Your browser is old and dusty. Try Google Chrome!

Details for sll0788

ORF sll0788
Accession NP_442639.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -379 -393 0.589577 0.205
NP_441453.1_4 Forward -277 -269 5.32929 0.147
NP_440226.1_1 Forward -277 -258 2.0644 0.278
NP_441465.1_8 Reverse -268 -286 5.42735 0.289
NP_440259.1_4 Forward -128 -114 18.1801 0.0912
NP_441745.1_3 Forward -396 -377 15.5349 0.215
NP_442975.1_10 Forward -180 -166 6.88214 0.156
NP_442861.1_4 Forward -60 -41 4.22689 0.253
NP_441476.1_10 Reverse -55 -68 17.1289 0.212
NP_441620.1_3 Reverse -160 -179 16.0274 0.227
NP_441594.1_6 Reverse -37 -56 0.982764 0.276
NP_441925.1_4 Reverse -234 -253 -17.6025 0.297
NP_439957.1_10 Reverse -112 -122 15.9097 0.278
NP_441434.1_7 Forward -213 -199 4.03116 0.225
NP_442889.1_8 Reverse -354 -368 3.93223 0.27
NP_440331.1_5 Reverse -153 -172 -17.7001 0.295
NP_440851.1_6 Forward -245 -228 2.98877 0.288
NP_441486.1_1 Forward -204 -190 -5.9986 0.272
NP_443017.1_1 Forward -97 -78 16.5041 0.191
NP_441014.1_10 Reverse -362 -381 -0.787962 0.253
NP_441014.1_10 Forward -383 -364 -1.67294 0.263
NP_443018.1_3 Forward -321 -314 5.34899 0.212
NP_440376.1_1 Reverse -167 -176 5.50626 0.131
NP_442687.1_7 Reverse -205 -215 13.0581 0.0591
NP_442687.1_7 Forward -373 -363 10.8948 0.0994
NP_440642.1_10 Forward -128 -114 12.782 0.133
NP_440642.1_10 Forward -119 -105 6.68548 0.225
NP_442658.1_1 Reverse -231 -241 5.09279 0.284
NP_440141.1_8 Reverse -364 -383 4.03102 0.294
NP_440184.1_9 Reverse -241 -260 6.29264 0.17
NP_439968.1_8 Forward -397 -381 19.7247 0.0485
NP_441958.1_5 Reverse -267 -277 -1.59326 0.246
NP_442536.1_4 Reverse -317 -335 20.767 0.027
NP_442051.1_5 Reverse -370 -389 10.1275 0.29
NP_442210.1_1 Forward -368 -349 3.73603 0.212
NP_440475.1_5 Reverse -104 -123 19.174 0.0274
NP_441294.1_1 Reverse -241 -260 4.32602 0.279
NP_441294.1_7 Reverse -249 -263 8.57871 0.294
NP_441646.1_1 Reverse -306 -325 -1.37718 0.284
NP_442566.1_7 Forward -56 -37 19.174 0.104
NP_441916.1_7 Reverse -167 -177 11.1898 0.0261
NP_440206.1_4 Forward -392 -373 2.45694 0.289
NP_441554.1_4 Reverse -139 -153 15.2706 0.22
NP_440260.1_8 Forward -245 -227 -5.88071 0.279
NP_442281.1_1 Reverse -187 -201 2.5556 0.263
NP_442281.1_1 Reverse -315 -329 2.45727 0.266
NP_440498.1_5 Forward -248 -230 21.0343 0.044
NP_441644.1_6 Forward -393 -383 5.97777 0.172
NP_441644.1_6 Forward -277 -267 4.60114 0.233
NP_442215.1_2 Forward -145 -129 -6.03799 0.263
NP_440929.1_8 Forward -277 -268 4.0313 0.193
NP_442142.1_4 Forward -396 -383 6.11523 0.173
NP_442142.1_4 Reverse -381 -394 3.55864 0.251
NP_440015.1_9 Forward -372 -354 1.78911 0.23
NP_441015.1_8 Reverse -103 -122 3.04771 0.272
NP_441096.1_5 Forward -155 -137 15.358 0.297
NP_441764.1_8 Reverse -43 -53 11.7892 0.284
NP_441911.1_10 Reverse -111 -130 19.7422 0.0263
NP_441911.1_10 Forward -28 -9 6.82367 0.291
NP_442808.1_1 Reverse -231 -241 11.4843 0.0481
NP_442808.1_1 Reverse -252 -262 4.01116 0.212
NP_440346.1_7 Reverse -136 -155 8.45592 0.233
NP_440346.1_7 Reverse -147 -166 5.80098 0.29
NP_441114.1_3 Forward -327 -318 8.35786 0.231
NP_441114.1_3 Forward -213 -204 7.27622 0.247
NP_441114.1_3 Forward -199 -190 6.29291 0.285
NP_441036.1_8 Reverse -267 -277 7.84651 0.183
NP_441590.1_4 Reverse -233 -252 6.29183 0.26
NP_440690.1_3 Reverse -317 -336 16.4207 0.169
NP_442998.1_10 Forward -213 -206 10.4622 0.0819
NP_440899.1_8 Forward -129 -110 -9.44032 0.262
NP_440456.1_7 Forward -335 -321 10.816 0.285
NP_442452.1_8 Reverse -240 -254 14.5519 0.273
NP_440748.1_5 Reverse -375 -394 4.42435 0.198
NP_440306.1_8 Reverse -214 -233 1.27698 0.204
NP_442386.1_9 Reverse -232 -241 7.07914 0.219
NP_441340.1_5 Reverse -269 -276 4.07068 0.239
NP_441340.1_9 Reverse -121 -131 9.02648 0.256
NP_441262.1_3 Reverse -268 -275 5.44732 0.11
NP_440027.1_3 Reverse -233 -251 9.45814 0.184
NP_443051.1_1 Reverse -267 -276 5.11294 0.0981
NP_443038.1_10 Forward -136 -117 12.585 0.277
NP_439937.1_8 Forward -350 -331 -2.65548 0.261
NP_440372.1_2 Reverse -269 -276 4.36568 0.205
NP_440171.1_3 Forward -245 -226 1.17943 0.294
NP_442262.1_2 Reverse -149 -168 14.7609 0.265
NP_442262.1_10 Forward -321 -314 7.6106 0.274
NP_441689.1_5 Forward -279 -269 8.3377 0.132
NP_441060.1_4 Reverse -292 -310 10.7372 0.171
NP_442641.1_1 Reverse -228 -247 41.3968 0.000000208
NP_442641.1_3 Reverse -380 -399 40.8068 0.000000315
NP_442529.1_4 Reverse -259 -278 13.4708 0.175
NP_440350.1_5 Forward -138 -119 11.7992 0.134
NP_440350.1_5 Forward -132 -113 0.392778 0.162
NP_440350.1_5 Forward -120 -101 -3.63879 0.261
NP_440350.1_5 Forward -150 -131 -5.80207 0.292
NP_439926.1_7 Reverse -103 -121 7.78729 0.204
NP_441778.1_8 Forward -393 -379 18.4851 0.178
NP_442892.1_1 Reverse -193 -212 4.12936 0.282
NP_442892.1_9 Forward -56 -42 16.7152 0.235
NP_442225.1_10 Forward -211 -192 19.3698 0.0453
NP_442225.1_10 Forward -325 -306 11.995 0.203
NP_442033.1_10 Reverse -241 -260 -11.2103 0.251
NP_440575.1_4 Reverse -279 -298 16.712 0.115
NP_441543.1_2 Reverse -364 -373 4.22796 0.267
NP_442845.1_2 Forward -345 -331 5.70279 0.225
NP_442845.1_2 Reverse -378 -392 4.52282 0.258
NP_440220.1_4 Forward -395 -376 -3.14789 0.285
NP_441462.1_2 Reverse -167 -177 -0.806614 0.254
NP_443062.1_1 Reverse -268 -286 8.05839 0.16
NP_443062.1_1 Forward -277 -259 6.01073 0.211
NP_443062.1_1 Forward -165 -147 4.45062 0.26
NP_440504.1_5 Reverse -171 -189 11.4255 0.153
NP_440544.1_5 Forward -119 -112 13.8024 0.28
NP_442428.1_8 Forward -246 -227 0.491109 0.239
NP_440783.1_5 Reverse -379 -398 -3.04881 0.273
NP_441719.1_6 Reverse -23 -42 6.98015 0.269
NP_442873.1_3 Forward -202 -183 3.44025 0.287
NP_440682.1_4 Reverse -188 -207 40.5118 0.000000306
NP_440593.1_3 Forward -206 -187 -3.24547 0.233
NP_441409.1_6 Forward -67 -48 -7.67036 0.154
NP_441394.1_10 Reverse -16 -34 9.35981 0.263
NP_441062.1_4 Reverse -240 -258 14.4738 0.235
NP_442843.1_1 Reverse -314 -333 -6.29373 0.244
NP_440431.1_4 Reverse -117 -136 12.7478 0.038
NP_441031.1_8 Forward -277 -258 3.34271 0.18
NP_441078.1_4 Forward -176 -167 -1.08191 0.222
NP_442348.1_2 Forward -243 -234 8.94785 0.28
NP_442443.1_1 Forward -249 -230 4.42435 0.157
NP_442320.1_2 Reverse -265 -284 13.5691 0.26
NP_442447.1_1 Reverse -115 -134 6.78429 0.258
NP_440497.1_6 Forward -246 -227 -7.08038 0.269
NP_441131.1_6 Reverse -189 -207 4.54237 0.219
NP_440199.1_10 Reverse -94 -104 6.46988 0.299
NP_440281.1_4 Reverse -324 -343 16.5182 0.275
NP_442489.1_2 Forward -377 -358 1.96607 0.278
NP_442489.1_7 Reverse -167 -176 -1.47524 0.203
NP_442763.1_8 Forward -257 -238 3.83436 0.182
NP_441659.2_8 Forward -277 -267 2.63497 0.195
NP_440786.1_9 Forward -281 -262 12.7825 0.288
NP_442346.1_5 Reverse -205 -215 4.3066 0.291
NP_441888.1_7 Reverse -329 -343 1.96621 0.232
NP_443040.1_1 Reverse -114 -128 11.7301 0.276
NP_441329.1_6 Reverse -112 -131 2.81659 0.217
NP_441329.1_6 Reverse -127 -146 0.0473228 0.266
NP_440912.1_3 Forward -131 -112 8.06178 0.286
NP_442060.1_10 Reverse -371 -390 8.65258 0.269
NP_442162.1_9 Reverse -269 -276 3.4807 0.246
NP_442162.1_9 Forward -276 -269 3.38237 0.276
NP_441973.1_1 Reverse -327 -342 0.27489 0.235
NP_441813.1_5 Forward -279 -269 2.43831 0.187
NP_442028.1_1 Forward -130 -117 11.1388 0.251
NP_442254.1_6 Reverse -224 -243 15.5357 0.133
NP_441239.1_9 Forward -279 -267 4.16888 0.26
NP_442639.1_1 Forward -67 -48 27.3346 0.000172
NP_440624.1_6 Reverse -9 -27 3.95163 0.246
NP_441892.1_1 Reverse -183 -200 0.92382 0.159
NP_442669.1_1 Reverse -69 -88 11.7992 0.0195
NP_441119.1_1 Forward -170 -151 2.0644 0.207
NP_440462.1_6 Forward -279 -269 3.71661 0.23
NP_440696.1_3 Forward -252 -234 5.13236 0.198
NP_441811.1_1 Reverse -335 -354 4.81767 0.28
NP_442679.1_1 Reverse -107 -126 3.83436 0.147
NP_442679.1_1 Reverse -109 -128 2.45773 0.164
NP_442679.1_1 Reverse -108 -127 2.16274 0.167
NP_442679.1_1 Reverse -110 -129 -5.40875 0.293
NP_442679.1_2 Forward -38 -19 6.78429 0.279
NP_442360.1_5 Forward -240 -230 13.7464 0.258
NP_441011.1_8 Reverse -269 -278 5.01461 0.289
NP_440037.1_2 Reverse -367 -386 7.7676 0.248
NP_440724.1_5 Reverse -130 -148 15.6538 0.262
NP_442541.1_10 Forward -322 -308 2.16228 0.265
NP_441482.1_7 Reverse -351 -365 -10.6202 0.211
NP_441527.1_4 Reverse -112 -131 2.81659 0.125
NP_441527.1_4 Reverse -116 -135 0.429291 0.136
NP_441527.1_4 Reverse -118 -137 -0.334645 0.146
NP_441527.1_4 Reverse -110 -129 -0.716613 0.146
NP_441527.1_4 Reverse -104 -123 -1.48055 0.148
NP_441527.1_4 Reverse -109 -128 -4.63178 0.188
NP_441527.1_4 Reverse -150 -169 -4.91826 0.191
NP_441527.1_4 Forward -29 -10 -5.49121 0.202
NP_441527.1_4 Reverse -98 -117 -8.16498 0.241
NP_441527.1_4 Reverse -102 -121 -8.26048 0.242
NP_441527.1_4 Reverse -119 -138 -8.35597 0.243
NP_441527.1_4 Reverse -101 -120 -10.4568 0.27
NP_441527.1_4 Reverse -115 -134 -11.0297 0.278
NP_441527.1_4 Reverse -107 -126 -11.6982 0.284
NP_441527.1_4 Reverse -113 -132 -12.7486 0.293
NP_440007.1_9 Forward -391 -377 9.34103 0.171
NP_441106.1_3 Forward -100 -81 11.3075 0.217
NP_440646.1_9 Reverse -183 -202 16.8141 0.167
NP_441825.1_4 Forward -243 -233 16.2046 0.186
NP_442674.1_3 Reverse -184 -203 3.04693 0.296
NP_442477.1_5 Forward -322 -303 11.7008 0.116
NP_441705.1_4 Forward -207 -188 11.4058 0.218
NP_441930.1_2 Forward -242 -232 11.6814 0.278
NP_440404.1_9 Reverse -109 -128 10.4559 0.209
NP_440907.2_8 Forward -103 -93 5.58445 0.194
NP_440962.1_5 Forward -130 -120 16.6963 0.261
NP_441463.1_3 Forward -225 -206 -9.53865 0.28
NP_441626.1_2 Reverse -269 -276 9.08556 0.1
NP_442365.1_7 Forward -104 -85 -4.22878 0.238
NP_440114.1_10 Forward -215 -201 10.3243 0.148
NP_442698.1_10 Reverse -105 -124 6.19431 0.233
NP_442698.1_10 Reverse -104 -123 0.58944 0.297
NP_441853.1_5 Reverse -137 -156 0.294447 0.283
NP_440293.1_3 Forward -262 -243 -1.7705 0.239
NP_442680.1_5 Reverse -109 -128 5.4452 0.225
NP_442680.1_5 Reverse -110 -129 3.00294 0.237
NP_440942.1_10 Forward -201 -182 13.3725 0.291
NP_441885.1_5 Reverse -357 -367 -1.19994 0.255
NP_442341.1_7 Reverse -312 -326 5.1128 0.167
NP_442341.1_9 Reverse -266 -280 5.30886 0.274
NP_442395.2_4 Reverse -232 -251 -0.0996487 0.282
NP_440127.1_2 Forward -334 -315 18.764 0.0948
NP_442638.1_2 Reverse -47 -66 19.469 0.0426
NP_441122.1_1 Forward -326 -311 2.92983 0.29
NP_441207.1_7 Reverse -115 -129 9.54584 0.275
NP_440216.1_9 Forward -286 -277 5.3096 0.298
NP_442371.1_1 Reverse -58 -68 13.8442 0.196
NP_440261.1_10 Reverse -141 -155 13.4709 0.207
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCCACACGCCATGACGTTGCCATTTACGGTAATAGCTATAGACCGTGCTACTAGGAGGAAAGTCATGGGGTAACATTGCCCATTGACAACCCGTTTTTAGTTGGTAGTAAATACCATTACAAACCGCTCGCATATCTGTGGTTCGTGGGTGTCCTCCGGGCTTTGCGGGAGGAATCATTGATTCAACTATTGCCCATTCTGCATCGCTCAGGTCTGTTTCATAGGCTGTCGACTTTTCATGCTCTTTGTCTCCTTCTGCTCTTACTCTTAGTTTTCCTTTTTTTCTTCTCCTACTTGCTATCCATTACAAGACTTTATAAATGAGCTCTAAATTTCATCCTGATTTCATTTTGCTTTGCCAGACTGGAATTAGAGAAGGAATAGGAGGTAAGCATTCCC

CDS

GTGGGTAATCAATTCTGGATATATGGGTTGGCAGGACTACTCCTCAGTGGTTCAGCGGCTGGGGTAACAGCGGTTTATCGCAATCAATCTCCACCGCAGATGATGGCCCAACAAGGCATGCACATGCAATGGACAGACCAAAGTTTTATCGAAATGATGATTCCCCACCATCAAGATGCCATTGATATGGCGGAGATGGCTCTACAAAAAGCCGAACATCCTGAACTCAAAAAGTTGGCACGGAATATTATCCGAGACCAGGAAAGGGAAATTAAAGAAATGAAAACCTGGTATCAGCAATGGTTTAAACGACCAGTGCCTGCTTTGTCGAGCCAGGGAATGATGGGAATGCACCAAGGTCACGGCATGATGGCGATGGATTTAGAGGCTTTGGCCACCGCCCAAAACTTTGACCGGGAATTTATTCGTCAGATGATTCCCCACCATCAAATGGCAGTGATGATGGCTAGCAATTTAAAAACCAATACGGAACGGCCGGAGATGGATAAATTGATGGATGACATTATCCGCTCCCAAAGTGCGGAAATTAAGCAAATGAAGCAATGGTATCAAAACTGGTATGGTCAGTGA

Protein

MGNQFWIYGLAGLLLSGSAAGVTAVYRNQSPPQMMAQQGMHMQWTDQSFIEMMIPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIKEMKTWYQQWFKRPVPALSSQGMMGMHQGHGMMAMDLEALATAQNFDREFIRQMIPHHQMAVMMASNLKTNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYGQ