Your browser is old and dusty. Try Google Chrome!

Details for sll0794

ORF sll0794
Accession NP_442632.1
Symbol corR, coaR
Category Cobalamin, heme, phycobilin and porphyrin
Definition cobalt-dependent transcriptional regulator
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -153 -167 12.586 0.209
NP_441061.1_2 Forward -161 -147 7.9644 0.0955
NP_440557.1_1 Reverse -154 -173 1.76941 0.249
NP_440795.1_7 Forward -161 -154 14.6904 0.0123
NP_440795.1_7 Reverse -154 -161 14.6904 0.0123
NP_442100.1_1 Reverse -25 -44 8.06865 0.24
NP_441418.1_6 Forward -162 -143 -21.83 0.16
NP_441418.1_6 Reverse -330 -349 -29.4015 0.224
NP_441480.1_10 Forward -62 -43 7.57094 0.286
NP_442291.1_5 Reverse -152 -168 6.15506 0.0727
NP_441453.1_1 Reverse -146 -164 6.80322 0.225
NP_441453.1_4 Reverse -153 -161 16.539 0.00633
NP_441453.1_4 Forward -162 -154 16.539 0.00633
NP_442151.1_6 Reverse -153 -167 10.816 0.114
NP_442151.1_6 Reverse -330 -344 6.09611 0.248
NP_442151.1_6 Forward -162 -148 5.40779 0.278
NP_441818.1_1 Reverse -154 -165 9.20294 0.25
NP_441818.1_6 Reverse -146 -160 21.7307 0.168
NP_440226.1_1 Forward -162 -143 10.4225 0.0622
NP_440226.1_1 Forward -322 -303 2.55606 0.259
NP_441630.1_3 Forward -170 -151 12.1925 0.0695
NP_440259.1_4 Reverse -218 -232 10.2748 0.27
NP_442173.1_1 Forward -161 -153 15.4574 0.00633
NP_442173.1_1 Reverse -154 -162 15.4574 0.00633
NP_442752.1_4 Forward -162 -155 13.8055 0.0199
NP_442752.1_4 Reverse -153 -160 13.8055 0.0199
NP_443027.1_4 Reverse -151 -161 13.943 0.0452
NP_443027.1_4 Forward -164 -154 13.2547 0.0521
NP_441812.1_3 Forward -317 -303 7.27608 0.282
NP_442975.1_10 Reverse -149 -163 12.0937 0.0477
NP_442975.1_10 Forward -166 -152 4.32555 0.245
NP_441225.1_1 Forward -160 -141 -1.27885 0.149
NP_440784.1_7 Forward -161 -154 15.9687 0.0123
NP_440784.1_7 Reverse -154 -161 15.9687 0.0123
NP_442909.1_7 Forward -161 -147 13.5686 0.12
NP_440061.1_9 Forward -164 -150 13.372 0.0819
NP_440110.1_8 Reverse -328 -347 4.916 0.184
NP_441054.1_2 Reverse -348 -367 13.0775 0.212
NP_441054.1_4 Reverse -314 -332 2.28076 0.169
NP_442062.1_8 Forward -162 -152 19.4496 0.000558
NP_442062.1_8 Reverse -153 -163 10.3048 0.0493
NP_440761.1_4 Reverse -148 -167 -12.2919 0.241
NP_440304.1_4 Forward -164 -154 10.8948 0.051
NP_440304.1_4 Reverse -151 -161 9.91146 0.051
NP_440304.1_4 Forward -224 -214 6.27322 0.167
NP_442242.1_4 Forward -161 -154 14.3954 0.0124
NP_442242.1_4 Reverse -154 -161 14.3954 0.0124
NP_440044.1_8 Forward -161 -142 -3.63879 0.288
NP_439918.1_2 Reverse -353 -372 -2.36049 0.242
NP_441935.1_1 Reverse -343 -362 10.5209 0.211
NP_441935.1_1 Reverse -174 -193 7.37428 0.24
NP_441208.1_9 Reverse -150 -164 8.25939 0.219
NP_441208.1_9 Reverse -210 -224 5.89945 0.259
NP_441208.1_9 Forward -165 -151 5.30946 0.271
NP_441594.1_6 Forward -339 -320 2.75272 0.244
NP_441594.1_6 Reverse -144 -163 1.67108 0.264
NP_440370.1_10 Reverse -144 -163 16.9124 0.0713
NP_441546.1_1 Reverse -201 -214 18.4072 0.201
NP_442110.1_7 Reverse -153 -167 11.701 0.0593
NP_442110.1_7 Forward -153 -139 0.196253 0.266
NP_442110.1_7 Forward -162 -148 -0.0987402 0.274
NP_441925.1_4 Forward -190 -171 -15.4392 0.264
NP_440856.1_7 Reverse -339 -358 8.16093 0.116
NP_440856.1_7 Reverse -327 -346 -7.57203 0.252
NP_441083.1_5 Forward -162 -152 11.3864 0.0159
NP_441083.1_5 Reverse -153 -163 11.2881 0.0159
NP_441083.1_5 Forward -322 -312 6.66654 0.0811
NP_441083.1_5 Forward -351 -341 -0.904945 0.283
NP_442827.1_8 Reverse -145 -164 9.93006 0.0665
NP_442827.1_8 Forward -170 -151 1.27698 0.184
NP_441149.1_9 Forward -66 -47 1.27698 0.221
NP_441434.1_7 Forward -160 -146 14.8476 0.0961
NP_441738.1_2 Forward -160 -153 15.28 0.0102
NP_441738.1_2 Reverse -155 -162 15.28 0.0102
NP_441558.1_5 Forward -164 -145 13.4708 0.0578
NP_440209.1_1 Reverse -153 -161 18.1123 0.00295
NP_440209.1_1 Forward -162 -154 18.1123 0.00295
NP_440447.1_1 Forward -167 -149 6.60732 0.194
NP_442398.1_1 Reverse -22 -41 11.1109 0.241
NP_441713.1_1 Reverse -147 -166 -7.4737 0.13
NP_440178.1_7 Forward -163 -144 -10.6203 0.0795
NP_440178.1_7 Reverse -152 -171 -14.0619 0.148
NP_442570.1_3 Reverse -349 -368 2.45773 0.187
NP_442570.1_3 Reverse -350 -369 -3.3438 0.218
NP_442570.1_3 Reverse -151 -170 -5.50708 0.244
NP_441716.1_1 Reverse -133 -147 4.32615 0.256
NP_442111.1_4 Forward -163 -149 7.17775 0.103
NP_442111.1_4 Reverse -152 -166 4.52282 0.203
NP_440343.1_3 Forward -359 -341 12.6047 0.132
NP_440906.1_5 Forward -161 -154 15.8704 0.0124
NP_440906.1_5 Reverse -154 -161 15.8704 0.0124
NP_440747.1_10 Forward -165 -153 7.4138 0.00422
NP_440747.1_10 Reverse -150 -162 -2.02597 0.0196
NP_440747.1_10 Reverse -339 -351 -3.99259 0.0763
NP_440747.1_10 Forward -354 -342 -11.7607 0.142
NP_441130.1_10 Reverse -151 -165 18.2892 0.0142
NP_441130.1_10 Forward -164 -150 9.5377 0.124
NP_441486.1_1 Reverse -150 -164 -3.44199 0.178
NP_441486.1_1 Forward -165 -151 -4.4253 0.198
NP_442145.1_3 Reverse -54 -73 6.09597 0.243
NP_442330.1_3 Reverse -136 -155 13.5691 0.0921
NP_442634.1_4 Forward -164 -150 5.80112 0.051
NP_442634.1_4 Reverse -151 -165 -3.24533 0.161
NP_440403.1_4 Reverse -144 -163 -1.86883 0.174
NP_440403.1_10 Reverse -356 -375 9.14423 0.189
NP_440403.1_10 Forward -162 -143 2.94938 0.278
NP_440403.1_10 Reverse -342 -361 2.94938 0.278
NP_441014.1_8 Forward -373 -354 -0.197208 0.218
NP_441014.1_10 Reverse -212 -231 -3.24622 0.297
NP_442848.1_1 Reverse -147 -161 6.3911 0.0791
NP_442848.1_5 Forward -169 -151 0.904127 0.276
NP_442848.1_9 Forward -168 -149 10.4225 0.158
NP_441012.1_4 Forward -160 -147 8.27909 0.272
NP_443018.1_3 Forward -161 -154 14.8871 0.0123
NP_443018.1_3 Reverse -154 -161 14.8871 0.0123
NP_441634.1_8 Forward -164 -150 15.8309 0.0248
NP_440376.1_1 Forward -162 -153 19.4693 0.000692
NP_440376.1_1 Reverse -153 -162 19.4693 0.000692
NP_440376.1_1 Reverse -342 -351 5.50626 0.131
NP_440376.1_1 Reverse -213 -222 3.7363 0.195
NP_440376.1_1 Reverse -365 -374 0.491382 0.273
NP_441857.1_5 Reverse -146 -164 6.11567 0.197
NP_441588.1_4 Reverse -155 -165 6.76487 0.185
NP_442687.1_7 Reverse -152 -162 15.8113 0.0125
NP_442687.1_7 Forward -163 -153 9.02648 0.0994
NP_442687.1_7 Forward -170 -160 3.91327 0.278
NP_440066.1_5 Forward -352 -333 7.76679 0.256
NP_442485.1_3 Forward -353 -334 -4.91709 0.286
NP_442485.1_3 Forward -350 -331 -5.31042 0.289
NP_442485.1_3 Reverse -331 -350 -5.60541 0.293
NP_442485.1_3 Reverse -340 -359 -5.99873 0.297
NP_442958.1_3 Reverse -142 -161 -0.688862 0.268
NP_442958.1_3 Forward -173 -154 -2.0655 0.293
NP_441422.1_7 Forward -164 -147 14.0018 0.0565
NP_441422.1_7 Forward -257 -240 -3.5994 0.235
NP_441029.1_3 Forward -254 -235 -0.000545616 0.287
NP_442658.1_1 Reverse -151 -161 18.7607 0.00222
NP_442658.1_1 Forward -164 -154 14.2375 0.0237
NP_440141.1_4 Forward -377 -358 -9.53865 0.298
NP_442205.1_9 Reverse -147 -163 15.4965 0.0269
NP_440656.1_8 Forward -233 -214 2.3594 0.113
NP_440656.1_8 Forward -173 -154 -9.73531 0.295
NP_441256.1_1 Reverse -156 -175 -8.26035 0.247
NP_442937.1_5 Reverse -316 -335 9.73422 0.183
NP_442321.1_9 Forward -153 -134 11.7992 0.278
NP_441958.1_2 Reverse -144 -163 11.8975 0.214
NP_441958.1_5 Forward -163 -153 21.2195 0.000805
NP_441958.1_5 Reverse -152 -162 12.2714 0.00183
NP_440651.1_7 Forward -270 -251 12.9791 0.265
NP_442836.1_5 Reverse -147 -166 1.0811 0.288
NP_440203.1_5 Forward -319 -309 9.321 0.263
NP_439905.1_1 Forward -161 -148 20.9638 0.00648
NP_439905.1_1 Forward -344 -331 13.9823 0.145
NP_440984.1_7 Reverse -148 -162 12.8809 0.121
NP_440984.1_7 Forward -167 -153 9.73436 0.127
NP_439990.1_5 Forward -167 -154 9.36073 0.145
NP_442376.1_2 Reverse -148 -167 -12.6852 0.286
NP_442911.1_2 Reverse -143 -162 1.57275 0.0576
NP_441580.1_6 Forward -173 -154 -5.01543 0.235
NP_441580.1_6 Reverse -142 -161 -5.11376 0.235
NP_440153.1_5 Reverse -154 -168 13.7659 0.0551
NP_440153.1_5 Forward -161 -147 4.62115 0.199
NP_441591.1_10 Forward -164 -145 15.7324 0.073
NP_440993.1_2 Forward -167 -151 14.4149 0.0631
NP_440993.1_2 Reverse -139 -155 1.04184 0.295
NP_440602.1_2 Reverse -208 -227 1.86774 0.263
NP_441129.1_6 Forward -170 -151 -0.983855 0.229
NP_441099.1_5 Forward -172 -153 -4.52377 0.146
NP_442002.1_9 Reverse -152 -159 10.7572 0.185
NP_441646.1_1 Reverse -146 -165 0.196116 0.254
NP_442438.1_10 Reverse -148 -162 13.9626 0.0322
NP_442438.1_10 Reverse -145 -159 -0.197071 0.253
NP_442438.1_10 Forward -167 -153 -0.787057 0.279
NP_441000.1_6 Reverse -152 -166 4.81781 0.0933
NP_441000.1_6 Forward -163 -149 -4.03198 0.225
NP_440147.1_4 Forward -164 -151 18.4072 0.00407
NP_440147.1_4 Reverse -151 -164 10.4424 0.0355
NP_440147.1_6 Reverse -136 -155 19.2723 0.181
NP_441295.1_4 Reverse -337 -356 -4.81876 0.29
NP_441550.1_8 Forward -164 -154 15.8108 0.0132
NP_441550.1_8 Reverse -151 -161 10.501 0.066
NP_441916.1_7 Reverse -153 -163 18.9579 0.00144
NP_441916.1_7 Forward -162 -152 18.4663 0.00144
NP_440206.1_4 Forward -172 -153 5.40686 0.242
NP_440465.1_10 Forward -165 -146 1.86774 0.275
NP_441041.1_4 Forward -351 -332 -6.29373 0.166
NP_441041.1_7 Forward -165 -153 16.6495 0.0131
NP_441041.1_7 Reverse -150 -162 10.2357 0.1
NP_443063.1_7 Reverse -261 -277 9.49831 0.224
NP_442004.1_6 Forward -162 -148 9.2427 0.14
NP_441725.1_4 Forward -167 -153 4.62054 0.278
NP_441725.1_5 Forward -161 -151 9.02648 0.0553
NP_441725.1_5 Reverse -154 -164 1.94665 0.115
NP_439966.1_7 Reverse -151 -161 17.4824 0.00636
NP_439966.1_7 Forward -164 -154 14.3359 0.0203
NP_439966.1_9 Reverse -151 -160 10.7178 0.0863
NP_440736.1_3 Forward -224 -205 -1.27885 0.282
NP_442941.1_3 Reverse -154 -164 19.2529 0.00262
NP_442941.1_3 Forward -161 -151 2.53664 0.14
NP_440289.1_2 Forward -165 -152 6.01747 0.0605
NP_440289.1_2 Reverse -150 -163 3.46087 0.078
NP_440983.1_5 Forward -159 -140 9.53756 0.151
NP_440983.1_5 Forward -351 -332 0.196116 0.216
NP_440983.1_9 Forward -171 -152 12.2908 0.202
NP_440260.1_7 Reverse -206 -225 8.84924 0.152
NP_440260.1_8 Reverse -333 -351 0.0191479 0.202
NP_440260.1_8 Reverse -349 -367 -7.55234 0.295
NP_440260.1_8 Reverse -237 -255 -7.749 0.3
NP_442281.1_1 Forward -167 -153 16.4202 0.00801
NP_442281.1_1 Reverse -148 -162 7.27547 0.104
NP_442281.1_1 Forward -227 -213 1.86729 0.285
NP_441334.1_7 Reverse -151 -170 -10.9153 0.12
NP_441334.1_7 Forward -164 -145 -11.8003 0.126
NP_440177.1_1 Reverse -351 -369 5.62401 0.272
NP_440177.1_5 Reverse -138 -157 15.3391 0.233
NP_440437.1_1 Forward -168 -149 21.4356 0.0113
NP_441457.1_7 Forward -164 -145 3.14605 0.246
NP_441457.1_7 Reverse -142 -161 -1.08219 0.293
NP_441556.1_4 Forward -348 -329 15.0183 0.161
NP_441556.1_10 Reverse -148 -162 15.478 0.144
NP_440498.1_1 Reverse -144 -162 -3.42244 0.261
NP_440453.1_5 Forward -120 -102 7.59063 0.246
NP_441644.1_6 Reverse -153 -163 19.0557 0.000803
NP_441644.1_6 Forward -162 -152 10.1076 0.0628
NP_441644.1_6 Forward -374 -364 3.32285 0.288
NP_442215.1_2 Reverse -151 -167 7.43336 0.0692
NP_442215.1_2 Reverse -259 -275 1.63183 0.13
NP_442029.1_1 Reverse -334 -353 -14.7502 0.272
NP_442029.1_1 Reverse -151 -170 -20.0601 0.297
NP_442029.1_6 Reverse -257 -276 6.4893 0.238
NP_442029.1_10 Reverse -329 -348 4.12936 0.293
NP_442247.1_8 Forward -164 -150 11.996 0.247
NP_440253.1_2 Forward -162 -144 -0.472507 0.212
NP_440929.1_8 Forward -162 -153 19.2726 0.000701
NP_440929.1_8 Reverse -153 -162 19.2726 0.000701
NP_442933.1_10 Forward -162 -153 17.601 0.00325
NP_442933.1_10 Reverse -153 -162 17.601 0.00325
NP_441751.2_8 Reverse -154 -168 5.30946 0.0448
NP_441751.2_8 Forward -161 -147 -5.40861 0.206
NP_442554.1_8 Reverse -154 -164 17.2863 0.00543
NP_442554.1_8 Forward -161 -151 16.008 0.0065
NP_441762.1_7 Forward -163 -151 12.527 0.0142
NP_441762.1_7 Reverse -152 -164 2.30059 0.0676
NP_442142.1_4 Forward -165 -152 14.1783 0.0311
NP_442142.1_4 Reverse -150 -163 6.60689 0.16
NP_442142.1_9 Forward -160 -141 11.7008 0.176
NP_442292.1_1 Reverse -154 -163 17.5026 0.00435
NP_442292.1_1 Forward -161 -152 9.63616 0.0183
NP_442292.1_5 Reverse -149 -168 12.2908 0.138
NP_440919.1_1 Reverse -201 -220 -1.47551 0.221
NP_440039.1_9 Reverse -142 -161 16.0274 0.253
NP_442476.1_6 Forward -161 -147 21.9274 0.0153
NP_440895.1_3 Forward -346 -327 15.7004 0.258
NP_441711.1_4 Forward -171 -152 3.73603 0.235
NP_443009.1_5 Forward -163 -152 19.626 0.00102
NP_443009.1_5 Reverse -152 -163 7.82632 0.118
NP_443009.1_5 Reverse -212 -223 7.62965 0.124
NP_443009.1_5 Forward -223 -212 3.79477 0.278
NP_443009.1_5 Reverse -261 -272 3.40144 0.296
NP_442301.1_2 Forward -349 -330 9.34008 0.204
NP_441715.1_4 Reverse -154 -164 16.7946 0.0106
NP_441715.1_4 Forward -161 -151 9.32148 0.097
NP_441088.1_1 Reverse -150 -169 6.39097 0.243
NP_440730.1_4 Forward -197 -178 -5.40875 0.298
NP_441448.1_1 Reverse -325 -344 9.0459 0.198
NP_441198.1_8 Forward -224 -214 10.3415 0.28
NP_440379.1_5 Forward -354 -335 -9.34199 0.263
NP_440379.1_5 Reverse -144 -163 -9.63698 0.264
NP_441468.1_1 Forward -161 -154 15.8704 0.0124
NP_441468.1_1 Reverse -154 -161 15.8704 0.0124
NP_441468.1_1 Reverse -183 -190 6.72562 0.126
NP_441020.2_3 Forward -172 -153 10.9142 0.297
NP_441020.2_7 Forward -190 -171 7.96345 0.269
NP_441015.1_10 Reverse -148 -167 -0.4922 0.169
NP_441015.1_10 Reverse -334 -353 -7.27704 0.265
NP_441015.1_10 Reverse -331 -350 -10.4236 0.284
NP_441015.1_10 Reverse -340 -359 -11.7019 0.3
NP_441673.1_1 Forward -162 -153 20.8459 0.000698
NP_441673.1_1 Reverse -153 -162 20.8459 0.000698
NP_441673.1_1 Reverse -342 -351 -7.86675 0.187
NP_441673.1_1 Forward -351 -342 -7.96508 0.206
NP_440265.1_8 Forward -111 -93 16.3421 0.208
NP_441826.1_2 Forward -168 -154 7.76774 0.0848
NP_441826.1_2 Reverse -147 -161 0.88457 0.17
NP_441826.1_2 Forward -159 -145 -3.34366 0.284
NP_441826.1_5 Reverse -340 -359 1.96607 0.279
NP_441330.1_1 Forward -167 -148 -10.6203 0.183
NP_442490.1_9 Reverse -141 -160 -9.047 0.299
NP_442868.1_6 Forward -164 -154 10.4031 0.038
NP_442868.1_6 Reverse -151 -161 8.53483 0.0555
NP_441251.1_8 Forward -129 -116 14.5765 0.254
NP_442808.1_1 Reverse -152 -162 18.4657 0.00201
NP_442808.1_1 Forward -163 -153 8.73102 0.0481
NP_440145.1_3 Reverse -143 -162 -5.50708 0.269
NP_442542.1_2 Reverse -151 -164 10.344 0.126
NP_442542.1_9 Forward -169 -155 20.1568 0.014
NP_442542.1_10 Forward -161 -147 16.9125 0.238
NP_442050.1_5 Forward -164 -154 15.9091 0.0091
NP_442050.1_5 Reverse -151 -161 8.23937 0.234
NP_442342.1_9 Reverse -151 -167 4.97508 0.241
NP_441114.1_3 Forward -221 -212 7.27622 0.247
NP_440558.1_2 Reverse -150 -169 -7.4737 0.294
NP_442789.1_4 Reverse -351 -370 -2.55715 0.238
NP_442789.1_4 Reverse -328 -347 -4.91709 0.265
NP_441518.1_3 Reverse -143 -162 -4.91709 0.121
NP_441878.1_6 Forward -163 -153 10.5014 0.0176
NP_441878.1_6 Reverse -152 -162 10.4031 0.0176
NP_441036.1_8 Reverse -152 -162 17.7779 0.000554
NP_441036.1_8 Forward -163 -153 15.713 0.00724
NP_442650.1_2 Forward -351 -337 4.62115 0.165
NP_441557.1_5 Forward -162 -153 19.9609 0.000699
NP_441557.1_5 Reverse -153 -162 19.9609 0.000699
NP_442066.2_4 Reverse -153 -172 0.786102 0.16
NP_442066.2_4 Forward -153 -134 -3.83545 0.223
NP_442066.2_9 Reverse -149 -162 10.934 0.154
NP_442066.2_9 Forward -166 -153 10.1474 0.156
NP_441433.1_8 Reverse -359 -378 0.0977854 0.242
NP_442419.1_2 Forward -350 -331 4.81767 0.184
NP_442419.1_2 Forward -167 -148 -3.73712 0.27
NP_441308.1_8 Reverse -151 -161 9.22315 0.226
NP_440101.1_3 Reverse -148 -167 24.4839 0.00503
NP_442183.1_1 Forward -162 -148 17.7975 0.00938
NP_442183.1_1 Reverse -213 -227 3.8345 0.295
NP_442135.1_3 Forward -174 -155 14.3558 0.116
NP_441574.1_1 Reverse -353 -372 2.65439 0.156
NP_441574.1_1 Reverse -141 -160 -7.96535 0.3
NP_441549.1_9 Reverse -149 -167 -5.68405 0.198
NP_441549.1_9 Reverse -326 -344 -8.33898 0.226
NP_442347.1_2 Forward -161 -152 11.1111 0.056
NP_442347.1_2 Reverse -154 -163 3.34298 0.284
NP_442645.1_2 Reverse -145 -164 -20.4534 0.288
NP_441037.1_4 Reverse -151 -161 16.2838 0.0168
NP_441037.1_4 Reverse -51 -61 7.61007 0.237
NP_441037.1_4 Forward -164 -154 7.22024 0.237
NP_441633.1_3 Forward -164 -151 13.3923 0.018
NP_441633.1_3 Reverse -151 -164 -3.81562 0.177
NP_440136.1_2 Forward -161 -154 15.9687 0.0123
NP_440136.1_2 Reverse -154 -161 15.9687 0.0123
NP_442590.1_9 Reverse -349 -368 9.73422 0.23
NP_442590.1_10 Reverse -147 -166 11.7992 0.153
NP_442590.1_10 Reverse -153 -172 3.04771 0.297
NP_442998.1_5 Reverse -59 -69 11.1898 0.191
NP_442998.1_10 Forward -160 -153 15.5754 0.0102
NP_442998.1_10 Reverse -155 -162 15.5754 0.0102
NP_440899.1_2 Forward -173 -154 17.0099 0.0554
NP_440299.1_1 Reverse -149 -162 7.59019 0.109
NP_440299.1_1 Forward -166 -153 2.87033 0.269
NP_441799.1_1 Reverse -149 -163 16.0269 0.0153
NP_441799.1_1 Forward -166 -152 8.45543 0.114
NP_441007.1_10 Reverse -148 -161 13.6873 0.0499
NP_441007.1_10 Forward -167 -154 2.57589 0.183
NP_442201.1_10 Forward -173 -154 -12.2919 0.268
NP_441449.1_8 Forward -338 -319 15.1471 0.21
NP_442333.2_5 Forward -350 -331 -14.6519 0.278
NP_442333.2_5 Forward -173 -154 -14.6519 0.278
NP_440256.1_1 Forward -165 -146 11.7008 0.0138
NP_440256.1_1 Reverse -243 -262 0.392778 0.0847
NP_440256.1_1 Reverse -150 -169 -5.21209 0.178
NP_440256.1_1 Reverse -210 -229 -7.57203 0.24
NP_441559.1_8 Forward -167 -153 2.16287 0.147
NP_441559.1_8 Reverse -208 -222 -0.393733 0.175
NP_441559.1_8 Reverse -148 -162 -6.98191 0.281
NP_440915.1_6 Forward -166 -152 11.3077 0.0263
NP_440915.1_6 Reverse -149 -163 6.88276 0.0779
NP_440915.1_6 Reverse -384 -398 -2.65535 0.278
NP_441296.1_9 Reverse -95 -108 10.2451 0.271
NP_442785.1_7 Forward -164 -150 11.3077 0.228
NP_442967.1_9 Forward -345 -331 13.6676 0.254
NP_442866.1_1 Reverse -148 -167 9.63589 0.0879
NP_442866.1_1 Forward -158 -139 -6.78538 0.26
NP_440748.1_4 Reverse -154 -173 12.29 0.292
NP_441464.1_8 Forward -162 -148 10.816 0.178
NP_441939.1_3 Reverse -154 -173 13.6675 0.0883
NP_441939.1_3 Forward -161 -142 7.96426 0.186
NP_441494.1_6 Reverse -148 -161 10.7374 0.225
NP_442993.1_1 Reverse -365 -381 -0.629782 0.0783
NP_442993.1_1 Reverse -153 -169 -8.79125 0.176
NP_442993.1_1 Forward -162 -146 -11.1512 0.235
NP_440677.1_6 Forward -151 -132 8.55425 0.276
NP_442386.1_9 Reverse -152 -161 15.7322 0.0144
NP_442386.1_9 Forward -346 -337 8.2591 0.205
NP_442386.1_9 Forward -163 -154 6.39082 0.219
NP_442386.1_10 Reverse -334 -347 5.32916 0.262
NP_441340.1_5 Forward -161 -154 15.6737 0.0124
NP_441340.1_5 Reverse -154 -161 15.6737 0.0124
NP_442791.1_5 Reverse -152 -171 -6.68705 0.279
NP_442791.1_5 Reverse -145 -164 -9.53865 0.279
NP_442326.1_7 Reverse -94 -113 17.9932 0.264
NP_442240.1_2 Forward -161 -142 -7.17871 0.124
NP_442240.1_2 Forward -152 -133 -11.4069 0.137
NP_442240.1_2 Reverse -154 -173 -19.9617 0.295
NP_441134.1_6 Forward -174 -156 9.06482 0.263
NP_440211.1_1 Forward -187 -168 11.3067 0.236
NP_440586.1_8 Forward -161 -154 13.2151 0.026
NP_440586.1_8 Reverse -154 -161 13.2151 0.026
NP_442251.1_6 Forward -161 -154 15.2804 0.0124
NP_442251.1_6 Reverse -154 -161 15.2804 0.0124
NP_441262.1_3 Reverse -153 -160 14.7888 0.0223
NP_441262.1_3 Forward -162 -155 14.7888 0.0223
NP_440027.1_3 Reverse -143 -161 11.0314 0.159
NP_440027.1_3 Forward -222 -204 10.5398 0.173
NP_440027.1_3 Forward -172 -154 5.91824 0.232
NP_440027.1_3 Forward -355 -337 2.08335 0.293
NP_443051.1_1 Forward -163 -154 19.5676 0.00335
NP_443051.1_1 Reverse -152 -161 10.4228 0.00754
NP_439984.1_2 Reverse -161 -174 11.4257 0.275
NP_439937.1_8 Reverse -334 -353 2.0644 0.217
NP_439937.1_8 Forward -350 -331 0.392778 0.235
NP_439937.1_8 Forward -341 -322 -2.95047 0.264
NP_439937.1_9 Forward -163 -146 -15.7931 0.287
NP_442294.1_3 Forward -72 -58 11.897 0.297
NP_440439.1_1 Reverse -150 -163 18.8005 0.0105
NP_440439.1_1 Forward -165 -152 10.934 0.0339
NP_442239.1_8 Reverse -336 -355 8.75091 0.249
NP_440372.1_2 Forward -161 -154 16.3621 0.0124
NP_440372.1_2 Reverse -154 -161 16.3621 0.0124
NP_440316.1_10 Reverse -358 -368 5.97822 0.275
NP_441803.1_2 Reverse -148 -167 0.491109 0.251
NP_439977.1_5 Reverse -147 -166 5.40766 0.15
NP_441572.1_7 Forward -168 -149 6.98095 0.0785
NP_440267.1_2 Forward -167 -153 11.602 0.125
NP_440267.1_2 Forward -227 -213 5.70218 0.259
NP_442384.1_10 Reverse -153 -166 11.524 0.0348
NP_442384.1_10 Forward -162 -149 9.36073 0.054
NP_442114.1_4 Forward -162 -151 12.1534 0.107
NP_441980.1_8 Forward -342 -323 15.7324 0.227
NP_440364.1_10 Reverse -145 -164 14.3558 0.299
NP_441877.1_7 Forward -167 -148 5.60352 0.218
NP_441877.1_7 Forward -260 -241 1.76863 0.241
NP_441877.1_7 Forward -356 -337 0.392004 0.266
NP_441018.1_7 Reverse -149 -168 8.45592 0.246
NP_442790.1_4 Reverse -157 -176 -7.37537 0.153
NP_442790.1_4 Forward -171 -152 -14.7502 0.281
NP_442262.1_10 Forward -161 -154 14.1988 0.0123
NP_442262.1_10 Reverse -154 -161 14.1988 0.0123
NP_442262.1_10 Forward -321 -314 8.39725 0.234
NP_441689.1_5 Forward -164 -154 8.3377 0.132
NP_440163.1_10 Forward -274 -264 13.2547 0.13
NP_440344.1_10 Forward -169 -152 -8.0243 0.121
NP_440344.1_10 Reverse -146 -163 -9.3026 0.143
NP_440531.1_6 Forward -170 -151 8.94757 0.0842
NP_440189.1_2 Forward -170 -151 2.26107 0.268
NP_441335.1_8 Reverse -173 -192 11.0125 0.204
NP_441965.1_3 Forward -172 -153 2.16274 0.214
NP_441965.1_7 Forward -206 -187 15.1416 0.239
NP_441965.1_10 Forward -165 -149 5.46674 0.204
NP_441640.1_6 Reverse -84 -103 16.0274 0.0654
NP_442750.1_3 Reverse -211 -230 -2.26216 0.184
NP_442065.1_2 Forward -195 -182 17.7182 0.188
NP_440297.1_9 Forward -161 -151 -0.216628 0.282
NP_440297.1_9 Reverse -154 -164 -0.216628 0.282
NP_441896.1_3 Reverse -144 -163 30.5804 0.0000649
NP_440990.1_8 Reverse -166 -185 16.2241 0.232
NP_440894.1_10 Reverse -148 -167 2.65439 0.286
YP_680420.1_1 Reverse -151 -170 10.0292 0.244
NP_442129.1_6 Forward -21 -2 13.1708 0.29
NP_442067.1_4 Reverse -142 -161 14.0608 0.0784
NP_442067.1_4 Forward -356 -337 3.04771 0.289
NP_440999.1_9 Reverse -149 -163 16.1259 0.0216
NP_440999.1_9 Forward -166 -152 2.16287 0.154
NP_440888.1_2 Reverse -153 -167 18.1901 0.00261
NP_440888.1_2 Forward -162 -148 15.2402 0.0118
NP_440600.1_4 Forward -170 -152 0.609134 0.138
NP_440179.1_6 Forward -161 -142 2.75272 0.295
NP_440491.1_1 Reverse -150 -169 17.2475 0.0567
NP_440491.1_1 Reverse -327 -346 7.98904 0.253
NP_439969.1_1 Reverse -329 -348 -7.4737 0.297
NP_442033.1_10 Reverse -151 -170 -5.50708 0.179
NP_442033.1_10 Forward -155 -136 -11.4069 0.253
NP_441949.1_4 Reverse -248 -267 7.37428 0.237
NP_441543.1_2 Forward -161 -152 18.486 0.00236
NP_441543.1_2 Reverse -154 -163 15.9293 0.00518
NP_442845.1_2 Forward -168 -154 5.70279 0.225
NP_442845.1_2 Reverse -359 -373 4.71948 0.254
NP_441304.1_10 Forward -99 -90 13.2744 0.25
NP_441551.1_5 Reverse -149 -165 18.0524 0.038
NP_440982.1_1 Forward -360 -341 4.32522 0.294
NP_441469.1_8 Reverse -152 -161 16.126 0.00797
NP_441469.1_8 Forward -163 -154 6.5879 0.227
NP_441469.1_8 Forward -192 -183 5.60459 0.258
NP_442315.1_1 Reverse -325 -343 7.68896 0.239
NP_442315.1_2 Reverse -208 -220 11.4454 0.291
NP_443064.1_6 Reverse -153 -163 10.8217 0.13
NP_442578.1_7 Forward -161 -154 14.5921 0.026
NP_442578.1_7 Reverse -154 -161 14.5921 0.026
NP_440710.1_1 Forward -205 -187 -1.45582 0.18
NP_440710.1_1 Forward -170 -152 -6.4707 0.225
NP_441462.1_2 Reverse -153 -163 20.2362 0.000805
NP_441462.1_2 Forward -162 -152 11.5831 0.00406
NP_441462.1_2 Reverse -313 -323 -1.19994 0.291
NP_441621.1_7 Reverse -151 -165 4.22782 0.0934
NP_441621.1_7 Forward -155 -141 3.73617 0.102
NP_441621.1_7 Forward -164 -150 -3.34366 0.188
NP_441621.1_7 Forward -350 -336 -4.62196 0.238
NP_443062.1_1 Reverse -153 -171 11.5686 0.0962
NP_442204.1_1 Forward -166 -155 11.7601 0.0565
NP_442204.1_5 Reverse -143 -162 0.294447 0.267
NP_441560.1_3 Forward -360 -342 7.39397 0.28
NP_440544.1_5 Forward -302 -295 13.8024 0.28
NP_441351.1_8 Reverse -151 -170 4.03102 0.225
NP_440516.1_2 Reverse -147 -165 -1.45582 0.285
NP_440516.1_6 Reverse -262 -276 7.27547 0.281
NP_440516.1_8 Forward -162 -153 16.9127 0.00442
NP_440516.1_8 Reverse -153 -162 16.9127 0.00442
NP_442428.1_5 Forward -161 -154 15.8704 0.0124
NP_442428.1_5 Reverse -154 -161 15.8704 0.0124
NP_442859.1_6 Forward -269 -250 13.175 0.0659
NP_440673.1_2 Reverse -143 -162 12.5357 0.145
NP_440673.1_3 Forward -160 -153 12.4288 0.0426
NP_440673.1_3 Reverse -155 -162 12.4288 0.0426
NP_440673.1_3 Forward -372 -365 8.8889 0.206
NP_440673.1_7 Forward -173 -154 10.3242 0.111
NP_441052.1_2 Forward -162 -152 10.5014 0.0285
NP_441052.1_2 Reverse -153 -163 10.4031 0.0285
NP_441052.1_2 Forward -397 -387 2.43831 0.204
NP_442219.1_8 Reverse -149 -168 9.9065 0.219
NP_442219.1_8 Reverse -251 -270 9.42334 0.23
NP_442219.1_9 Forward -161 -152 8.35786 0.0681
NP_442219.1_9 Reverse -154 -163 8.25953 0.0681
NP_440436.1_4 Forward -161 -152 18.1905 0.00233
NP_440436.1_4 Reverse -154 -163 9.24241 0.0871
NP_441884.1_8 Reverse -152 -171 -1.27885 0.138
NP_441884.1_9 Reverse -150 -169 -13.1769 0.138
NP_441884.1_9 Forward -165 -146 -13.5702 0.138
NP_440314.1_9 Forward -373 -354 -10.3253 0.295
NP_441719.1_4 Forward -161 -154 16.3621 0.0124
NP_441719.1_4 Reverse -154 -161 16.3621 0.0124
NP_441733.1_10 Forward -165 -152 8.27909 0.14
NP_441004.1_1 Reverse -353 -372 -6.49039 0.188
NP_441004.1_1 Reverse -337 -356 -13.5702 0.259
NP_441004.1_1 Reverse -256 -275 -13.6686 0.26
NP_442366.1_3 Reverse -152 -170 -1.65248 0.216
NP_442873.1_9 Forward -272 -253 10.815 0.205
NP_440296.1_10 Reverse -150 -169 -5.9004 0.225
NP_441115.1_4 Reverse -152 -170 12.998 0.0921
NP_440328.1_4 Forward -168 -149 17.7974 0.0248
NP_443054.1_2 Forward -164 -150 10.226 0.0761
NP_441851.1_10 Reverse -152 -162 16.008 0.00552
NP_441851.1_10 Forward -163 -153 8.53483 0.114
NP_442208.1_5 Reverse -328 -347 -3.04881 0.252
NP_442622.1_1 Forward -163 -144 -11.7019 0.257
NP_442622.1_8 Reverse -153 -171 -8.73231 0.127
NP_442856.1_7 Forward -171 -152 -2.95047 0.239
NP_442515.1_1 Forward -163 -149 5.01447 0.107
NP_442515.1_1 Reverse -364 -378 -1.5737 0.257
NP_442515.1_1 Forward -340 -326 -2.65535 0.277
NP_440593.1_3 Forward -167 -148 -2.65548 0.227
NP_440593.1_9 Reverse -339 -353 8.94771 0.255
NP_440463.1_8 Reverse -335 -354 7.11264 0.267
NP_440165.1_5 Reverse -152 -171 -6.78538 0.246
NP_441046.1_2 Reverse -142 -161 2.65439 0.24
NP_440338.1_4 Forward -48 -29 5.99684 0.292
NP_441349.1_10 Forward -172 -153 7.86593 0.0288
NP_441409.1_6 Reverse -307 -326 -8.85033 0.176
NP_440432.1_9 Reverse -154 -169 5.3881 0.0555
NP_442843.1_1 Reverse -145 -164 -4.72043 0.239
NP_442843.1_4 Reverse -332 -350 22.8319 0.0332
NP_439960.1_10 Forward -169 -151 7.29564 0.138
NP_439960.1_10 Reverse -335 -353 3.06741 0.165
NP_440474.1_8 Forward -161 -147 9.04542 0.168
NP_440396.1_10 Forward -161 -145 10.6776 0.223
NP_440726.1_2 Forward -172 -153 0.884433 0.285
NP_440431.1_5 Forward -242 -223 8.25926 0.279
NP_440588.1_2 Forward -171 -152 -0.787193 0.154
NP_443047.1_7 Reverse -154 -173 9.14423 0.188
NP_441570.1_1 Reverse -153 -171 10.3439 0.00901
NP_441570.1_1 Reverse -213 -231 -10.9939 0.184
NP_441570.1_1 Reverse -330 -348 -14.1405 0.225
NP_441570.1_1 Forward -162 -144 -14.7305 0.227
NP_441078.1_4 Forward -162 -153 19.6659 0.0007
NP_441078.1_4 Reverse -153 -162 19.6659 0.0007
NP_441078.1_4 Forward -222 -213 -1.47524 0.266
NP_441078.1_4 Forward -351 -342 -1.86856 0.272
NP_442729.1_8 Reverse -149 -162 9.75405 0.125
NP_441663.1_8 Forward -168 -149 0.491109 0.219
NP_442348.1_2 Forward -271 -262 12.2911 0.218
NP_440707.1_6 Forward -170 -151 11.11 0.274
NP_442443.1_1 Reverse -319 -338 -5.31042 0.282
NP_440526.1_3 Forward -161 -150 2.41814 0.267
NP_440526.1_3 Reverse -154 -165 1.92649 0.267
NP_441432.1_8 Forward -163 -154 16.8143 0.00595
NP_441432.1_8 Reverse -152 -161 8.25953 0.0755
NP_442320.1_8 Reverse -147 -161 -0.492064 0.0817
NP_442320.1_8 Forward -168 -154 -3.54032 0.124
NP_441732.1_2 Forward -166 -150 4.28677 0.0141
NP_441732.1_2 Forward -343 -327 -17.2477 0.247
NP_440497.1_2 Reverse -319 -338 6.68596 0.249
NP_440321.1_1 Forward -104 -87 16.0668 0.27
NP_442003.1_9 Reverse -357 -376 3.53937 0.279
NP_440760.1_1 Forward -162 -143 5.40766 0.0124
NP_440760.1_1 Reverse -153 -172 -13.1769 0.0989
NP_442797.1_7 Reverse -334 -352 7.29564 0.198
NP_442797.1_7 Forward -346 -328 0.0191479 0.279
NP_442797.1_7 Reverse -335 -353 -1.35749 0.297
NP_441805.1_2 Reverse -133 -152 14.6508 0.0227
NP_439900.1_1 Reverse -46 -65 14.9458 0.215
NP_440913.1_1 Forward -164 -146 4.54237 0.265
NP_442407.1_10 Forward -342 -332 19.2529 0.259
NP_441072.1_2 Forward -173 -154 5.60432 0.296
NP_442489.1_7 Forward -162 -153 20.1576 0.000695
NP_442489.1_7 Reverse -153 -162 20.1576 0.000695
NP_442489.1_7 Reverse -213 -222 -1.86856 0.259
NP_442489.1_7 Forward -222 -213 -1.96689 0.28
NP_440757.1_7 Reverse -334 -352 1.39578 0.269
NP_442079.1_7 Forward -161 -142 4.71934 0.187
NP_440559.1_1 Forward -161 -152 8.75118 0.0586
NP_440559.1_1 Reverse -154 -163 8.65285 0.0586
NP_441659.2_8 Reverse -153 -163 20.9245 0.000805
NP_441659.2_8 Forward -162 -152 11.9764 0.0147
NP_441022.1_1 Reverse -15 -24 11.6421 0.274
NP_440363.1_8 Reverse -145 -164 13.0775 0.288
NP_442913.1_10 Reverse -204 -223 -0.590531 0.161
NP_441040.1_2 Reverse -158 -177 -16.4218 0.296
NP_442346.1_5 Forward -163 -153 16.303 0.00248
NP_442346.1_5 Reverse -152 -162 9.02648 0.118
NP_442346.1_10 Reverse -171 -190 3.44104 0.194
NP_440545.1_3 Forward -166 -149 7.217 0.0518
NP_440545.1_3 Reverse -149 -166 0.628827 0.135
NP_441629.1_3 Forward -346 -327 0.490334 0.235
NP_441923.1_6 Reverse -145 -159 7.66941 0.298
NP_440459.1_2 Forward -171 -154 11.8386 0.166
NP_440459.1_2 Forward -117 -100 7.512 0.288
NP_441653.1_6 Reverse -141 -155 20.0591 0.272
NP_440010.1_4 Forward -355 -336 -1.27961 0.267
NP_440010.1_10 Reverse -353 -372 8.35759 0.216
NP_440010.1_10 Reverse -334 -353 4.62101 0.244
NP_442828.1_7 Reverse -341 -360 3.34271 0.207
NP_441888.1_7 Forward -167 -153 2.5562 0.225
NP_441948.1_4 Forward -169 -151 -1.35749 0.146
NP_441833.1_4 Forward -161 -154 15.9687 0.0124
NP_441833.1_4 Reverse -154 -161 15.9687 0.0124
NP_441895.1_2 Forward -397 -378 -26.9432 0.275
NP_441112.1_6 Forward -172 -153 -4.42544 0.297
NP_442162.1_9 Forward -161 -154 16.2637 0.0124
NP_442162.1_9 Reverse -154 -161 16.2637 0.0124
NP_440671.1_2 Reverse -156 -170 19.0758 0.0965
NP_440671.1_4 Forward -168 -154 7.76774 0.208
NP_440671.1_4 Forward -360 -346 7.07942 0.227
NP_440671.1_4 Reverse -240 -254 5.40779 0.283
NP_442821.1_2 Forward -367 -348 1.27776 0.248
NP_442140.1_3 Forward -161 -151 17.4829 0.0159
NP_442140.1_3 Reverse -154 -164 4.69992 0.238
NP_441671.1_1 Reverse -157 -176 1.96607 0.263
NP_440875.1_9 Reverse -155 -165 15.867 0.0233
NP_440875.1_9 Forward -160 -150 15.2829 0.0295
NP_442547.1_7 Forward -355 -336 14.6025 0.171
NP_441813.1_5 Forward -164 -154 18.1713 0.00743
NP_441813.1_5 Reverse -151 -161 10.0098 0.0208
NP_441813.1_7 Forward -336 -322 11.2087 0.23
NP_440590.1_4 Reverse -154 -167 12.704 0.013
NP_440590.1_4 Forward -161 -148 12.3107 0.0148
NP_440567.1_1 Forward -161 -147 12.291 0.0241
NP_440567.1_1 Reverse -154 -168 5.60446 0.1
NP_442497.1_10 Reverse -154 -163 17.601 0.00813
NP_442497.1_10 Forward -161 -152 10.4228 0.0087
NP_440821.1_4 Reverse -151 -161 18.7612 0.00422
NP_440821.1_4 Forward -164 -154 2.24165 0.131
NP_441239.1_9 Reverse -151 -163 16.0669 0.0175
NP_441239.1_9 Forward -164 -152 15.5753 0.0186
NP_441239.1_9 Reverse -180 -192 5.44718 0.221
NP_441892.1_1 Forward -171 -154 13.9035 0.034
NP_440665.1_1 Forward -159 -140 -15.0452 0.264
NP_442193.1_8 Reverse -150 -169 10.3234 0.286
NP_442643.1_3 Forward -158 -139 -5.11376 0.261
NP_441874.1_1 Reverse -361 -375 9.14437 0.277
NP_442216.1_4 Reverse -89 -97 8.08217 0.255
NP_440949.1_7 Forward -176 -157 9.24175 0.264
NP_442138.1_10 Reverse -153 -172 -0.787193 0.162
NP_440546.1_4 Reverse -153 -163 13.5365 0.0459
NP_440546.1_4 Forward -162 -152 11.8882 0.0679
NP_440546.1_6 Reverse -143 -162 13.7658 0.182
NP_440546.1_7 Reverse -160 -170 17.0896 0.234
NP_441230.1_5 Forward -167 -148 10.9142 0.0951
NP_441230.1_8 Reverse -325 -344 17.994 0.135
NP_440462.1_6 Forward -164 -154 18.7612 0.00454
NP_440462.1_6 Reverse -151 -161 17.9746 0.00578
NP_440462.1_6 Forward -324 -314 3.22496 0.255
NP_441184.1_3 Reverse -145 -164 3.04771 0.293
NP_442340.1_3 Reverse -329 -348 -9.14533 0.271
NP_440868.1_4 Reverse -149 -161 21.5735 0.00629
NP_440868.1_4 Reverse -309 -321 3.77555 0.133
NP_440868.1_4 Forward -166 -154 1.02229 0.193
NP_441497.1_3 Forward -391 -372 -11.7019 0.294
NP_441249.1_8 Reverse -44 -63 11.7008 0.16
NP_441084.1_6 Forward -164 -150 11.768 0.188
NP_440696.1_3 Reverse -149 -167 -1.16082 0.251
NP_440696.1_3 Reverse -153 -171 -1.65248 0.264
NP_440696.1_3 Reverse -203 -221 -3.81576 0.29
NP_442039.1_4 Forward -161 -154 15.1821 0.0124
NP_442039.1_4 Reverse -154 -161 15.1821 0.0124
NP_442039.1_7 Reverse -338 -348 11.5831 0.257
NP_441811.1_8 Reverse -147 -161 10.6193 0.219
NP_442409.1_6 Reverse -158 -177 15.6341 0.18
NP_441926.1_3 Reverse -153 -169 7.13836 0.17
NP_442837.1_3 Forward -161 -154 15.7721 0.0124
NP_442837.1_3 Reverse -154 -161 15.7721 0.0124
NP_440160.1_9 Reverse -153 -172 9.53756 0.239
NP_442053.1_1 Forward -162 -153 18.3876 0.0007
NP_442053.1_1 Reverse -153 -162 18.3876 0.0007
NP_440505.1_3 Forward -164 -154 17.188 0.00332
NP_440505.1_3 Reverse -151 -161 14.1397 0.0235
NP_440505.1_3 Forward -224 -214 7.05986 0.165
NP_441959.1_9 Reverse -350 -369 19.8623 0.0584
NP_441102.1_1 Reverse -346 -365 2.85105 0.299
NP_442532.1_7 Forward -162 -148 15.8309 0.0587
NP_442532.1_7 Reverse -324 -338 2.85119 0.22
NP_440914.1_1 Reverse -153 -163 16.3248 0.00196
NP_440914.1_1 Forward -162 -152 8.6151 0.186
NP_440914.1_1 Forward -255 -245 7.05364 0.254
NP_441011.1_8 Forward -161 -152 16.9127 0.00602
NP_441011.1_8 Reverse -154 -163 16.6177 0.00602
NP_442533.1_1 Reverse -327 -346 3.44104 0.0927
NP_442533.1_6 Forward -162 -153 17.2076 0.00137
NP_442533.1_6 Reverse -153 -162 17.2076 0.00137
NP_442533.1_6 Forward -351 -342 4.52295 0.179
NP_442533.1_6 Forward -374 -365 2.06468 0.275
NP_442232.1_3 Reverse -145 -164 -13.3736 0.282
NP_441482.1_7 Forward -168 -154 -2.36035 0.0963
NP_441482.1_7 Reverse -147 -161 -8.65353 0.193
NP_439944.1_9 Forward -161 -151 10.4031 0.0887
NP_439944.1_9 Reverse -154 -164 9.12481 0.1
NP_442202.1_10 Forward -346 -332 6.29277 0.255
NP_440116.1_8 Reverse -154 -173 -9.44032 0.278
NP_441527.1_4 Forward -118 -99 -3.58137 0.17
NP_441527.1_4 Forward -129 -110 -5.96867 0.212
NP_441527.1_4 Forward -112 -93 -12.7486 0.293
NP_440115.1_6 Reverse -150 -160 9.61647 0.115
NP_440115.1_6 Forward -165 -155 4.89658 0.28
NP_440007.1_9 Forward -166 -152 2.35953 0.281
NP_440572.1_8 Reverse -214 -233 14.8474 0.299
NP_441602.1_3 Reverse -148 -167 17.994 0.0354
NP_441602.1_3 Reverse -331 -350 -1.67217 0.23
NP_441972.1_3 Reverse -340 -359 11.1109 0.284
NP_441106.1_1 Forward -163 -154 18.486 0.0028
NP_441106.1_1 Reverse -152 -161 18.191 0.0028
NP_441106.1_7 Forward -330 -311 18.5831 0.205
NP_441106.1_9 Forward -25 -15 15.5163 0.289
NP_439903.1_6 Forward -165 -146 4.91521 0.188
NP_442306.1_10 Forward -167 -148 -9.34199 0.11
NP_441286.1_1 Forward -163 -151 5.34885 0.0259
NP_441286.1_1 Reverse -152 -164 -3.59927 0.145
NP_440670.1_8 Forward -162 -153 18.3876 0.000699
NP_440670.1_8 Reverse -153 -162 18.3876 0.000699
NP_440670.1_8 Reverse -313 -322 5.60459 0.149
NP_441479.1_4 Reverse -142 -161 8.45592 0.168
NP_440886.1_7 Reverse -152 -162 17.7774 0.0011
NP_440886.1_7 Forward -163 -153 8.04271 0.0805
NP_440886.1_7 Forward -352 -342 4.69947 0.22
NP_440828.1_4 Forward -163 -144 -4.03287 0.246
NP_442614.1_2 Forward -162 -148 6.6861 0.287
NP_441399.1_10 Forward -351 -332 16.9124 0.209
NP_442072.1_9 Reverse -152 -170 -3.42244 0.0355
NP_442072.1_9 Forward -163 -145 -23.187 0.284
NP_440907.2_8 Forward -161 -151 17.4824 0.00685
NP_440907.2_8 Reverse -154 -164 9.616 0.103
NP_442264.1_2 Reverse -326 -343 8.00365 0.223
NP_442264.1_2 Reverse -143 -160 4.85706 0.292
NP_441021.1_8 Forward -167 -149 11.9172 0.11
NP_441463.1_6 Forward -224 -210 6.3193 0.274
NP_441626.1_2 Forward -161 -154 15.7721 0.0124
NP_441626.1_2 Reverse -154 -161 15.7721 0.0124
NP_442365.1_7 Forward -166 -147 -4.72043 0.25
NP_440107.1_5 Forward -352 -333 6.4893 0.139
NP_442794.1_5 Reverse -150 -164 12.1926 0.275
NP_442615.1_1 Reverse -144 -162 -4.60241 0.19
NP_441962.1_4 Forward -167 -148 -14.6519 0.291
NP_440387.1_1 Forward -162 -146 12.3499 0.0125
NP_440855.1_2 Forward -193 -174 16.4199 0.263
NP_441431.1_2 Reverse -150 -164 11.1104 0.146
NP_441431.1_2 Forward -165 -151 10.9137 0.15
NP_441431.1_2 Forward -172 -158 10.422 0.159
NP_441431.1_2 Forward -156 -142 9.04542 0.198
NP_441431.1_2 Forward -348 -334 7.47213 0.241
NP_441488.1_7 Reverse -147 -166 0.294447 0.298
NP_441488.1_8 Forward -167 -153 7.86545 0.221
NP_441836.1_2 Reverse -147 -166 -0.295539 0.212
NP_440634.1_10 Forward -339 -320 8.75009 0.221
NP_440634.1_10 Forward -333 -314 4.03023 0.3
NP_441993.1_1 Reverse -153 -172 13.1543 0.0889
NP_441993.1_1 Reverse -160 -179 9.64582 0.135
NP_441993.1_1 Reverse -336 -355 2.33652 0.26
NP_441993.1_1 Forward -162 -143 2.23906 0.261
NP_441993.1_1 Reverse -240 -259 1.75177 0.27
NP_440114.1_10 Forward -162 -148 14.7492 0.0346
NP_440114.1_10 Reverse -213 -227 11.6026 0.107
NP_440114.1_10 Reverse -153 -167 10.9143 0.13
NP_442090.1_10 Reverse -161 -174 10.5407 0.284
NP_442323.1_7 Forward -167 -148 6.1935 0.199
NP_441156.1_1 Forward -111 -92 12.8808 0.208
NP_440766.1_4 Forward -166 -152 8.06273 0.0871
NP_441979.1_5 Forward -168 -149 -12.1936 0.228
NP_442743.1_4 Reverse -154 -173 -7.27704 0.279
NP_441246.1_7 Reverse -346 -365 7.37428 0.199
NP_442867.1_8 Forward -353 -334 5.60432 0.276
NP_440457.1_1 Forward -166 -154 6.43049 0.121
NP_440457.1_1 Reverse -149 -161 0.137309 0.25
NP_440798.1_6 Forward -161 -148 3.5592 0.15
NP_442680.1_5 Reverse -54 -73 4.66368 0.227
NP_441984.1_3 Forward -179 -161 8.47561 0.229
NP_441984.1_3 Reverse -149 -167 8.18062 0.234
NP_441436.1_2 Forward -112 -93 0.294447 0.277
NP_441436.1_8 Reverse -341 -360 7.66927 0.293
NP_442509.1_5 Forward -359 -342 20.1959 0.0487
NP_442509.1_9 Forward -162 -152 16.2041 0.00739
NP_442509.1_9 Reverse -153 -163 8.04271 0.192
NP_441440.1_8 Reverse -333 -346 18.7022 0.138
NP_440554.1_4 Reverse -154 -164 17.9746 0.0131
NP_440554.1_4 Forward -161 -151 13.943 0.0218
NP_441885.1_5 Forward -162 -152 11.4848 0.00668
NP_441885.1_5 Reverse -153 -163 11.3864 0.00668
NP_441885.1_5 Forward -351 -341 -0.314959 0.195
NP_441885.1_5 Forward -222 -212 -0.314959 0.195
NP_440478.1_10 Reverse -151 -165 7.86607 0.257
NP_441428.1_8 Forward -161 -142 8.94757 0.206
NP_441428.1_8 Reverse -145 -164 2.75272 0.267
NP_442341.1_7 Forward -163 -149 9.43936 0.0751
NP_442341.1_7 Reverse -152 -166 3.63784 0.217
NP_442341.1_9 Forward -150 -136 9.14375 0.156
NP_441756.1_5 Reverse -149 -168 6.29264 0.175
NP_441756.1_5 Forward -354 -335 -2.65548 0.28
NP_442395.2_4 Reverse -152 -171 3.9319 0.19
NP_442534.1_7 Forward -170 -151 7.96426 0.26
NP_440409.1_1 Reverse -145 -164 1.86774 0.18
NP_440409.1_1 Forward -170 -151 -1.47551 0.233
NP_440423.1_6 Forward -170 -151 -13.7669 0.224
NP_440423.1_6 Reverse -145 -164 -14.2585 0.224
NP_443000.1_7 Forward -164 -154 20.3345 0.00223
NP_443000.1_7 Reverse -151 -161 2.04498 0.226
NP_441842.1_10 Reverse -146 -160 8.65272 0.213
NP_440275.1_3 Reverse -151 -161 17.9746 0.0082
NP_440275.1_3 Forward -164 -154 16.1063 0.0155
NP_440091.1_1 Reverse -149 -161 10.1671 0.0498
NP_440679.1_10 Forward -352 -333 -21.83 0.3
NP_443010.1_10 Forward -225 -208 3.73713 0.252
NP_441359.1_5 Reverse -150 -169 6.29264 0.188
NP_442451.1_2 Reverse -145 -164 11.1109 0.0648
NP_442451.1_2 Forward -170 -151 -0.000545616 0.153
NP_439962.1_4 Forward -353 -334 1.76941 0.197
NP_439962.1_4 Forward -161 -142 -5.31042 0.278
NP_439962.1_4 Reverse -145 -164 -7.08038 0.287
NP_439962.1_4 Forward -350 -331 -8.06369 0.292
NP_439962.1_4 Forward -170 -151 -8.752 0.298
NP_440175.1_4 Reverse -151 -170 -3.24547 0.122
NP_440175.1_7 Reverse -149 -167 9.75348 0.276
NP_440149.1_8 Forward -162 -143 7.07928 0.0628
NP_440149.1_8 Reverse -153 -172 -7.96535 0.296
NP_440149.1_10 Reverse -153 -172 -1.67217 0.203
NP_441105.1_3 Forward -173 -154 7.86593 0.0513
NP_440216.1_1 Reverse -153 -167 17.7975 0.00129
NP_440216.1_1 Forward -162 -148 -1.27871 0.0303
NP_440216.1_1 Reverse -313 -327 -4.4253 0.111
NP_440172.1_1 Reverse -153 -163 17.5813 0.00421
NP_440172.1_1 Forward -162 -152 8.73149 0.0586
NP_442015.1_10 Forward -166 -153 4.93583 0.156
NP_442015.1_10 Reverse -149 -162 3.06754 0.185
NP_442015.1_10 Reverse -338 -351 -1.16069 0.297
NP_441226.1_7 Forward -161 -154 14.4934 0.0123
NP_441226.1_7 Reverse -154 -161 14.4934 0.0123
NP_441226.1_7 Forward -373 -366 8.59356 0.197
NP_441226.1_7 Forward -359 -352 5.34865 0.289
NP_441111.1_7 Forward -161 -153 18.7023 0.00294
NP_441111.1_7 Reverse -154 -162 18.7023 0.00294
NP_441766.1_2 Forward -162 -153 17.5026 0.00297
NP_441766.1_2 Reverse -153 -162 17.5026 0.00297
NP_441766.1_9 Reverse -337 -356 -1.96717 0.276
NP_441766.1_9 Reverse -145 -164 -2.45882 0.281
NP_442417.1_5 Reverse -153 -167 6.3911 0.222
NP_442252.1_8 Forward -362 -343 22.3206 0.0836
NP_440416.1_1 Reverse -153 -172 -13.7669 0.283
NP_440416.1_9 Reverse -335 -354 -9.047 0.125
NP_440416.1_9 Reverse -334 -353 -11.9969 0.155
NP_440416.1_9 Forward -169 -150 -16.8151 0.223
NP_443052.1_9 Forward -353 -334 -4.81876 0.261
NP_443052.1_9 Forward -157 -138 -5.60541 0.271
NP_443052.1_9 Forward -346 -327 -5.9004 0.274
NP_442116.1_6 Forward -138 -121 12.1796 0.181
NP_442154.1_1 Reverse -334 -352 -17.8771 0.272
NP_442154.1_1 Reverse -174 -192 -19.1554 0.291
NP_440261.1_5 Forward -161 -148 6.80412 0.0316
NP_440261.1_5 Reverse -154 -167 -2.73398 0.0924
NP_440261.1_5 Forward -353 -340 -6.2739 0.199
NP_440988.1_10 Forward -224 -210 3.44663 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGCCCCATCCACAATGAGGGTATATTCCCGTCGCCAAAGTCCCAACCCGGCGGCCCCCAAGGCGGCCACAATCATCAGCAGATCGACATCAAATTCTTTTTCTTCAAAGAGGGTTGTTAATCCCTCACGGGCATTGTCAAATCCACCAATCACATAGGCCGCTGTTAGGACAAAAAAGGCAATTCCCAACCAGCCCAAGTTAAGCATCTGCCAGCCCAGAAAGACCAGCCCGCCACAGGCGATCGCCGCCACTGCATCGGGATGATCTTTGAAAAGGTTAGAAAATCGAAAGGCAGAAGAAGGGGGAGTTACAACCATGCTTTTTAACTTGGATTTTTACCTTCTCAGCCTAAACCTTAACATTAGTGTCAATGTCAAGGTTTTGAGTAAACTAAAGGG

CDS

ATGAAGACTAATCACTTAACGATTAAAGAACTCACAGATGCAGTGGGAGGTGGCGTTACGCCTCGCATGGTGCGCCATTACCACACCCTGGGATTGCTTCCCCCCGTTCAACGCTCAGAGGGCAACTACCGCCTTTATACTCAGCAGGACGTACAACGGCTCCAACGAGTCATTGCCCTCAAACAGCAGGGCTTTCAGTTGTCTCATATTCGGCAACTGCTGGATAGCCATTCTGAAGAGAGCCTTGATCCCACCCTAATGGTGCAGTTGCAACAGCAATATCAGGCTGTGATTCAGCAGATTACTCGACTCCGCCAAACCGCATCTGCTTTAGAAGGATTACTGGGACGCGACCAGAGTTGCCAGATTACCCAAGCGGAAGCTCTGGCCCAACTGAAACAGCTTGATGTGGATGTCCAGGAGGGGTTAGGAAAACTCGATCAGTTGTGGACGAACCTAGATGCGGAGACAACAACTCATCCAGAAGCCTTTCAGGAATCCCTCAAACACCTGCTACCGGATTTATCGGCTTACTCTGAAATTACCATTCACTTACTACATCAATTAGTGCTGGCCTGTGGTGATGTTAGCTTGGTAAACGCCGTTCGATTGAGTCAGGGAGCGATCGCCTCGGCACGAGATGCACTGAAAGCAGGGTGTCCAGTCGTCACCGATGTTCCGGTTGTGGCTGCGGCTCTTGATCAAACTCGGTTAGCTCATTTAGGATGTACGGTTAAAACGCTGATTGACGACCCTCACATCACAGGGCTTAGGGAAGCCGAGCAAGCTTTTTGGCACCATGACCATTGGCAACAGCGGTTACAACAGATTCCCCAAGGATGTGTGCTGGCGATCGGCTATGCCCCTTCTGTTTTACTCACTGCCTGTAAGCTGATAGAGCAACAACATATTCAGCCGGCTCTTGTGATCGGAATGCCGATCGGTTTTAGTCATGCTCCGGGGGCAAAACGACGACTGATGACCAGTCCCATTCCCCATATCACCATTCAGGGGAGCCTCGGTGGAGGACTTCTAGCCGCAGTAACGCTAAACGCTTTAGTGGAAACATTGATTGCAAAGCCAGATTGCCACTGCTATCTCACTTGTCTTTAG

Protein

MKTNHLTIKELTDAVGGGVTPRMVRHYHTLGLLPPVQRSEGNYRLYTQQDVQRLQRVIALKQQGFQLSHIRQLLDSHSEESLDPTLMVQLQQQYQAVIQQITRLRQTASALEGLLGRDQSCQITQAEALAQLKQLDVDVQEGLGKLDQLWTNLDAETTTHPEAFQESLKHLLPDLSAYSEITIHLLHQLVLACGDVSLVNAVRLSQGAIASARDALKAGCPVVTDVPVVAAALDQTRLAHLGCTVKTLIDDPHITGLREAEQAFWHHDHWQQRLQQIPQGCVLAIGYAPSVLLTACKLIEQQHIQPALVIGMPIGFSHAPGAKRRLMTSPIPHITIQGSLGGGLLAAVTLNALVETLIAKPDCHCYLTCL