 Forward -105 -86 -8.85033 0.244
NP_440153.1_5 Reverse -135 -149 7.66941 0.154
NP_440153.1_8 Forward -270 -257 -2.24233 0.235
NP_442064.1_4 Forward -36 -17 8.4551 0.232
NP_443055.1_3 Forward -152 -133 11.791 0.243
NP_443055.1_6 Reverse -237 -255 0.215075 0.248
NP_440993.1_4 Reverse -17 -34 3.38209 0.289
NP_441000.1_6 Reverse -96 -110 2.75286 0.127
NP_441000.1_6 Reverse -133 -147 -3.44199 0.221
NP_441550.1_8 Forward -145 -135 5.87944 0.224
NP_441916.1_10 Reverse -27 -46 6.4893 0.202
NP_441041.1_4 Reverse -104 -123 -4.13045 0.13
NP_441725.1_5 Forward -43 -33 -0.118297 0.232
NP_439966.1_7 Reverse -132 -142 12.7626 0.0365
NP_439966.1_7 Forward -145 -135 5.58445 0.216
NP_442941.1_3 Reverse -135 -145 9.41981 0.0319
NP_442941.1_3 Forward -142 -132 0.0783647 0.231
NP_440289.1_2 Reverse -131 -144 2.47756 0.096
NP_442281.1_1 Reverse -30 -44 2.65393 0.26
NP_441566.1_3 Forward -152 -133 13.3725 0.243
NP_442256.1_2 Reverse -132 -150 -8.63398 0.232
NP_440437.1_1 Reverse -128 -147 -2.65548 0.22
NP_441860.1_1 Forward -163 -149 13.8041 0.288
NP_441644.1_6 Reverse -134 -144 5.78111 0.176
NP_441644.1_6 Forward -143 -133 5.68278 0.18
NP_443049.1_6 Forward -144 -134 16.5205 0.102
NP_442215.1_2 Forward -307 -291 -5.05468 0.244
NP_442215.1_2 Forward -46 -30 -6.43131 0.271
NP_440253.1_2 Forward -254 -236 -1.75081 0.249
NP_440780.1_1 Reverse -66 -85 8.83258 0.274
NP_442933.1_10 Reverse -134 -143 6.48957 0.119
NP_441751.2_8 Reverse -135 -149 4.42448 0.0499
NP_442554.1_8 Reverse -135 -145 6.37155 0.12
NP_441762.1_7 Forward -98 -86 -6.2542 0.284
NP_442142.1_4 Reverse -131 -144 5.72191 0.186
NP_442292.1_1 Reverse -135 -144 8.65285 0.0335
NP_440919.1_1 Forward -259 -240 -8.16202 0.286
NP_441024.1_7 Reverse -92 -110 9.06482 0.292
NP_442476.1_6 Forward -96 -82 3.14618 0.161
NP_443009.1_5 Reverse -34 -45 5.85971 0.185
NP_441726.1_5 Forward -73 -54 18.7807 0.278
NP_442406.1_9 Reverse -237 -256 0.392778 0.291
NP_442408.2_1 Reverse -89 -108 1.96607 0.175
NP_441715.1_4 Reverse -135 -145 7.55152 0.108
NP_441198.1_2 Reverse -292 -311 14.5516 0.226
NP_441198.1_8 Forward -99 -89 12.1971 0.15
NP_440464.1_3 Reverse -204 -223 11.7008 0.207
NP_441468.1_1 Forward -142 -135 6.13563 0.209
NP_441468.1_1 Reverse -135 -142 6.0373 0.223
NP_441015.1_10 Forward -310 -291 -10.9153 0.289
NP_441673.1_1 Forward -143 -134 1.37636 0.114
NP_441673.1_1 Reverse -134 -143 1.1797 0.163
NP_441876.1_9 Reverse -14 -24 13.1559 0.267
NP_442868.1_6 Forward -145 -135 9.51814 0.0447
NP_442868.1_6 Reverse -132 -142 0.275027 0.243
NP_442719.1_2 Reverse -79 -97 -11.9779 0.299
NP_442559.1_3 Reverse -13 -32 11.2092 0.214
NP_442227.1_2 Forward -261 -242 1.0811 0.25
NP_442427.1_8 Forward -376 -357 6.58763 0.236
NP_442808.1_1 Reverse -133 -143 7.84605 0.0668
NP_442808.1_1 Reverse -205 -215 5.19112 0.168
NP_442808.1_1 Reverse -281 -291 4.20782 0.203
NP_442808.1_1 Reverse -87 -97 4.10949 0.207
NP_442808.1_1 Reverse -142 -152 2.92952 0.252
NP_442542.1_9 Reverse -41 -55 4.8172 0.285
NP_442542.1_9 Forward -150 -136 4.42388 0.297
NP_442050.1_5 Reverse -132 -142 10.8943 0.126
NP_441518.1_3 Forward -153 -134 -13.4719 0.264
NP_441557.1_5 Forward -143 -134 1.08137 0.0794
NP_441557.1_5 Reverse -134 -143 0.589713 0.134
NP_441445.1_1 Forward -53 -34 5.60432 0.166
NP_442267.1_6 Forward -43 -24 19.2723 0.121
NP_442066.2_9 Reverse -130 -143 8.18076 0.19
NP_442830.1_5 Reverse -204 -218 2.35894 0.271
NP_442183.1_1 Forward -44 -30 4.62115 0.254
NP_441574.1_1 Reverse -258 -277 -5.9004 0.27
NP_440276.1_8 Forward -35 -16 6.09597 0.297
NP_442347.1_2 Reverse -135 -144 12.2911 0.056
NP_442764.1_6 Reverse -136 -154 11.1305 0.163
NP_440136.1_2 Forward -142 -135 6.23397 0.171
NP_440136.1_2 Reverse -135 -142 6.13563 0.193
NP_442998.1_5 Forward -20 -10 8.53483 0.261
NP_442998.1_10 Reverse -136 -143 15.5754 0.0102
NP_440899.1_5 Reverse -25 -44 1.96607 0.283
NP_441799.1_1 Forward -147 -133 4.52221 0.247
NP_440256.1_1 Reverse -131 -150 -10.3253 0.299
NP_440087.1_1 Forward -152 -133 12.3892 0.0665
NP_441559.1_8 Reverse -84 -98 4.71948 0.111
NP_441559.1_8 Reverse -201 -215 -3.34366 0.201
NP_441464.1_8 Reverse -86 -100 4.32615 0.277
NP_441340.1_5 Forward -253 -246 8.8889 0.084
NP_441340.1_5 Forward -142 -135 6.23397 0.132
NP_441340.1_5 Reverse -135 -142 5.84064 0.208
NP_442327.1_3 Reverse -360 -379 11.6018 0.182
NP_442484.1_2 Forward -265 -246 0.392778 0.248
NP_442240.1_1 Reverse -259 -278 2.9486 0.295
NP_440586.1_8 Forward -142 -135 14.69 0.026
NP_442251.1_6 Reverse -135 -142 12.0355 0.0627
NP_441262.1_3 Forward -143 -136 14.7888 0.0223
NP_440027.1_3 Forward -270 -252 7.78652 0.205
NP_440027.1_3 Reverse -35 -53 3.26332 0.275
NP_443051.1_1 Forward -144 -135 0.884706 0.125
NP_443051.1_1 Reverse -133 -142 0.29472 0.195
NP_439937.1_9 Reverse -85 -102 -17.1697 0.294
NP_440840.1_10 Reverse -87 -105 12.4089 0.279
NP_439943.1_2 Reverse -16 -35 9.0459 0.286
NP_440372.1_2 Forward -142 -135 6.82395 0.0854
NP_440372.1_2 Reverse -135 -142 6.52896 0.188
NP_440271.1_2 Forward -223 -204 -0.0988766 0.292
NP_440171.1_3 Forward -100 -81 10.4225 0.224
NP_441803.1_2 Reverse -246 -265 -0.0988766 0.267
NP_442790.1_4 Forward -152 -133 -4.03212 0.13
NP_442262.1_10 Forward -142 -135 12.9205 0.0422
NP_440344.1_10 Reverse -127 -144 -6.15601 0.112
NP_440487.1_1 Forward -152 -133 3.53937 0.13
NP_440826.1_5 Forward -19 -1 13.5436 0.276
NP_442187.1_3 Forward -144 -134 17.2863 0.0619
NP_442280.1_10 Forward -36 -18 9.05824 0.242
NP_442553.1_7 Reverse -145 -159 14.6509 0.284
NP_440999.1_9 Forward -268 -254 -1.5737 0.242
NP_440999.1_9 Reverse -130 -144 -1.67204 0.246
NP_440999.1_9 Forward -274 -260 -1.77037 0.249
NP_442147.1_7 Forward -53 -34 11.7008 0.233
NP_442277.1_4 Forward -276 -257 5.99684 0.167
NP_441543.1_2 Reverse -135 -144 7.07956 0.131
NP_441543.1_2 Forward -142 -133 4.52295 0.234
NP_442710.1_7 Forward -378 -359 -0.975606 0.213
NP_442710.1_7 Reverse -351 -370 -3.18613 0.262
NP_442315.1_2 Forward -49 -37 13.412 0.291
NP_443064.1_6 Reverse -35 -45 9.46426 0.219
NP_443064.1_6 Reverse -134 -144 8.59164 0.278
NP_442578.1_7 Forward -142 -135 14.6904 0.026
NP_441462.1_2 Forward -143 -133 8.63316 0.0339
NP_441621.1_7 Forward -99 -85 -5.50694 0.254
NP_441601.1_4 Forward -271 -252 -5.40875 0.293
NP_442204.1_1 Reverse -19 -30 3.10693 0.266
NP_442204.1_1 Forward -156 -145 3.0086 0.266
NP_442204.1_1 Forward -147 -136 0.0586712 0.284
NP_440516.1_2 Reverse -128 -146 4.54237 0.138
NP_440516.1_8 Forward -143 -134 10.5211 0.00816
NP_442428.1_5 Forward -142 -135 6.13563 0.209
NP_442428.1_5 Reverse -135 -142 6.0373 0.212
NP_440673.1_3 Reverse -136 -143 12.4288 0.0426
NP_440673.1_3 Reverse -263 -270 8.59391 0.213
NP_440673.1_7 Reverse -136 -155 2.94938 0.216
NP_441052.1_2 Reverse -134 -144 10.6981 0.0285
NP_442219.1_9 Reverse -135 -144 7.96454 0.0696
NP_440436.1_4 Reverse -135 -144 7.57079 0.124
NP_441336.1_3 Forward -350 -336 15.0442 0.277
NP_440314.1_9 Reverse -135 -154 -1.27885 0.127
NP_441719.1_4 Forward -142 -135 13.5105 0.026
NP_441719.1_4 Reverse -135 -142 6.52896 0.188
NP_441733.1_10 Forward -100 -87 9.65572 0.112
NP_441004.1_5 Forward -101 -87 7.47274 0.292
NP_441437.1_1 Forward -31 -12 20.4523 0.0826
NP_441437.1_2 Forward -221 -202 21.0423 0.0897
NP_441437.1_3 Forward -61 -42 21.828 0.11
NP_440296.1_6 Reverse -364 -382 10.7926 0.295
NP_441851.1_10 Forward -144 -134 4.40493 0.271
NP_442622.1_8 Reverse -134 -152 0.314141 0.0762
NP_441668.1_4 Forward -35 -16 1.37609 0.215
NP_441668.1_5 Forward -97 -78 7.17762 0.277
NP_441349.1_10 Reverse -124 -143 -2.75381 0.125
NP_441409.1_6 Reverse -128 -147 -3.83545 0.0877
NP_442843.1_1 Forward -105 -86 -1.86883 0.202
NP_442450.1_5 Reverse -61 -71 8.53483 0.13
NP_442006.1_2 Forward -152 -135 -7.04099 0.169
NP_442006.1_2 Forward -158 -141 -14.6125 0.205
NP_440078.1_10 Forward -95 -76 4.03102 0.254
NP_441078.1_4 Forward -143 -134 0.196389 0.205
NP_441078.1_4 Reverse -134 -143 -0.000272808 0.205
NP_441078.1_4 Reverse -35 -44 -1.86856 0.272
NP_442348.1_2 Reverse -154 -163 14.7494 0.146
NP_442348.1_2 Forward -44 -35 13.2744 0.198
NP_440526.1_3 Reverse -89 -100 1.92649 0.267
NP_441432.1_8 Forward -144 -135 7.27622 0.101
NP_442815.1_2 Forward -99 -81 4.9357 0.237
NP_440713.1_3 Reverse -18 -37 2.26107 0.28
NP_442489.1_7 Reverse -134 -143 7.47288 0.0613
NP_442489.1_7 Forward -143 -134 0.688044 0.152
NP_442489.1_7 Forward -44 -35 -1.96689 0.28
NP_440559.1_1 Reverse -135 -144 7.76787 0.0918
NP_441659.2_8 Forward -143 -133 1.84832 0.224
NP_441659.2_8 Forward -270 -260 0.176696 0.271
NP_440708.1_6 Forward -35 -16 -1.67217 0.201
NP_440779.1_5 Reverse -282 -299 -14.8091 0.274
NP_442346.1_5 Reverse -257 -267 5.38824 0.248
NP_442346.1_10 Reverse -86 -105 3.14605 0.194
NP_441653.1_3 Forward -30 -16 13.0776 0.279
NP_440010.1_10 Forward -155 -136 2.0644 0.29
NP_441833.1_4 Reverse -135 -142 6.52896 0.0924
NP_441833.1_4 Forward -142 -135 6.23397 0.163
NP_442699.1_8 Forward -27 -8 -4.13045 0.238
NP_442162.1_9 Forward -142 -135 6.62729 0.142
NP_442162.1_9 Reverse -135 -142 6.52896 0.178
NP_442140.1_3 Reverse -246 -256 6.46988 0.168
NP_441671.1_10 Forward -154 -135 -0.39387 0.293
NP_440875.1_9 Reverse -380 -390 7.00932 0.287
NP_441813.1_5 Reverse -132 -142 8.53483 0.0394
NP_441813.1_5 Forward -145 -135 8.4365 0.0432
NP_440590.1_4 Reverse -135 -148 -5.19226 0.277
NP_442497.1_10 Reverse -135 -144 0.589713 0.153
NP_442497.1_10 Forward -142 -133 -1.18024 0.256
NP_440821.1_4 Forward -145 -135 -0.314959 0.251
NP_440927.1_10 Reverse -309 -327 20.9628 0.156
NP_441239.1_9 Reverse -132 -144 3.38223 0.285
NP_441892.1_1 Forward -152 -135 -5.36936 0.279
NP_442082.1_4 Reverse -314 -333 9.73422 0.165
NP_441017.1_8 Forward -47 -32 11.6813 0.188
NP_442216.1_4 Reverse -226 -234 8.1805 0.255
NP_442138.1_1 Forward -269 -250 1.6703 0.26
NP_442138.1_10 Reverse -134 -153 1.86774 0.12
NP_440391.1_5 Reverse -85 -104 14.6508 0.149
NP_440546.1_2 Forward -88 -69 14.7491 0.219
NP_440546.1_4 Reverse -245 -255 7.42815 0.241
NP_440546.1_4 Forward -143 -133 6.65249 0.288
NP_440462.1_6 Reverse -132 -142 8.1415 0.0699
NP_440462.1_6 Forward -145 -135 6.37155 0.118
NP_440868.1_4 Reverse -130 -142 9.77374 0.043
NP_440868.1_4 Forward -147 -135 7.80712 0.0637
NP_442479.1_9 Reverse -59 -78 -8.55534 0.266
NP_441848.1_7 Forward -67 -48 -3.54122 0.284
NP_441084.1_6 Reverse -26 -40 9.15021 0.292
NP_440506.1_10 Forward -153 -134 20.059 0.143
NP_442837.1_3 Reverse -135 -142 12.1338 0.0702
NP_442837.1_3 Forward -142 -135 6.0373 0.25
NP_440160.1_9 Reverse -55 -74 8.16093 0.27
NP_442053.1_1 Reverse -134 -143 14.1594 0.0136
NP_442053.1_1 Forward -143 -134 7.86621 0.0863
NP_440505.1_3 Forward -145 -135 9.51814 0.122
NP_442532.1_1 Forward -381 -367 8.94748 0.292
NP_440914.1_1 Reverse -35 -45 13.4947 0.0297
NP_441011.1_8 Forward -142 -133 5.40793 0.263
NP_439944.1_8 Forward -153 -134 12.7825 0.238
NP_441697.1_5 Reverse -350 -369 -11.7937 0.299
NP_441028.1_6 Reverse -13 -23 5.78111 0.243
NP_440115.1_6 Forward -146 -136 15.0247 0.0505
NP_441680.1_4 Reverse -281 -300 -2.95047 0.276
NP_441602.1_4 Forward -160 -141 9.63589 0.278
NP_441286.1_1 Forward -45 -33 1.80894 0.0791
NP_441286.1_1 Forward -144 -132 -4.48425 0.161
NP_440886.1_7 Reverse -87 -97 4.7978 0.218
NP_442072.1_9 Forward -98 -80 -22.9903 0.271
NP_440907.2_8 Reverse -89 -99 12.2709 0.0694
NP_441021.1_1 Forward -43 -24 -5.50708 0.177
NP_441626.1_2 Forward -142 -135 6.13563 0.177
NP_441626.1_2 Reverse -135 -142 5.93897 0.231
NP_441626.1_6 Forward -207 -189 11.9164 0.177
NP_442365.1_7 Reverse -130 -149 -6.29373 0.289
NP_442020.1_1 Forward -173 -154 0.883656 0.255
NP_442084.1_6 Reverse -14 -32 8.37728 0.221
NP_440114.1_10 Forward -143 -129 5.80112 0.292
NP_440737.1_1 Forward -298 -279 5.50599 0.251
NP_440457.1_1 Forward -147 -135 0.923956 0.25
NP_440801.1_8 Reverse -34 -53 1.86774 0.236
NP_442297.1_4 Forward -147 -128 13.4051 0.245
NP_442582.1_8 Reverse -152 -170 5.62401 0.28
NP_440554.1_4 Forward -142 -132 1.65166 0.293
NP_441885.1_5 Reverse -134 -144 1.25834 0.11
NP_441885.1_5 Reverse -35 -45 -0.216628 0.189
NP_440478.1_10 Reverse -132 -146 6.3911 0.291
NP_441428.1_8 Reverse -262 -281 18.879 0.0282
NP_440423.1_6 Forward -151 -132 -1.7705 0.126
NP_443000.1_7 Forward -145 -135 10.2065 0.0355
NP_443000.1_7 Reverse -132 -142 1.455 0.247
NP_440275.1_3 Forward -145 -135 5.5849 0.14
NP_440175.1_7 Forward -36 -18 12.4861 0.217
NP_440216.1_1 Reverse -134 -148 -11.1118 0.163
NP_440216.1_1 Forward -143 -129 -11.4068 0.184
NP_440216.1_9 Reverse -19 -28 13.8644 0.184
NP_440216.1_9 Forward -303 -294 5.40793 0.294
NP_440172.1_1 Forward -143 -133 8.82982 0.0586
NP_442015.1_10 Reverse -292 -305 4.14919 0.178
NP_441111.1_7 Reverse -135 -143 8.86921 0.0589
NP_441766.1_2 Reverse -134 -143 8.55452 0.054
NP_440072.1_5 Forward -106 -88 -2.0458 0.269
NP_440591.1_9 Forward -150 -132 7.68896 0.196
NP_442154.1_1 Forward -360 -342 -17.7788 0.267
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGCTGATTTGGCGGCCATTAAATAATTAAATAAACGATTGTAATTTTTTTGCTGGCGGGTATGACTTTCCATTTTTAAATGCCAAGTTTGAGTAGATCATTGCAAAGGGGCGTTGTAGGATGGAATGTCAGCAACCGTCACCTGCCGCCATAGGTACTTTACCTCGGGGACTTACATTCAGACAGGGTATTGCGGGGTAAGTCTCCAAACATCGTGGGTTGTTAACCTACTCCATAAAAAATACCCAGGCGAAGCTGGCGATCGAGTGTAAAAGACTCAACTCAACGCAGACCTGCAATAGGGGGGATACCGGCAAGATTTTCAGTCTTGGCTCAACCTTTGTTCCGTCGTAGTTGGGGATTGTCCTTACCTTTGCCTGGGGCTAAAACGATCATTTCC

CDS

ATGGCACGACAAGCTCGCTATCAAAACCTTTTAGGGCTCAATCCGAGAACTGAATCCCGCAGTCTAATTTGGTGTCGTCGTTTCTCCGTTCGTCCTAATTGCCTTGGGCTTTTGTATAGAAAAAATTGCTTTGAAAAAACTTTAGAACCGGGTATTTACTCCTTTTGGGATTTTCGCTCAGAATTGGAACTTTTCCTGATTCCCCGTTCTGACCAGTTCTTTATTGTTACAAATCAAGAAGTATTAACCAAAGATAATATTCCTCTACGTTTTTCTTACATTGTCAATTATAGAATTACAGACGGTCAGAAATTGTTGACCTATATTGATCCTGCCCAAATGGGATACATCGAAGGGCTAGCAAGTATGATTCAAACTCTGATTCATCCTCTAACCCAAATTTATTGGCGTAGTGCTATTAGTGTAATTAACAGCCTTGAGCTTAATGAGCAATGGGAAGCTTTCATCCCCAATATTCCGGATGAATTGCAAGAATCAGCCCAAAAATTTGGGGTTATGATTGAAGCAATGAAATTAAGGGATATTACTTTTCCCAAAAATATCCAAACTCTTTTTGCTCTTCAGTTAGAAGCCAAAATTAGAGGTCAAACGGATTTGGAAAATGCCCGCACAGCAGTTGCCACCGCTAGGGCGTTAAAAAATGCTTCCCAATTAATAGGAGATGATCAAAATATTAAGTTCCTGCAGTATCTAGAAACCTTAATTAAAATCGCATCTTCTGGGAAGCATACCTTTGTTGTTGGTGGCTCAGAAAAAATAACATCGGATAGTTGA

Protein

MARQARYQNLLGLNPRTESRSLIWCRRFSVRPNCLGLLYRKNCFEKTLEPGIYSFWDFRSELELFLIPRSDQFFIVTNQEVLTKDNIPLRFSYIVNYRITDGQKLLTYIDPAQMGYIEGLASMIQTLIHPLTQIYWRSAISVINSLELNEQWEAFIPNIPDELQESAQKFGVMIEAMKLRDITFPKNIQTLFALQLEAKIRGQTDLENARTAVATARALKNASQLIGDDQNIKFLQYLETLIKIASSGKHTFVVGGSEKITSDS