Your browser is old and dusty. Try Google Chrome!

Details for sll0810

ORF sll0810
Accession NP_441447.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -386 -400 4.62115 0.146
NP_440557.1_1 Forward -387 -368 -0.983855 0.27
NP_440795.1_7 Forward -393 -386 14.6904 0.0123
NP_440795.1_7 Reverse -386 -393 14.6904 0.0123
NP_442291.1_5 Forward -395 -379 16.9715 0.0187
NP_442291.1_5 Reverse -384 -400 -1.90808 0.204
NP_442291.1_5 Forward -323 -307 -1.90808 0.204
NP_441453.1_1 Reverse -129 -147 5.03327 0.256
NP_441453.1_4 Reverse -385 -393 16.539 0.00633
NP_441453.1_4 Forward -394 -386 16.539 0.00633
NP_442151.1_6 Forward -394 -380 16.9125 0.013
NP_442151.1_6 Reverse -385 -399 6.6861 0.224
NP_442838.1_3 Forward -227 -209 17.7187 0.195
NP_441818.1_1 Forward -393 -382 18.8393 0.00301
NP_441818.1_1 Reverse -386 -397 10.1862 0.232
NP_440226.1_1 Forward -394 -375 10.6192 0.061
NP_440259.1_4 Reverse -196 -210 10.3712 0.264
NP_440259.1_4 Reverse -187 -201 9.50354 0.278
NP_440150.1_6 Reverse -3 -22 2.45773 0.27
NP_440996.1_4 Forward -183 -173 17.5813 0.15
NP_443002.1_2 Reverse -369 -388 8.94757 0.279
NP_442173.1_1 Forward -393 -385 15.4574 0.00633
NP_442173.1_1 Reverse -386 -394 15.4574 0.00633
NP_442173.1_1 Reverse -355 -363 4.73931 0.258
NP_442752.1_4 Forward -394 -387 13.8055 0.0199
NP_442752.1_4 Reverse -385 -392 13.8055 0.0199
NP_443027.1_4 Forward -396 -386 14.0414 0.0452
NP_443027.1_4 Reverse -383 -393 14.0414 0.0452
NP_443027.1_4 Reverse -311 -321 9.12481 0.177
NP_441812.1_3 Forward -395 -381 11.5043 0.21
NP_442975.1_10 Reverse -381 -395 13.1753 0.0459
NP_440784.1_7 Forward -393 -386 15.9687 0.0123
NP_440784.1_7 Reverse -386 -393 15.9687 0.0123
NP_441967.1_6 Reverse -186 -205 18.584 0.124
NP_441250.1_3 Forward -157 -138 1.27776 0.294
NP_440061.1_9 Reverse -383 -397 10.3237 0.126
NP_440110.1_7 Forward -179 -160 10.3242 0.289
NP_442062.1_8 Forward -394 -384 17.3846 0.00193
NP_442062.1_8 Reverse -385 -395 17.3846 0.00193
NP_440304.1_4 Forward -396 -386 10.8948 0.051
NP_440304.1_4 Reverse -383 -393 10.8948 0.051
NP_442242.1_4 Forward -393 -386 14.3954 0.0124
NP_442242.1_4 Reverse -386 -393 14.3954 0.0124
NP_440044.1_8 Forward -393 -374 5.40766 0.103
NP_440044.1_8 Forward -251 -232 -0.688862 0.225
NP_440049.1_2 Reverse -277 -296 5.70265 0.152
NP_441208.1_9 Reverse -265 -279 6.3911 0.246
NP_441208.1_9 Reverse -117 -131 4.62115 0.297
NP_442110.1_1 Forward -117 -98 24.0067 0.00358
NP_442110.1_7 Reverse -385 -399 9.5377 0.0724
NP_442110.1_7 Forward -394 -380 9.14437 0.0755
NP_441925.1_4 Forward -284 -265 -15.3409 0.263
NP_440014.1_3 Forward -284 -270 16.3538 0.261
NP_441083.1_5 Forward -394 -384 20.3345 0.00053
NP_441083.1_5 Reverse -385 -395 20.3345 0.00053
NP_442827.1_8 Reverse -377 -396 -1.27961 0.245
NP_441738.1_2 Forward -392 -385 15.28 0.0102
NP_441738.1_2 Reverse -387 -394 15.28 0.0102
NP_441738.1_2 Forward -262 -255 6.52862 0.261
NP_441558.1_5 Forward -396 -377 12.5858 0.0675
NP_440209.1_1 Reverse -385 -393 18.1123 0.00295
NP_440209.1_1 Forward -394 -386 18.1123 0.00295
NP_440209.1_1 Forward -9 -1 2.1827 0.254
NP_440209.1_2 Reverse -215 -231 9.98996 0.298
NP_442889.1_8 Reverse -382 -396 11.5037 0.0733
NP_442889.1_10 Forward -207 -188 21.9424 0.0478
NP_441713.1_1 Forward -253 -234 -7.27704 0.13
NP_441713.1_1 Forward -400 -381 -8.16202 0.145
NP_440178.1_7 Forward -395 -376 12.9791 0.00536
NP_441716.1_1 Reverse -385 -399 13.2743 0.0689
NP_441716.1_1 Forward -221 -207 5.99778 0.208
NP_441716.1_1 Forward -394 -380 4.22782 0.256
NP_441327.1_5 Forward -211 -202 15.0444 0.191
NP_441598.1_1 Forward -243 -224 7.86593 0.295
NP_442111.1_4 Reverse -384 -398 10.3243 0.0545
NP_441495.1_1 Reverse -377 -396 14.3558 0.193
NP_440906.1_5 Forward -393 -386 15.8704 0.0124
NP_440906.1_5 Reverse -386 -393 15.8704 0.0124
NP_440747.1_10 Forward -397 -385 17.2469 0.000522
NP_440747.1_10 Reverse -382 -394 7.51213 0.00286
NP_441130.1_10 Forward -396 -382 7.76774 0.149
NP_441486.1_1 Reverse -382 -396 20.9441 0.00262
NP_441486.1_1 Forward -397 -383 12.1926 0.0129
NP_442634.1_4 Reverse -383 -397 -1.5737 0.149
NP_440057.1_8 Reverse -167 -186 15.2408 0.232
NP_441014.1_10 Forward -395 -376 9.53674 0.123
NP_442848.1_1 Reverse -379 -393 7.17775 0.0791
NP_442848.1_1 Forward -400 -386 5.50613 0.0828
NP_443018.1_3 Forward -393 -386 14.8871 0.0123
NP_443018.1_3 Reverse -386 -393 14.8871 0.0123
NP_443018.1_3 Reverse -1 -8 11.3472 0.0846
NP_443018.1_3 Forward -8 -1 4.16902 0.278
NP_441634.1_8 Forward -396 -382 2.16287 0.17
NP_440376.1_1 Forward -394 -385 19.4693 0.000692
NP_440376.1_1 Reverse -385 -394 19.4693 0.000692
NP_440376.1_1 Reverse -231 -240 2.26134 0.228
NP_441588.1_4 Forward -392 -382 8.63316 0.14
NP_442687.1_7 Forward -395 -385 8.92815 0.0994
NP_442687.1_7 Reverse -384 -394 8.92815 0.0994
NP_442485.1_3 Reverse -321 -340 -3.04881 0.272
NP_441013.1_2 Forward -232 -214 2.37909 0.241
NP_440533.1_6 Forward -352 -333 12.0942 0.238
NP_440667.1_2 Forward -102 -83 -6.88371 0.273
NP_442658.1_1 Reverse -383 -393 6.76441 0.214
NP_442658.1_1 Forward -396 -386 6.76441 0.214
NP_440617.1_3 Reverse -204 -223 3.53937 0.261
NP_442782.1_2 Reverse -385 -399 4.91614 0.25
NP_441414.1_9 Forward -394 -375 8.35759 0.0286
NP_440184.1_7 Forward -303 -284 13.6054 0.28
NP_443061.1_4 Forward -327 -308 3.6377 0.205
NP_441958.1_5 Forward -395 -385 12.2714 0.00183
NP_441958.1_5 Reverse -384 -394 12.2714 0.00183
NP_441127.1_1 Forward -335 -321 12.7826 0.206
NP_442836.1_5 Reverse -379 -398 1.67108 0.276
NP_440203.1_5 Reverse -388 -398 12.0743 0.166
NP_439905.1_2 Reverse -207 -221 8.35772 0.265
NP_439905.1_5 Forward -198 -184 18.1908 0.185
NP_440984.1_7 Reverse -380 -394 7.57108 0.166
NP_442690.1_1 Forward -153 -134 -14.0619 0.268
NP_442911.1_2 Reverse -375 -394 -3.44213 0.112
NP_440153.1_5 Forward -393 -379 8.75105 0.132
NP_440858.1_1 Forward -357 -338 0.884433 0.212
NP_440602.1_8 Forward -394 -380 17.5025 0.0898
NP_440138.1_6 Reverse -380 -399 6.78348 0.219
NP_441913.1_1 Forward -352 -336 13.4326 0.256
NP_441099.1_5 Forward -257 -238 -8.06369 0.187
NP_441294.1_7 Reverse -381 -395 14.914 0.033
NP_442438.1_10 Forward -399 -385 20.9441 0.0119
NP_442438.1_10 Reverse -380 -394 7.86607 0.0859
NP_442431.1_9 Reverse -159 -178 14.3558 0.164
NP_441000.1_6 Reverse -312 -326 1.67122 0.163
NP_441000.1_6 Forward -395 -381 -4.7203 0.251
NP_440147.1_4 Forward -396 -383 2.08423 0.21
NP_440147.1_4 Reverse -383 -396 2.08423 0.21
NP_441175.1_7 Reverse -9 -28 13.2741 0.113
NP_441550.1_8 Reverse -383 -393 12.3692 0.0336
NP_441550.1_8 Forward -396 -386 12.3692 0.0336
NP_441550.1_8 Reverse -44 -54 5.48612 0.247
NP_441916.1_7 Forward -394 -384 10.3048 0.0261
NP_441916.1_7 Reverse -385 -395 10.3048 0.0261
NP_441916.1_10 Reverse -377 -396 2.3594 0.249
NP_441041.1_4 Forward -394 -375 5.60432 0.0496
NP_442396.1_5 Forward -398 -385 8.08242 0.164
NP_442004.1_6 Reverse -385 -399 17.8958 0.0534
NP_441725.1_5 Forward -393 -383 11.2881 0.0247
NP_441725.1_5 Reverse -386 -396 11.2881 0.0247
NP_439966.1_7 Reverse -383 -393 15.8108 0.0124
NP_439966.1_7 Forward -396 -386 15.8108 0.0124
NP_439966.1_7 Forward -11 -1 4.50281 0.269
NP_439966.1_7 Forward -266 -256 4.10949 0.289
NP_440736.1_3 Forward -343 -324 -1.67217 0.294
NP_442941.1_3 Forward -393 -383 19.9412 0.00262
NP_442941.1_3 Reverse -386 -396 19.9412 0.00262
NP_440289.1_2 Reverse -382 -395 13.294 0.0132
NP_440289.1_2 Forward -397 -384 3.75586 0.0741
NP_442281.1_1 Reverse -380 -394 17.2068 0.00633
NP_442281.1_1 Forward -399 -385 7.66879 0.0949
NP_442575.1_8 Forward -227 -208 -4.72043 0.264
NP_442256.1_2 Forward -396 -378 -8.83064 0.236
NP_440437.1_1 Forward -400 -381 -4.22878 0.254
NP_442500.1_8 Reverse -366 -380 12.2993 0.243
NP_442012.1_1 Forward -252 -233 5.11266 0.154
NP_442012.1_5 Reverse -255 -274 -0.000545616 0.288
NP_441556.1_10 Reverse -232 -246 14.5046 0.167
NP_440498.1_1 Reverse -376 -394 0.609134 0.214
NP_441644.1_6 Forward -394 -384 17.3841 0.00127
NP_441644.1_6 Reverse -385 -395 17.3841 0.00127
NP_441644.1_6 Forward -221 -211 5.87944 0.174
NP_442215.1_2 Forward -396 -380 5.6634 0.0775
NP_442215.1_2 Reverse -383 -399 1.33684 0.136
NP_442215.1_2 Forward -350 -334 -4.07137 0.227
NP_440253.1_2 Forward -394 -376 2.87075 0.128
NP_440929.1_8 Forward -394 -385 19.2726 0.000701
NP_440929.1_8 Reverse -385 -394 19.2726 0.000701
NP_440780.1_1 Reverse -164 -183 9.31004 0.274
NP_442933.1_1 Reverse -188 -207 8.16414 0.253
NP_442933.1_2 Forward -204 -186 8.88274 0.257
NP_442933.1_10 Forward -394 -385 17.601 0.00325
NP_442933.1_10 Reverse -385 -394 17.601 0.00325
NP_441095.1_2 Forward -202 -192 17.4358 0.282
NP_441751.2_8 Reverse -386 -400 16.0275 0.0103
NP_441751.2_8 Forward -393 -379 -3.24533 0.137
NP_442926.1_5 Forward -399 -380 14.3475 0.15
NP_442554.1_8 Forward -393 -383 15.9097 0.00747
NP_442554.1_8 Reverse -386 -396 15.9097 0.00747
NP_442554.1_8 Reverse -213 -223 2.33998 0.274
NP_441762.1_7 Forward -395 -383 -6.84419 0.284
NP_441762.1_7 Reverse -384 -396 -6.84419 0.284
NP_442142.1_4 Forward -397 -384 15.4566 0.0264
NP_442142.1_4 Reverse -382 -395 14.1783 0.0311
NP_442142.1_4 Reverse -209 -222 7.00021 0.151
NP_442292.1_1 Forward -393 -384 18.486 0.00229
NP_442292.1_1 Reverse -386 -395 18.486 0.00229
NP_440919.1_1 Reverse -311 -330 -3.24547 0.221
NP_442476.1_6 Reverse -386 -400 8.94771 0.0978
NP_441711.1_4 Reverse -376 -395 5.01433 0.185
NP_443009.1_5 Reverse -384 -395 8.90795 0.0965
NP_443009.1_5 Forward -395 -384 8.90795 0.0965
NP_441715.1_4 Forward -393 -383 14.828 0.0268
NP_441715.1_4 Reverse -386 -396 14.828 0.0268
NP_440183.1_9 Forward -339 -320 4.22769 0.11
NP_441468.1_1 Forward -393 -386 15.8704 0.0124
NP_441468.1_1 Reverse -386 -393 15.8704 0.0124
NP_441468.1_1 Forward -8 -1 3.97235 0.277
NP_441015.1_10 Forward -226 -207 -8.16202 0.272
NP_441015.1_10 Forward -113 -94 -10.1286 0.283
NP_441673.1_1 Forward -394 -385 20.8459 0.000698
NP_441673.1_1 Reverse -385 -394 20.8459 0.000698
NP_441826.1_2 Reverse -379 -393 13.8643 0.0213
NP_441826.1_2 Forward -400 -386 4.42448 0.103
NP_441826.1_2 Forward -15 -1 -2.45868 0.271
NP_442868.1_6 Forward -396 -386 9.91146 0.038
NP_442868.1_6 Reverse -383 -393 9.91146 0.038
NP_442868.1_6 Forward -248 -238 2.14332 0.205
NP_442719.1_2 Forward -332 -314 2.08335 0.162
NP_442719.1_2 Forward -303 -285 -11.2896 0.291
NP_441251.1_8 Reverse -287 -300 13.3352 0.254
NP_441612.1_2 Reverse -385 -395 8.54929 0.21
NP_441612.1_2 Forward -394 -384 8.54929 0.21
NP_442427.1_8 Reverse -376 -395 13.5691 0.141
NP_442808.1_1 Reverse -384 -394 8.63269 0.0481
NP_442808.1_1 Forward -395 -385 8.63269 0.0481
NP_442808.1_1 Forward -241 -231 8.53436 0.0493
NP_441849.1_2 Forward -384 -365 5.96782 0.245
NP_442050.1_5 Reverse -383 -393 16.4991 0.00812
NP_442050.1_5 Forward -396 -386 16.4991 0.00812
NP_442903.1_2 Forward -205 -186 5.58586 0.196
NP_441114.1_3 Reverse -214 -223 7.66954 0.231
NP_440558.1_2 Reverse -209 -228 -7.17871 0.289
NP_442789.1_4 Reverse -238 -257 2.0644 0.184
NP_441518.1_3 Reverse -375 -394 -14.7502 0.28
NP_441878.1_6 Forward -395 -385 10.4031 0.0176
NP_441878.1_6 Reverse -384 -394 10.4031 0.0176
NP_441878.1_6 Forward -222 -212 0.668351 0.139
NP_441036.1_8 Forward -395 -385 8.33817 0.174
NP_441036.1_8 Reverse -384 -394 8.33817 0.174
NP_442650.1_2 Reverse -385 -399 6.58777 0.13
NP_441557.1_5 Forward -394 -385 19.9609 0.000699
NP_441557.1_5 Reverse -385 -394 19.9609 0.000699
NP_441445.1_1 Reverse -376 -395 3.6377 0.21
NP_441445.1_1 Reverse -258 -277 -0.0988766 0.286
NP_442469.1_8 Reverse -218 -232 12.3893 0.291
NP_442183.1_1 Forward -394 -380 7.37441 0.143
NP_442183.1_1 Reverse -385 -399 6.48943 0.171
NP_441819.1_5 Reverse -131 -150 8.92807 0.287
NP_441549.1_9 Reverse -381 -399 4.44404 0.0925
NP_442347.1_2 Forward -393 -384 12.4878 0.056
NP_442347.1_2 Reverse -386 -395 12.4878 0.056
NP_442347.1_2 Forward -321 -312 5.70292 0.226
NP_442645.1_2 Reverse -377 -396 -14.4552 0.175
NP_441633.1_3 Forward -396 -383 -6.07724 0.236
NP_441633.1_3 Reverse -383 -396 -6.07724 0.236
NP_442764.1_8 Forward -232 -213 3.93269 0.262
NP_440136.1_2 Forward -393 -386 15.9687 0.0123
NP_440136.1_2 Reverse -386 -393 15.9687 0.0123
NP_442998.1_10 Forward -392 -385 15.5754 0.0102
NP_442998.1_10 Reverse -387 -394 15.5754 0.0102
NP_442998.1_10 Forward -238 -231 4.07068 0.276
NP_440299.1_1 Forward -398 -385 18.6032 0.00369
NP_440299.1_1 Reverse -381 -394 4.44361 0.207
NP_441799.1_1 Forward -398 -384 13.1753 0.0348
NP_441799.1_1 Reverse -381 -395 10.0287 0.0797
NP_441007.1_10 Forward -399 -386 1.49425 0.203
NP_441007.1_10 Reverse -380 -393 0.805932 0.216
NP_442334.1_2 Reverse -306 -323 -6.84433 0.267
NP_440256.1_1 Forward -397 -378 8.16093 0.0239
NP_441090.1_6 Forward -221 -207 10.0294 0.239
NP_441447.1_1 Forward -131 -113 21.652 0.0129
NP_441447.1_2 Forward -385 -367 20.8653 0.0712
NP_441447.1_3 Forward -303 -284 24.2863 0.0301
NP_440915.1_6 Forward -398 -384 1.08123 0.147
NP_442069.1_7 Forward -289 -270 9.7334 0.291
NP_442866.1_4 Forward -387 -368 6.09597 0.231
NP_442993.1_1 Forward -394 -378 -7.70961 0.146
NP_442993.1_1 Reverse -332 -348 -9.97122 0.201
NP_442386.1_9 Reverse -384 -393 13.8639 0.0289
NP_442386.1_9 Forward -395 -386 13.8639 0.0289
NP_442386.1_9 Reverse -390 -399 9.5374 0.159
NP_442386.1_10 Reverse -231 -244 3.5592 0.273
NP_440570.1_5 Forward -358 -339 -4.03212 0.299
NP_441750.1_1 Reverse -291 -310 -13.3736 0.3
NP_441750.1_4 Forward -398 -379 4.52268 0.21
NP_441340.1_5 Forward -393 -386 15.6737 0.0124
NP_441340.1_5 Reverse -386 -393 15.6737 0.0124
NP_441340.1_5 Reverse -1 -8 4.07068 0.239
NP_441340.1_9 Forward -97 -87 8.93007 0.256
NP_441340.1_9 Forward -211 -201 8.25522 0.256
NP_441271.1_1 Forward -400 -382 11.1298 0.247
NP_442326.1_6 Forward -381 -364 21.0817 0.11
NP_440586.1_8 Forward -393 -386 13.2151 0.026
NP_440586.1_8 Reverse -386 -393 13.2151 0.026
NP_440586.1_8 Reverse -1 -8 12.8218 0.0395
NP_440586.1_8 Forward -220 -213 5.8403 0.283
NP_440586.1_8 Reverse -333 -340 5.8403 0.283
NP_442251.1_6 Forward -393 -386 15.2804 0.0124
NP_442251.1_6 Reverse -386 -393 15.2804 0.0124
NP_441262.1_3 Reverse -385 -392 14.7888 0.0223
NP_441262.1_3 Forward -394 -387 14.7888 0.0223
NP_443051.1_1 Reverse -384 -393 10.4228 0.00754
NP_443051.1_1 Forward -395 -386 10.4228 0.00754
NP_443051.1_5 Forward -208 -189 6.29264 0.256
NP_439937.1_9 Reverse -163 -180 -11.1715 0.245
NP_443039.1_7 Forward -264 -250 4.91554 0.248
NP_440408.1_3 Reverse -379 -398 -1.37718 0.238
NP_440439.1_1 Forward -397 -384 0.117615 0.202
NP_440372.1_2 Forward -393 -386 16.3621 0.0124
NP_440372.1_2 Reverse -386 -393 16.3621 0.0124
NP_441181.1_2 Forward -232 -213 24.1889 0.00673
NP_440316.1_10 Forward -222 -212 8.92815 0.236
NP_441803.1_2 Forward -399 -380 -0.197208 0.269
NP_439977.1_5 Forward -400 -381 2.45773 0.173
NP_440139.1_1 Reverse -379 -398 1.96529 0.242
NP_441572.1_7 Reverse -379 -398 -4.22878 0.229
NP_440267.1_2 Reverse -380 -394 8.45543 0.162
NP_442384.1_10 Reverse -385 -398 16.4406 0.00838
NP_442384.1_10 Forward -394 -381 1.10092 0.268
NP_442114.1_8 Forward -208 -194 9.73373 0.234
NP_441877.1_5 Reverse -323 -342 8.75091 0.151
NP_441877.1_9 Forward -97 -80 7.41366 0.271
NP_442262.1_10 Forward -393 -386 14.1988 0.0123
NP_442262.1_10 Reverse -386 -393 14.1988 0.0123
NP_442262.1_10 Reverse -1 -8 10.3639 0.153
NP_441689.1_5 Forward -396 -386 15.3192 0.0403
NP_441689.1_5 Reverse -383 -393 15.3192 0.0403
NP_441814.1_1 Forward -261 -242 3.14605 0.287
NP_440163.1_10 Forward -397 -387 12.4681 0.159
NP_440163.1_10 Reverse -382 -392 11.3864 0.169
NP_440531.1_6 Reverse -292 -311 -5.31042 0.296
NP_441965.1_10 Reverse -382 -398 7.53169 0.146
NP_442750.1_1 Forward -125 -106 7.37347 0.261
NP_440297.1_9 Forward -393 -383 9.32148 0.0917
NP_440297.1_9 Reverse -386 -396 9.32148 0.0917
NP_440297.1_9 Reverse -213 -223 -0.118297 0.282
NP_440350.1_5 Reverse -194 -213 0.196116 0.166
NP_440350.1_5 Forward -181 -162 -1.18052 0.199
NP_440350.1_5 Reverse -191 -210 -3.54046 0.261
NP_442280.1_5 Forward -301 -282 14.0355 0.276
NP_441592.1_4 Forward -246 -227 -1.96717 0.26
NP_441896.1_3 Forward -273 -254 -2.0655 0.275
NP_440937.1_5 Forward -69 -50 8.65258 0.278
NP_440888.1_2 Forward -394 -380 18.0918 0.00261
NP_440888.1_2 Reverse -385 -399 15.9285 0.00837
NP_440179.1_6 Forward -24 -5 4.22769 0.246
NP_441748.1_3 Forward -169 -150 18.1213 0.142
NP_441543.1_2 Forward -393 -384 16.9127 0.00359
NP_441543.1_2 Reverse -386 -395 16.9127 0.00359
NP_442845.1_2 Forward -400 -386 17.1092 0.0608
NP_442845.1_2 Reverse -385 -399 13.8643 0.0893
NP_442845.1_2 Reverse -379 -393 5.1128 0.243
NP_441551.1_4 Forward -250 -231 12.5858 0.276
NP_441551.1_5 Forward -398 -382 6.2527 0.275
NP_442710.1_7 Forward -198 -179 -5.39666 0.29
NP_442710.1_7 Forward -199 -180 -6.54997 0.294
NP_441469.1_8 Forward -395 -386 6.48957 0.227
NP_441469.1_8 Reverse -384 -393 6.48957 0.227
NP_443064.1_6 Forward -394 -384 12.5669 0.0796
NP_443064.1_6 Reverse -385 -395 12.5669 0.0796
NP_442578.1_5 Reverse -98 -117 2.45773 0.257
NP_442578.1_7 Forward -393 -386 14.5921 0.026
NP_442578.1_7 Reverse -386 -393 14.5921 0.026
NP_441462.1_2 Forward -394 -384 11.5831 0.00406
NP_441462.1_2 Reverse -385 -395 11.5831 0.00406
NP_441462.1_5 Reverse -303 -322 5.70265 0.25
NP_443062.1_1 Forward -394 -376 14.6889 0.0444
NP_443062.1_1 Forward -341 -323 3.67056 0.289
NP_440911.1_5 Forward -194 -175 18.289 0.154
NP_442204.1_1 Forward -398 -387 -0.0396598 0.285
NP_442204.1_1 Forward -219 -208 -0.432984 0.299
NP_442872.1_1 Reverse -91 -110 -7.27704 0.241
NP_440516.1_8 Forward -394 -385 16.9127 0.00442
NP_440516.1_8 Reverse -385 -394 16.9127 0.00442
NP_440516.1_8 Reverse -231 -240 -0.295266 0.232
NP_442428.1_4 Forward -395 -376 3.73603 0.24
NP_442428.1_5 Forward -393 -386 15.8704 0.0124
NP_442428.1_5 Reverse -386 -393 15.8704 0.0124
NP_442428.1_5 Forward -8 -1 4.36568 0.271
NP_441353.1_7 Reverse -381 -399 15.948 0.25
NP_440603.1_9 Reverse -339 -358 1.17943 0.278
NP_440673.1_3 Forward -392 -385 12.4288 0.0426
NP_440673.1_3 Reverse -387 -394 12.4288 0.0426
NP_441052.1_2 Forward -394 -384 19.9412 0.00106
NP_441052.1_2 Reverse -385 -395 19.9412 0.00106
NP_442219.1_8 Reverse -313 -332 14.5449 0.136
NP_442219.1_8 Forward -336 -317 10.3897 0.205
NP_442219.1_9 Forward -393 -384 17.7976 0.00718
NP_442219.1_9 Reverse -386 -395 17.7976 0.00718
NP_440436.1_4 Forward -393 -384 17.2072 0.00233
NP_440436.1_4 Reverse -386 -395 17.2072 0.00233
NP_441719.1_4 Forward -393 -386 16.3621 0.0124
NP_441719.1_4 Reverse -386 -393 16.3621 0.0124
NP_441719.1_7 Reverse -174 -193 16.3224 0.295
NP_441004.1_5 Reverse -227 -241 6.58777 0.298
NP_442366.1_3 Reverse -331 -349 3.85406 0.104
NP_443054.1_2 Forward -396 -382 3.04785 0.24
NP_441851.1_10 Forward -395 -385 15.8113 0.00552
NP_441851.1_10 Reverse -384 -394 15.8113 0.00552
NP_441851.1_10 Forward -248 -238 10.2065 0.0998
NP_441851.1_10 Reverse -254 -264 8.82982 0.114
NP_442856.1_7 Forward -224 -205 -2.45882 0.236
NP_442515.1_1 Forward -395 -381 9.43936 0.0629
NP_442515.1_1 Reverse -384 -398 1.76955 0.149
NP_440593.1_3 Reverse -207 -226 -5.70374 0.264
NP_441982.1_6 Reverse -360 -369 13.3448 0.274
NP_441982.1_6 Forward -350 -341 12.6763 0.274
NP_441349.1_10 Reverse -375 -394 -1.7705 0.108
NP_441409.1_6 Forward -400 -381 10.6192 0.024
NP_440432.1_9 Forward -393 -378 5.3881 0.0555
NP_442450.1_3 Forward -206 -188 5.52492 0.27
NP_442450.1_5 Reverse -383 -393 9.32148 0.115
NP_442450.1_5 Forward -396 -386 9.32148 0.115
NP_440588.1_2 Reverse -203 -222 -2.55715 0.167
NP_440195.1_4 Reverse -373 -392 16.3224 0.0684
NP_442006.1_2 Reverse -345 -362 -14.6125 0.205
NP_441570.1_1 Forward -394 -376 8.96727 0.0125
NP_441078.1_4 Forward -394 -385 19.6659 0.0007
NP_441078.1_4 Reverse -385 -394 19.6659 0.0007
NP_442729.1_5 Forward -222 -212 18.2696 0.059
NP_440526.1_3 Forward -393 -382 10.1862 0.0646
NP_440526.1_3 Reverse -386 -397 7.92465 0.126
NP_441432.1_8 Reverse -384 -393 16.8143 0.00595
NP_441432.1_8 Forward -395 -386 16.8143 0.00595
NP_441432.1_9 Reverse -194 -207 10.9253 0.235
NP_442320.1_8 Reverse -379 -393 11.996 0.0175
NP_442320.1_8 Forward -400 -386 6.3911 0.029
NP_442344.1_7 Forward -393 -374 0.491109 0.0936
NP_442344.1_7 Forward -340 -321 -8.26035 0.209
NP_441732.1_2 Forward -398 -382 -7.90627 0.0983
NP_441732.1_2 Reverse -381 -397 -16.5594 0.174
NP_440760.1_1 Forward -394 -375 -20.945 0.226
NP_440760.1_7 Reverse -192 -211 4.32522 0.232
NP_440199.1_10 Reverse -382 -392 16.7946 0.0381
NP_440199.1_10 Forward -397 -387 7.64985 0.231
NP_440913.1_1 Forward -396 -378 4.83737 0.254
NP_441072.1_2 Reverse -257 -276 6.78429 0.269
NP_442489.1_7 Forward -394 -385 20.1576 0.000695
NP_442489.1_7 Reverse -385 -394 20.1576 0.000695
NP_440559.1_1 Forward -393 -384 17.4043 0.00658
NP_440559.1_1 Reverse -386 -395 17.4043 0.00658
NP_441659.2_8 Forward -394 -384 18.1713 0.00133
NP_441659.2_8 Reverse -385 -395 18.1713 0.00133
NP_442913.1_10 Reverse -376 -395 11.4058 0.0421
NP_442346.1_5 Forward -395 -385 16.6963 0.00248
NP_442346.1_5 Reverse -384 -394 16.6963 0.00248
NP_442346.1_5 Forward -222 -212 6.17489 0.212
NP_440545.1_3 Reverse -381 -398 -6.15601 0.27
NP_441923.1_6 Forward -340 -326 10.9143 0.25
NP_440486.1_6 Forward -228 -209 5.50599 0.295
NP_440459.1_1 Forward -249 -230 15.7324 0.271
NP_440459.1_2 Reverse -376 -393 10.3636 0.2
NP_440459.1_2 Forward -230 -213 9.47861 0.227
NP_441585.1_5 Forward -342 -323 3.9319 0.252
NP_441585.1_5 Forward -35 -16 0.490334 0.291
NP_441833.1_4 Forward -393 -386 15.9687 0.0124
NP_441833.1_4 Reverse -386 -393 15.9687 0.0124
NP_443040.1_1 Forward -201 -187 11.1503 0.277
NP_441329.1_6 Forward -143 -124 6.2543 0.185
NP_441329.1_6 Forward -208 -189 1.76618 0.231
NP_441895.1_10 Forward -205 -186 -9.44032 0.281
NP_441895.1_10 Forward -228 -209 -27.6315 0.282
NP_442162.1_9 Forward -393 -386 16.2637 0.0124
NP_442162.1_9 Reverse -386 -393 16.2637 0.0124
NP_440671.1_4 Forward -400 -386 17.8958 0.0164
NP_440671.1_4 Reverse -379 -393 13.7659 0.0748
NP_442199.1_7 Forward -33 -14 -0.00131823 0.286
NP_442140.1_3 Forward -220 -210 7.74818 0.13
NP_442140.1_3 Forward -393 -383 4.40493 0.243
NP_442140.1_3 Reverse -386 -396 4.40493 0.243
NP_442723.1_1 Forward -268 -249 6.29183 0.276
NP_441813.1_5 Reverse -383 -393 15.9097 0.01
NP_441813.1_5 Forward -396 -386 15.9097 0.01
NP_442028.1_1 Reverse -193 -206 8.65605 0.281
NP_442089.1_6 Forward -387 -368 7.07928 0.187
NP_440590.1_4 Forward -393 -380 2.57589 0.0845
NP_440590.1_4 Reverse -386 -399 -5.68391 0.286
NP_440567.1_1 Reverse -386 -400 18.6825 0.0136
NP_442497.1_10 Forward -393 -384 10.4228 0.0087
NP_442497.1_10 Reverse -386 -395 10.4228 0.0087
NP_440821.1_4 Reverse -383 -393 18.2696 0.00448
NP_440821.1_4 Forward -396 -386 18.2696 0.00448
NP_441239.1_9 Reverse -383 -395 4.36554 0.253
NP_441239.1_9 Forward -396 -384 4.36554 0.253
NP_442568.1_8 Reverse -367 -381 9.34103 0.257
NP_441892.1_1 Forward -230 -213 2.98877 0.133
NP_441892.1_1 Forward -363 -346 -0.944468 0.193
NP_442193.1_1 Reverse -16 -34 17.1287 0.117
NP_442193.1_1 Reverse -261 -279 12.0155 0.223
NP_442643.1_3 Reverse -213 -232 13.4708 0.0422
NP_441017.1_6 Reverse -381 -395 14.1586 0.157
NP_440546.1_4 Forward -394 -384 10.046 0.109
NP_440546.1_4 Reverse -385 -395 10.046 0.109
NP_440546.1_4 Forward -221 -211 6.94336 0.269
NP_440462.1_6 Reverse -383 -393 7.74818 0.0699
NP_440462.1_6 Forward -396 -386 7.74818 0.0699
NP_440868.1_4 Forward -398 -386 13.2153 0.022
NP_440868.1_4 Reverse -381 -393 5.93884 0.0879
NP_440868.1_4 Forward -13 -1 3.18557 0.14
NP_442840.1_10 Forward -320 -301 13.7658 0.229
NP_442402.1_4 Reverse -140 -159 1.27698 0.173
NP_442402.1_4 Reverse -128 -147 -3.93454 0.22
NP_442402.1_4 Forward -379 -360 -7.76943 0.278
NP_442402.1_9 Reverse -34 -53 9.14423 0.277
NP_442402.1_10 Reverse -240 -250 10.206 0.299
NP_439942.1_2 Forward -212 -193 12.2108 0.271
NP_441843.2_9 Forward -392 -374 12.2428 0.205
NP_442039.1_4 Forward -393 -386 15.1821 0.0124
NP_442039.1_4 Reverse -386 -393 15.1821 0.0124
NP_442039.1_7 Forward -352 -342 15.3197 0.211
NP_442679.1_1 Forward -214 -195 -4.72043 0.283
NP_442679.1_1 Forward -213 -194 -4.91709 0.286
NP_442829.1_2 Forward -208 -192 11.7165 0.287
NP_441926.1_3 Forward -394 -378 5.56507 0.17
NP_442837.1_3 Forward -393 -386 15.7721 0.0124
NP_442837.1_3 Reverse -386 -393 15.7721 0.0124
NP_442053.1_1 Forward -394 -385 18.3876 0.0007
NP_442053.1_1 Reverse -385 -394 18.3876 0.0007
NP_440505.1_3 Reverse -383 -393 16.303 0.00696
NP_440505.1_3 Forward -396 -386 16.303 0.00696
NP_441408.2_7 Reverse -370 -389 -4.81876 0.286
NP_440914.1_1 Forward -394 -384 17.5935 0.000537
NP_440914.1_1 Reverse -385 -395 17.5935 0.000537
NP_442470.1_3 Forward -32 -13 13.6666 0.162
NP_441011.1_8 Forward -393 -384 8.25953 0.144
NP_441011.1_8 Reverse -386 -395 8.25953 0.144
NP_442533.1_6 Forward -394 -385 17.2076 0.00137
NP_442533.1_6 Reverse -385 -394 17.2076 0.00137
NP_440661.1_6 Reverse -273 -292 11.1109 0.113
NP_441482.1_7 Forward -400 -386 0.294584 0.0586
NP_441482.1_7 Reverse -379 -393 -8.94853 0.193
NP_439944.1_9 Forward -393 -383 19.0562 0.00329
NP_439944.1_9 Reverse -386 -396 19.0562 0.00329
NP_440116.1_8 Forward -393 -374 0.786102 0.0948
NP_441527.1_4 Forward -208 -189 -2.33998 0.156
NP_441527.1_4 Forward -213 -194 -2.81744 0.161
NP_441527.1_4 Forward -211 -192 -2.81744 0.161
NP_441527.1_4 Forward -214 -195 -5.87318 0.21
NP_441527.1_4 Forward -206 -187 -11.1252 0.278
NP_440115.1_6 Forward -397 -387 9.41981 0.115
NP_440007.1_9 Forward -398 -384 6.98109 0.213
NP_440007.1_9 Reverse -381 -395 0.88457 0.29
NP_441347.1_5 Forward -400 -386 11.7987 0.246
NP_442492.1_2 Forward -394 -375 -1.37718 0.3
NP_441106.1_1 Forward -395 -386 9.63616 0.0311
NP_441106.1_1 Reverse -384 -393 9.63616 0.0311
NP_442588.1_6 Reverse -12 -31 7.57094 0.173
NP_441286.1_1 Forward -395 -383 21.3768 0.00196
NP_441286.1_1 Reverse -384 -396 21.3768 0.00196
NP_442674.1_3 Forward -362 -343 7.66846 0.216
NP_440670.1_8 Forward -394 -385 18.3876 0.000699
NP_440670.1_8 Reverse -385 -394 18.3876 0.000699
NP_441930.1_3 Forward -198 -179 10.8459 0.217
NP_440886.1_7 Forward -395 -385 7.94438 0.0805
NP_440886.1_7 Reverse -384 -394 7.94438 0.0805
NP_440886.1_7 Forward -241 -231 6.96107 0.112
NP_442614.1_2 Reverse -385 -399 15.4376 0.0773
NP_442614.1_2 Forward -394 -380 5.80112 0.297
NP_442382.1_7 Reverse -372 -391 9.3409 0.222
NP_440404.1_9 Forward -201 -182 13.3207 0.2
NP_440404.1_9 Forward -210 -191 8.35512 0.25
NP_442072.1_9 Forward -395 -377 -3.02911 0.0326
NP_441069.1_5 Reverse -159 -177 2.18243 0.221
NP_442125.1_2 Forward -212 -193 8.25926 0.166
NP_440907.2_8 Forward -239 -229 4.99446 0.228
NP_440907.2_8 Reverse -239 -249 4.10949 0.278
NP_442264.1_2 Reverse -381 -398 15.9685 0.122
NP_441463.1_3 Reverse -375 -394 0.0977854 0.132
NP_441463.1_6 Reverse -383 -397 17.4322 0.114
NP_441463.1_6 Forward -396 -382 7.96207 0.25
NP_440501.1_4 Forward -240 -221 -7.76869 0.285
NP_441626.1_2 Forward -393 -386 15.7721 0.0124
NP_441626.1_2 Reverse -386 -393 15.7721 0.0124
NP_442794.1_1 Forward -398 -386 9.97041 0.0742
NP_442794.1_1 Reverse -208 -220 9.77374 0.0789
NP_442615.1_1 Reverse -376 -394 -5.58572 0.217
NP_441962.1_4 Forward -399 -380 -13.4719 0.273
NP_440387.1_1 Forward -394 -378 -4.36636 0.185
NP_441521.1_4 Forward -332 -313 22.2223 0.0312
NP_440114.1_10 Forward -394 -380 10.4227 0.148
NP_440114.1_10 Reverse -212 -226 8.84938 0.192
NP_441510.2_7 Reverse -379 -393 10.3237 0.28
NP_441133.1_1 Reverse -267 -286 16.1257 0.181
NP_439910.1_2 Reverse -377 -394 5.25038 0.0287
NP_440457.1_1 Forward -398 -386 10.8554 0.092
NP_440457.1_1 Reverse -381 -393 0.0389777 0.25
NP_441801.1_4 Forward -236 -226 2.7333 0.262
NP_442680.1_5 Forward -215 -196 14.1396 0.0829
NP_442130.1_8 Forward -253 -234 7.17681 0.235
NP_442509.1_9 Forward -394 -384 8.14104 0.192
NP_442509.1_9 Reverse -385 -395 8.14104 0.192
NP_440660.1_7 Reverse -273 -292 6.4893 0.0777
NP_441496.1_1 Reverse -186 -200 13.9534 0.271
NP_442936.1_10 Forward -95 -81 11.5608 0.23
NP_442514.1_5 Forward -363 -344 -4.03287 0.238
NP_440554.1_4 Forward -393 -383 7.05986 0.106
NP_440554.1_4 Reverse -386 -396 7.05986 0.106
NP_441885.1_5 Forward -394 -384 20.9245 0.000538
NP_441885.1_5 Reverse -385 -395 20.9245 0.000538
NP_440628.1_1 Forward -205 -195 15.3213 0.248
NP_442703.1_1 Forward -215 -196 10.074 0.228
NP_442341.1_7 Forward -395 -381 8.35772 0.0881
NP_442341.1_7 Reverse -384 -398 6.3911 0.127
NP_442341.1_9 Reverse -383 -397 8.94708 0.162
NP_442341.1_9 Forward -396 -382 7.07881 0.204
NP_441173.1_9 Reverse -342 -350 13.2937 0.17
NP_441173.1_9 Forward -367 -359 12.9004 0.206
NP_443000.1_7 Forward -396 -386 17.0896 0.00865
NP_443000.1_7 Reverse -383 -393 17.0896 0.00865
NP_440275.1_3 Forward -396 -386 8.1415 0.0602
NP_440275.1_3 Reverse -383 -393 8.1415 0.0602
NP_440091.1_1 Reverse -381 -393 16.4603 0.0153
NP_440091.1_1 Forward -398 -386 8.9871 0.0567
NP_442451.1_2 Forward -272 -253 -11.0136 0.284
NP_441207.1_7 Forward -209 -195 15.7419 0.179
NP_441207.1_7 Forward -208 -194 10.8044 0.253
NP_440149.1_8 Forward -394 -375 -1.96717 0.162
NP_441105.1_3 Reverse -380 -399 4.81767 0.076
NP_440216.1_1 Forward -394 -380 7.9644 0.00737
NP_440216.1_1 Reverse -385 -399 -1.27871 0.0303
NP_440216.1_9 Forward -352 -343 7.57121 0.286
NP_440216.1_9 Forward -339 -330 7.47288 0.286
NP_440172.1_1 Forward -394 -384 15.0247 0.00945
NP_440172.1_1 Reverse -385 -395 15.0247 0.00945
NP_442015.1_10 Forward -398 -385 9.16406 0.053
NP_442015.1_10 Reverse -381 -394 0.60927 0.221
NP_441226.1_7 Forward -393 -386 14.4934 0.0123
NP_441226.1_7 Reverse -386 -393 14.4934 0.0123
NP_441111.1_7 Forward -393 -385 18.7023 0.00294
NP_441111.1_7 Reverse -386 -394 18.7023 0.00294
NP_442379.1_10 Reverse -378 -395 -1.43612 0.223
NP_441766.1_2 Forward -394 -385 17.5026 0.00297
NP_441766.1_2 Reverse -385 -394 17.5026 0.00297
NP_440416.1_9 Reverse -211 -230 -18.8801 0.266
NP_443052.1_8 Reverse -375 -394 -0.39387 0.0693
NP_443052.1_8 Reverse -303 -322 -9.63698 0.193
NP_442403.1_8 Forward -392 -373 -0.4922 0.256
NP_442226.1_8 Forward -183 -173 16.6963 0.164
NP_442564.1_10 Forward -355 -341 16.4209 0.203
NP_440261.1_5 Forward -393 -380 -10.6005 0.201
NP_440261.1_5 Reverse -386 -399 -10.6005 0.201
NP_440261.1_5 Forward -239 -226 -10.8955 0.221
NP_440988.1_10 Reverse -383 -397 8.4809 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGCATGGCGATCGCCATTTGTTTGAGCTTGTTTTTAACCAACCGGCTCCTTGGCAAAAAACCATGGCAGAGTTGACCAATGATCCCAGTCTGCCCCAGGTTTTAAAGGTTTTAACGACTGCAGCCCAACAGCACTTTCAATCCCACTTACGGTGGGAACCCCTAACGCCCCAAGAGTGGGCCATGGTGAAGGAAAAATAGAAAAAATACTGAAGCTAATTTTGGCTGGACTTCCTGCTCGTTGTGAATAAAGTTGTGAATAACATTGACAGGACTTACGCAAGATAGATGAGGTTAAGGTGGTAGGATAACTTTTTTCACTCGTTTAGATTACTGTCAGTATTTACTGAGCAGCCCAATTAACTACACCCTAACAAACCTTGCCAAGCATCTCGATGGC

CDS

GTGAGCCATAACCGAATTAAACGTTACCTACAGGGAGTAAAACTGACTCCTCGTTTGCTATGGGAACAAGTACGTCTAGAGCTAATCGAATCACCAAAAGCTTATGTTGTCTTTGACGATACGGTGTTAGACAAAAGCTATAGTAAAAAAATCGAATGCAGTCAGTGGCAGTATAGTGGCAATGCCCGAGGACTAGTCAAAGGTATTGGTCTGGTCAGTTGTGTTTATGTCAATCCAGAGGTGAATCAGTACTGGGCGATCGACTATCGTCTATATGGCAAATGGATGGATAGTTACAGTAAGCTAGAGCATGTCAAGGAAATGCTCAGTCAAGTGACACATAGCAAGAATCTGATGTTCGCCACTGTACTGATGGATAGTTGGTACGCAACTAAAAAGCTGATGGCTTTTATTGATGACACATTAAACAAGATTTACTACTGCCCGCTGAAACGGAACCGATTGGTGGACGATAGTGGCATCACTTCTCCATACCAACGGGTAGATGCACTGCTATGGGATGCATCCGAAATACAGCAAGGAAAAGTGATTAAAATTTGA

Protein

MSHNRIKRYLQGVKLTPRLLWEQVRLELIESPKAYVVFDDTVLDKSYSKKIECSQWQYSGNARGLVKGIGLVSCVYVNPEVNQYWAIDYRLYGKWMDSYSKLEHVKEMLSQVTHSKNLMFATVLMDSWYATKKLMAFIDDTLNKIYYCPLKRNRLVDDSGITSPYQRVDALLWDASEIQQGKVIKI