Your browser is old and dusty. Try Google Chrome!

Details for sll0803

ORF sll0803
Accession NP_441461.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -223 -242 -1.96717 0.28
NP_442100.1_1 Reverse -12 -31 9.88299 0.218
NP_442657.1_5 Reverse -202 -216 17.385 0.217
NP_440295.1_2 Reverse -264 -283 5.11266 0.289
NP_441453.1_4 Forward -198 -190 12.7041 0.0314
NP_442151.1_1 Forward -344 -325 6.98095 0.286
NP_442861.1_1 Reverse -150 -169 12.5858 0.26
NP_441900.1_2 Forward -301 -283 -2.24319 0.275
NP_441594.1_6 Forward -342 -323 -0.295539 0.298
NP_441925.1_2 Reverse -11 -30 0.491109 0.295
NP_441083.1_5 Forward -198 -188 8.33817 0.0393
NP_441083.1_5 Reverse -189 -199 6.96153 0.0717
NP_442827.1_8 Reverse -181 -200 0.686995 0.199
NP_440447.1_5 Forward -73 -63 12.4681 0.291
NP_440178.1_7 Forward -199 -180 -21.24 0.215
NP_441327.1_5 Reverse -101 -110 13.9627 0.261
NP_442111.1_4 Forward -199 -185 15.6342 0.0204
NP_440747.1_10 Forward -201 -189 -4.28759 0.0903
NP_442634.1_4 Reverse -211 -225 -3.44199 0.161
NP_440403.1_4 Reverse -180 -199 -9.14533 0.269
NP_440842.1_10 Reverse -186 -200 2.94952 0.269
NP_442848.1_5 Forward -279 -261 -1.45582 0.276
NP_443018.1_3 Reverse -341 -348 7.11894 0.16
NP_441634.1_8 Reverse -172 -186 -3.83532 0.295
NP_441634.1_8 Reverse -185 -199 -4.52363 0.295
NP_440376.1_1 Forward -198 -189 7.76787 0.0688
NP_440376.1_1 Reverse -189 -198 5.89959 0.116
NP_442687.1_7 Reverse -188 -198 7.84651 0.123
NP_442687.1_7 Forward -199 -189 5.68323 0.189
NP_440642.1_10 Reverse -216 -230 10.717 0.162
NP_442937.1_5 Forward -161 -142 7.7676 0.241
NP_441958.1_5 Reverse -188 -198 8.4365 0.028
NP_441958.1_5 Forward -199 -189 0.963343 0.12
NP_441127.1_1 Forward -342 -328 10.6193 0.244
NP_440984.1_7 Reverse -335 -349 6.48943 0.214
NP_442376.1_2 Reverse -184 -203 -13.3736 0.292
NP_442690.1_1 Forward -31 -12 -1.18052 0.128
NP_442064.1_4 Reverse -329 -348 4.71854 0.285
NP_442051.1_5 Forward -255 -236 8.84924 0.29
NP_441099.1_5 Reverse -179 -198 -12.1936 0.296
NP_442567.1_3 Forward -161 -145 14.5132 0.183
NP_440377.1_1 Reverse -147 -164 12.0468 0.265
NP_440147.1_3 Reverse -181 -200 5.89931 0.24
NP_440147.1_4 Forward -200 -187 3.36254 0.188
NP_440147.1_4 Reverse -187 -200 1.00259 0.242
NP_441550.1_8 Reverse -187 -197 8.92768 0.112
NP_441550.1_8 Forward -200 -190 6.96107 0.183
NP_441916.1_7 Forward -198 -188 4.20827 0.185
NP_441916.1_10 Reverse -68 -87 7.86593 0.182
NP_441916.1_10 Forward -138 -119 0.392778 0.285
NP_441725.1_5 Forward -197 -187 -0.314959 0.246
NP_442941.1_3 Forward -221 -211 5.38824 0.115
NP_442941.1_5 Forward -82 -68 15.2889 0.27
NP_440289.1_2 Forward -140 -127 -0.669033 0.206
NP_442012.1_1 Forward -204 -185 -0.295539 0.255
NP_443030.1_4 Forward -136 -117 -4.22878 0.251
NP_441644.1_6 Forward -198 -188 6.17443 0.165
NP_441644.1_6 Reverse -340 -350 5.68278 0.18
NP_440929.1_8 Forward -198 -189 6.78456 0.082
NP_441346.1_7 Forward -22 -3 13.2741 0.183
NP_442933.1_5 Forward -78 -59 16.2241 0.0806
NP_440576.1_2 Forward -29 -10 7.27595 0.279
NP_442554.1_8 Reverse -190 -200 2.63497 0.265
NP_442142.1_4 Forward -241 -228 13.2934 0.0375
NP_441020.2_6 Forward -262 -245 7.512 0.229
NP_441673.1_1 Forward -198 -189 1.27803 0.155
NP_441673.1_1 Reverse -189 -198 1.27803 0.155
NP_441637.1_9 Forward -26 -8 -3.71743 0.296
NP_442719.1_2 Forward -205 -187 -5.38976 0.219
NP_442719.1_2 Forward -26 -8 -9.32298 0.263
NP_442808.1_1 Forward -199 -189 7.74772 0.0697
NP_441101.1_2 Reverse -47 -66 15.6332 0.176
NP_440145.1_3 Reverse -179 -198 -3.3438 0.195
NP_442542.1_2 Reverse -187 -200 10.049 0.131
NP_441114.1_3 Reverse -220 -229 6.5879 0.262
NP_440093.1_7 Reverse -93 -112 13.1758 0.175
NP_441878.1_6 Forward -199 -189 2.24165 0.0462
NP_441878.1_6 Reverse -188 -198 1.25834 0.108
NP_441878.1_6 Reverse -339 -349 0.668351 0.139
NP_441557.1_5 Forward -198 -189 0.393051 0.166
NP_441557.1_5 Reverse -189 -198 0.393051 0.166
NP_441445.1_1 Forward -165 -146 0.58944 0.272
NP_441433.1_8 Forward -78 -59 11.6025 0.147
NP_442962.1_5 Reverse -229 -248 3.93269 0.291
NP_441308.1_8 Reverse -211 -221 15.418 0.218
NP_442192.1_5 Reverse -9 -28 6.88262 0.297
NP_442183.1_1 Forward -222 -208 5.50613 0.215
NP_441574.1_1 Reverse -213 -232 -6.58872 0.277
NP_441063.1_8 Forward -369 -355 17.8371 0.212
NP_441633.1_3 Forward -200 -187 -6.37223 0.248
NP_442998.1_5 Reverse -102 -112 12.7631 0.159
NP_442998.1_5 Reverse -37 -47 9.22315 0.248
NP_442998.1_10 Forward -196 -189 12.5271 0.0457
NP_440899.1_8 Forward -95 -76 4.62101 0.119
NP_440899.1_8 Forward -27 -8 -8.55534 0.257
NP_441799.1_1 Reverse -383 -397 4.22722 0.261
NP_441362.1_2 Reverse -10 -29 5.17403 0.253
NP_440915.1_6 Reverse -185 -199 12.8809 0.0206
NP_441296.1_7 Forward -296 -277 12.5858 0.29
NP_440134.1_2 Reverse -7 -26 -0.983855 0.298
NP_442452.1_3 Reverse -59 -78 8.94757 0.212
NP_441340.1_5 Reverse -190 -197 3.97235 0.274
NP_442240.1_2 Reverse -254 -273 -13.7669 0.173
NP_440586.1_8 Forward -123 -116 9.18354 0.171
NP_443051.1_1 Reverse -188 -197 5.3096 0.0964
NP_439937.1_9 Forward -199 -182 -17.268 0.296
NP_441665.1_2 Forward -85 -66 9.93088 0.215
NP_440819.1_5 Reverse -36 -44 7.98423 0.228
NP_440819.1_5 Forward -247 -239 7.98423 0.228
NP_440948.1_3 Reverse -37 -51 18.8791 0.282
NP_442713.1_5 Forward -244 -225 6.39097 0.136
NP_441018.1_7 Reverse -260 -279 10.8159 0.194
NP_441018.1_7 Reverse -179 -198 8.35759 0.249
NP_442262.1_10 Forward -197 -190 9.47889 0.187
NP_442262.1_10 Reverse -341 -348 8.20058 0.25
NP_441689.1_5 Forward -224 -214 5.78111 0.197
NP_441689.1_5 Reverse -211 -221 3.71617 0.294
NP_440282.1_2 Reverse -324 -343 8.65258 0.253
NP_441640.1_8 Forward -155 -136 -4.22878 0.26
NP_442280.1_10 Forward -82 -64 9.25304 0.233
NP_441896.1_3 Reverse -180 -199 -3.24547 0.297
NP_440894.1_10 Forward -203 -184 7.57094 0.202
NP_440575.1_8 Forward -35 -16 -1.18052 0.221
NP_440575.1_8 Reverse -22 -41 -6.39206 0.283
NP_441538.1_2 Forward -243 -224 18.0187 0.0947
NP_442845.1_2 Forward -228 -214 5.60446 0.228
NP_443064.1_6 Forward -222 -212 10.5308 0.148
NP_441462.1_2 Reverse -189 -199 8.53483 0.0354
NP_441462.1_2 Forward -198 -188 0.57002 0.144
NP_443062.1_1 Reverse -213 -231 7.18082 0.182
NP_443062.1_6 Forward -206 -187 1.57275 0.272
NP_441410.1_3 Forward -231 -212 4.916 0.261
NP_441410.1_4 Reverse -266 -285 8.4551 0.297
NP_440516.1_8 Reverse -189 -198 7.07956 0.0867
NP_440516.1_8 Forward -198 -189 5.11294 0.118
NP_441443.1_1 Reverse -69 -88 -5.50708 0.298
NP_441443.1_1 Forward -137 -118 -5.80207 0.3
NP_441443.1_10 Forward -77 -59 -0.178247 0.293
NP_440673.1_2 Reverse -179 -198 8.73121 0.263
NP_440673.1_7 Forward -203 -184 2.94938 0.216
NP_441733.1_10 Reverse -186 -199 3.46087 0.3
NP_442366.1_3 Reverse -228 -246 0.707465 0.166
NP_440296.1_6 Forward -37 -19 9.83765 0.298
NP_443054.1_2 Forward -200 -186 0.392915 0.267
NP_441542.1_4 Forward -23 -9 3.93283 0.264
NP_442515.1_1 Forward -199 -185 5.89945 0.105
NP_441046.1_2 Forward -372 -353 -0.885524 0.287
NP_441349.1_6 Reverse -207 -226 12.6841 0.207
NP_441124.1_5 Forward -375 -365 11.7668 0.245
NP_440431.1_3 Reverse -9 -28 -11.0136 0.28
NP_442006.1_2 Forward -73 -56 -17.6607 0.279
NP_442006.1_3 Reverse -183 -201 -7.35568 0.298
NP_441078.1_4 Reverse -189 -198 8.35786 0.0338
NP_441078.1_4 Forward -198 -189 7.27622 0.0764
NP_440793.1_1 Forward -82 -68 11.012 0.279
NP_441432.1_8 Reverse -188 -197 4.32629 0.223
NP_441432.1_9 Forward -35 -22 9.56794 0.274
NP_441732.1_2 Forward -202 -186 -17.641 0.281
NP_440760.1_1 Forward -198 -179 -12.5869 0.0942
NP_442146.1_7 Forward -126 -107 20.354 0.186
NP_440913.1_1 Reverse -338 -356 7.39397 0.202
NP_442400.1_1 Forward -123 -104 -4.81876 0.279
NP_442400.1_10 Reverse -11 -24 17.8233 0.112
NP_440713.1_4 Forward -232 -213 10.6192 0.123
NP_442489.1_7 Forward -198 -189 1.27803 0.0935
NP_442489.1_7 Reverse -189 -198 0.589713 0.17
NP_440559.1_1 Reverse -148 -157 8.1612 0.0618
NP_440559.1_1 Reverse -190 -199 4.91628 0.175
NP_441659.2_8 Forward -198 -188 6.46988 0.0744
NP_441659.2_8 Reverse -189 -199 0.275027 0.27
NP_441040.1_2 Forward -207 -188 -13.2752 0.277
NP_441040.1_2 Reverse -119 -138 -16.5201 0.3
NP_442346.1_5 Reverse -188 -198 5.09324 0.262
NP_440352.1_5 Reverse -143 -162 11.7797 0.254
NP_440545.1_3 Forward -202 -185 -3.69774 0.21
NP_441856.1_5 Forward -202 -183 16.9115 0.225
NP_442851.1_3 Forward -132 -113 15.9291 0.018
NP_440459.1_2 Forward -236 -219 7.80699 0.278
NP_440010.1_10 Reverse -213 -232 8.16093 0.219
NP_441585.1_5 Forward -121 -102 -1.47628 0.298
NP_441329.1_4 Forward -34 -16 11.843 0.251
NP_441895.1_10 Forward -142 -123 -27.3366 0.282
NP_440788.1_8 Reverse -283 -302 11.6025 0.265
NP_440671.1_6 Forward -247 -228 12.6833 0.226
NP_441973.1_1 Forward -93 -78 -0.216765 0.271
NP_442140.1_3 Forward -197 -187 9.22315 0.111
NP_440875.1_9 Reverse -117 -127 10.7081 0.201
NP_440875.1_9 Reverse -342 -352 8.85871 0.233
NP_440590.1_4 Reverse -148 -161 -3.22564 0.255
NP_440567.1_1 Reverse -116 -130 4.71948 0.114
NP_442497.1_10 Reverse -190 -199 0.29472 0.199
NP_442497.1_10 Forward -197 -188 0.29472 0.199
NP_440821.1_4 Reverse -187 -197 -0.0199663 0.217
NP_442810.1_5 Reverse -351 -370 22.418 0.044
NP_441239.1_9 Forward -200 -188 4.07055 0.264
NP_440876.1_5 Forward -196 -177 4.916 0.283
NP_440546.1_4 Reverse -189 -199 10.6277 0.109
NP_440546.1_4 Forward -198 -188 7.42815 0.241
NP_441230.1_5 Reverse -184 -203 0.58944 0.264
NP_440675.1_4 Reverse -185 -204 12.4875 0.299
NP_442592.1_2 Forward -278 -259 7.27595 0.212
NP_441848.1_7 Forward -114 -95 -4.32786 0.289
NP_442923.1_6 Reverse -21 -35 18.919 0.114
NP_442039.1_7 Forward -71 -61 14.4347 0.211
NP_442679.1_1 Forward -373 -354 4.22769 0.147
NP_442829.1_2 Forward -368 -352 8.14109 0.287
NP_442053.1_1 Forward -198 -189 6.8829 0.111
NP_441777.1_2 Forward -64 -46 18.702 0.299
NP_440914.1_1 Reverse -147 -157 8.6151 0.186
NP_441011.1_8 Reverse -190 -199 8.06287 0.16
NP_441011.1_10 Forward -64 -45 14.9458 0.213
NP_442533.1_6 Forward -198 -189 5.11294 0.155
NP_442533.1_6 Reverse -340 -349 3.83464 0.202
NP_442533.1_6 Reverse -213 -222 1.67135 0.293
NP_443016.1_10 Reverse -112 -131 9.3409 0.284
NP_441482.1_7 Reverse -183 -197 -1.47537 0.0721
NP_441482.1_7 Reverse -207 -221 -7.67023 0.193
NP_441482.1_7 Forward -204 -190 -10.7185 0.213
NP_441028.1_6 Forward -76 -66 8.14104 0.217
NP_441028.1_6 Forward -109 -99 5.38779 0.255
NP_441527.1_4 Reverse -283 -302 -5.5867 0.204
NP_441527.1_4 Reverse -10 -29 -12.3666 0.285
NP_439903.1_6 Reverse -106 -125 1.76863 0.24
NP_442306.1_10 Forward -203 -184 -11.8003 0.15
NP_441286.1_1 Forward -199 -187 -4.77924 0.175
NP_442058.1_6 Forward -27 -8 -1.37718 0.237
NP_440670.1_8 Reverse -189 -198 8.25953 0.0703
NP_440670.1_8 Forward -198 -189 6.29291 0.124
NP_442614.1_2 Reverse -189 -203 8.16106 0.255
NP_442614.1_2 Forward -137 -123 6.3911 0.291
NP_442072.1_9 Forward -199 -181 -15.0255 0.168
NP_440907.2_8 Forward -197 -187 7.94438 0.117
NP_441901.1_9 Reverse -227 -246 8.75091 0.243
NP_441460.1_1 Forward -365 -346 15.8021 0.228
NP_441460.1_2 Forward -75 -62 21.7498 0.00263
NP_442615.1_1 Forward -207 -189 0.0191479 0.109
NP_440387.1_1 Forward -198 -182 3.69678 0.0533
NP_441431.1_2 Forward -201 -187 6.29216 0.275
NP_441431.1_3 Reverse -257 -276 3.34271 0.268
NP_441193.1_6 Reverse -148 -167 2.26107 0.272
NP_440311.1_8 Reverse -70 -84 18.2892 0.25
NP_440766.1_5 Reverse -16 -28 6.98735 0.29
NP_441237.1_9 Reverse -190 -200 12.4681 0.12
NP_440457.1_1 Reverse -185 -197 7.61046 0.101
NP_442680.1_7 Reverse -29 -48 -3.44213 0.265
NP_442680.1_7 Forward -28 -9 -7.08038 0.279
NP_441984.1_1 Reverse -183 -201 11.5239 0.196
NP_442514.1_5 Forward -114 -95 -5.90115 0.263
NP_442514.1_5 Forward -79 -60 -6.19614 0.264
NP_441885.1_5 Reverse -189 -199 7.84651 0.0419
NP_442341.1_7 Forward -199 -185 12.3893 0.0454
NP_442341.1_7 Reverse -188 -202 2.85119 0.243
NP_440275.1_3 Reverse -187 -197 7.15819 0.0872
NP_441190.1_7 Forward -187 -168 16.0274 0.204
NP_442495.1_4 Forward -350 -340 13.353 0.191
NP_440149.1_8 Forward -244 -225 -7.96535 0.296
NP_440216.1_9 Reverse -65 -74 8.65285 0.286
NP_440216.1_9 Reverse -4 -13 8.65285 0.286
NP_440216.1_9 Reverse -66 -75 7.27622 0.286
NP_440172.1_1 Forward -198 -188 4.0116 0.208
NP_440172.1_3 Reverse -200 -219 13.9625 0.194
NP_441064.1_4 Forward -191 -172 15.4374 0.124
NP_442015.1_10 Forward -202 -189 -1.16069 0.297
NP_441045.1_4 Reverse -165 -184 11.3075 0.274
NP_441766.1_2 Forward -198 -189 4.22796 0.193
NP_443052.1_9 Forward -295 -276 -5.9004 0.274
NP_440261.1_5 Reverse -190 -203 -3.22564 0.12
NP_440261.1_5 Forward -348 -335 -6.56889 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACAAGGTGATTTGCAATCCTTAGACTTAGAGAATTTAATTGAAGAAATAGAGTCCATGGGCCGCAGTGATAAACGGGAAGTTTATAGTCGCTTGAAGGTACTTTTCCTGCACCTGCTCAAATGGAAATATCAACCCCAGAAGCGCACTGGTAGCTGGAAAAACACCATCGATGAGCAAAGGGATCAGCTTAATTTAATTCTGGCCGATAGCCCCAGCTTGAATCCCTATGTGCAAACCATATTTGCCGATTGTTATCTTAAAGGGAGAAAGGGCGCAGCCAACGAAACCAATTTACCCCTCTCAAACTTTCCGGTGGATTGTCCCTTTTCCCTGGCGGAAATGCTTGATGCAGAATTCTTTCCCGATTAATTAATTTTTCTGGCAAATTTCCCTGGCTCC

CDS

ATGAATACCCCCTCTTCGACCCAACCCGCAACAATGGTCAAAGCGATAATCCCAACTTTGTACGACACCGATTTCAATCTTTGGATTGAGGAAACTGTGCGTCAACTCAAACAAGGCGATTTACAATCCTTAGATTTAGACAATTTAATTGAAGAAATAGAGTCCATGGGTCGCAGCGATAAACGGGAAGTTAAAAATAGACTAATTGTTTTGATGATTCATTTGCTCGAATGGCGGTATCAACCGGAAAAACGCTCTAACAGTTGGACAGCGACCATTAACGAACAACGTCGTCAGTTAGGCCTCATCACCGGGGATAGCCCTAGTCTGAAACCATTTTTGGTTGATAATTTTCCCGGTTGTTATCAGATAGCCCGCAGGGATGCGGTGAGGGAAACGTTTTTATCGCTATCAGTTTTCCCCCTGGATTGTCCCTTTTCCCTGGCGGAAATTCTCAATGCTGAGTTTTTCCCCGATTAA

Protein

MNTPSSTQPATMVKAIIPTLYDTDFNLWIEETVRQLKQGDLQSLDLDNLIEEIESMGRSDKREVKNRLIVLMIHLLEWRYQPEKRSNSWTATINEQRRQLGLITGDSPSLKPFLVDNFPGCYQIARRDAVRETFLSLSVFPLDCPFSLAEILNAEFFPD