Your browser is old and dusty. Try Google Chrome!

Details for sll0787

ORF sll0787
Accession NP_442643.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -213 -199 10.9143 0.262
NP_441061.1_2 Forward -110 -96 9.63603 0.0708
NP_440795.1_7 Forward -110 -103 14.6904 0.0123
NP_440795.1_7 Reverse -103 -110 14.6904 0.0123
NP_441418.1_6 Forward -111 -92 -15.4385 0.0822
NP_442291.1_5 Reverse -101 -117 -0.0397962 0.177
NP_442291.1_5 Forward -112 -96 -0.629782 0.187
NP_441453.1_4 Reverse -102 -110 16.539 0.00633
NP_441453.1_4 Forward -111 -103 7.8859 0.0536
NP_441453.1_4 Reverse -285 -293 5.23096 0.157
NP_442151.1_6 Forward -294 -280 11.3077 0.104
NP_442151.1_6 Forward -111 -97 7.66941 0.192
NP_441818.1_1 Forward -110 -99 14.0211 0.0577
NP_440226.1_1 Reverse -102 -121 4.22769 0.199
NP_442173.1_1 Forward -110 -102 15.4574 0.00633
NP_442173.1_1 Reverse -103 -111 14.1791 0.0165
NP_442173.1_1 Forward -293 -285 8.86921 0.0882
NP_442752.1_4 Reverse -102 -109 13.8055 0.0199
NP_442752.1_4 Forward -294 -287 4.36568 0.273
NP_443027.1_4 Forward -113 -103 6.8632 0.262
NP_443027.1_4 Reverse -100 -110 6.46988 0.275
NP_440784.1_7 Forward -110 -103 15.9687 0.0123
NP_440784.1_7 Reverse -103 -110 15.9687 0.0123
NP_442909.1_7 Forward -110 -96 15.4369 0.104
NP_440061.1_9 Forward -113 -99 19.2718 0.00608
NP_440928.1_8 Forward -304 -285 15.8307 0.255
NP_441054.1_2 Forward -203 -184 10.6192 0.284
NP_442062.1_8 Reverse -102 -112 18.7612 0.00187
NP_442062.1_8 Forward -111 -101 8.1415 0.0801
NP_441859.1_3 Forward -112 -93 23.4013 0.0135
NP_441802.1_1 Reverse -369 -388 7.57094 0.248
NP_440304.1_4 Reverse -100 -110 17.9746 0.00654
NP_440304.1_4 Forward -178 -168 4.0116 0.281
NP_442242.1_4 Forward -110 -103 14.3954 0.0124
NP_442242.1_4 Reverse -103 -110 14.3954 0.0124
NP_441161.1_3 Forward -117 -99 18.0137 0.0605
NP_441619.1_8 Forward -117 -103 6.78381 0.295
NP_440132.1_1 Forward -296 -278 8.37728 0.272
NP_442110.1_7 Forward -149 -135 3.53951 0.21
NP_441083.1_5 Forward -111 -101 10.0098 0.0214
NP_441083.1_5 Reverse -285 -295 9.51814 0.026
NP_441083.1_5 Reverse -102 -112 1.65166 0.2
NP_441083.1_5 Forward -294 -284 -0.708283 0.276
NP_441738.1_2 Forward -109 -102 15.28 0.0102
NP_441738.1_2 Reverse -104 -111 11.5435 0.084
NP_440209.1_1 Reverse -102 -110 18.1123 0.00295
NP_440209.1_1 Forward -111 -103 8.47588 0.0457
NP_442445.1_1 Forward -299 -280 13.0775 0.234
NP_442111.1_4 Reverse -101 -115 4.42448 0.207
NP_442111.1_4 Reverse -180 -194 4.32615 0.212
NP_442111.1_4 Forward -295 -281 1.76955 0.294
NP_440906.1_5 Forward -110 -103 15.8704 0.0124
NP_440906.1_5 Reverse -103 -110 15.8704 0.0124
NP_441209.1_8 Forward -247 -229 8.46115 0.259
NP_440747.1_10 Reverse -282 -294 -4.09092 0.078
NP_440747.1_10 Forward -114 -102 -4.38592 0.0974
NP_440747.1_10 Reverse -99 -111 -11.6624 0.131
NP_440747.1_10 Forward -297 -285 -11.7607 0.142
NP_441130.1_10 Reverse -100 -114 10.0294 0.117
NP_442973.1_5 Forward -120 -101 10.5209 0.282
NP_441486.1_1 Forward -114 -100 11.6026 0.0153
NP_441486.1_1 Reverse -99 -113 -3.04867 0.175
NP_442634.1_4 Forward -260 -246 -4.13031 0.184
NP_442634.1_4 Reverse -100 -114 -5.11362 0.235
NP_442848.1_1 Reverse -96 -110 -2.26202 0.263
NP_441012.1_4 Forward -211 -198 7.19745 0.272
NP_443018.1_3 Forward -110 -103 14.8871 0.0123
NP_443018.1_3 Reverse -103 -110 14.8871 0.0123
NP_441634.1_8 Reverse -100 -114 -3.83532 0.295
NP_440376.1_1 Reverse -102 -111 9.73449 0.0365
NP_440376.1_1 Forward -111 -102 9.63616 0.0385
NP_440376.1_1 Reverse -285 -294 7.37455 0.0786
NP_440376.1_1 Forward -294 -285 6.5879 0.0915
NP_441588.1_4 Reverse -104 -114 8.33817 0.151
NP_442687.1_7 Reverse -101 -111 9.51814 0.0994
NP_442687.1_7 Reverse -216 -226 8.63316 0.104
NP_442687.1_7 Forward -112 -102 6.17489 0.178
NP_441013.1_3 Forward -258 -239 5.70265 0.281
NP_442296.1_9 Reverse -103 -122 -4.6221 0.28
NP_441763.1_10 Reverse -206 -225 5.89851 0.28
NP_440360.1_10 Forward -109 -95 17.0108 0.0856
NP_442658.1_1 Reverse -100 -110 17.6791 0.00565
NP_442658.1_1 Forward -113 -103 14.0409 0.0273
NP_442658.1_1 Forward -178 -168 4.99446 0.288
NP_440141.1_8 Reverse -93 -112 3.83436 0.298
NP_441414.1_9 Reverse -102 -121 -1.37718 0.0996
NP_441958.1_5 Reverse -101 -111 11.3864 0.0074
NP_441958.1_5 Forward -112 -102 2.43831 0.0422
NP_441958.1_5 Reverse -284 -294 1.84832 0.0729
NP_441958.1_5 Forward -295 -285 0.57002 0.139
NP_441127.1_1 Reverse -211 -225 13.8643 0.164
NP_442836.1_5 Reverse -96 -115 25.5655 0.00894
NP_440203.1_5 Forward -108 -98 10.4026 0.225
NP_440203.1_5 Forward -135 -125 9.51767 0.254
NP_439905.1_1 Forward -110 -97 10.934 0.204
NP_440995.1_8 Forward -121 -102 2.26107 0.264
NP_440984.1_7 Forward -224 -210 5.30946 0.259
NP_442911.1_2 Reverse -92 -111 9.0459 0.0185
NP_442911.1_2 Forward -121 -102 7.96426 0.0225
NP_440153.1_5 Forward -110 -96 3.24451 0.217
NP_440153.1_10 Forward -225 -212 17.2272 0.297
NP_443055.1_6 Reverse -167 -185 1.98502 0.222
NP_443055.1_6 Reverse -244 -262 -1.84987 0.284
NP_440993.1_2 Forward -116 -100 2.12349 0.269
NP_442002.1_9 Reverse -101 -108 14.1004 0.074
NP_441294.1_7 Forward -115 -101 17.3137 0.00972
NP_441646.1_1 Forward -118 -99 5.211 0.182
NP_442438.1_10 Forward -116 -102 3.44117 0.162
NP_442438.1_10 Forward -299 -285 0.786239 0.213
NP_442438.1_10 Reverse -36 -50 -0.197071 0.253
NP_442431.1_10 Reverse -132 -150 4.9357 0.206
NP_441000.1_6 Reverse -101 -115 14.3559 0.0396
NP_441000.1_6 Forward -112 -98 -5.01529 0.257
NP_442771.1_1 Reverse -100 -118 -7.55234 0.171
NP_440147.1_4 Forward -113 -100 12.9006 0.0326
NP_441550.1_8 Reverse -100 -110 19.8424 0.00352
NP_441550.1_8 Forward -113 -103 5.09279 0.267
NP_441550.1_8 Reverse -283 -293 4.7978 0.283
NP_441916.1_7 Reverse -102 -112 9.12481 0.0396
NP_441916.1_7 Forward -111 -101 8.63316 0.0437
NP_440465.1_10 Reverse -99 -118 -1.7705 0.297
NP_441041.1_4 Forward -294 -275 2.94938 0.0684
NP_441041.1_4 Forward -258 -239 1.96607 0.0769
NP_441041.1_4 Forward -149 -130 -13.0786 0.28
NP_441041.1_4 Forward -219 -200 -13.9635 0.299
NP_441041.1_7 Forward -114 -102 17.1354 0.0109
NP_442004.1_6 Forward -111 -97 1.27789 0.294
NP_441725.1_5 Forward -110 -100 18.7612 0.0119
NP_441725.1_5 Reverse -168 -178 6.37155 0.115
NP_441725.1_5 Reverse -103 -113 0.766681 0.149
NP_439966.1_7 Reverse -100 -110 8.14104 0.14
NP_439966.1_7 Forward -113 -103 7.35439 0.15
NP_439966.1_7 Reverse -252 -262 6.27276 0.185
NP_439966.1_9 Forward -113 -104 9.14451 0.253
NP_439966.1_9 Reverse -100 -109 0.983037 0.253
NP_442941.1_3 Forward -110 -100 2.43831 0.14
NP_442941.1_3 Reverse -286 -296 0.57002 0.199
NP_440289.1_2 Forward -114 -101 6.4108 0.0596
NP_440289.1_2 Reverse -27 -40 1.49425 0.125
NP_440289.1_2 Reverse -99 -112 -4.40561 0.288
NP_440983.1_5 Reverse -285 -304 -1.18052 0.228
NP_442281.1_1 Reverse -97 -111 7.96378 0.089
NP_442281.1_1 Forward -116 -102 4.71887 0.184
NP_441334.1_7 Reverse -247 -266 -11.8003 0.126
NP_442575.1_8 Reverse -205 -224 -1.86883 0.232
NP_001035871.2_7 Forward -244 -234 12.6647 0.262
NP_440437.1_1 Forward -117 -98 9.43923 0.0507
NP_440437.1_1 Forward -45 -26 -0.295539 0.178
NP_441644.1_6 Reverse -102 -112 7.64939 0.121
NP_441644.1_6 Reverse -285 -295 7.55106 0.123
NP_441644.1_6 Forward -294 -284 6.76441 0.147
NP_441644.1_6 Forward -111 -101 6.37109 0.161
NP_441644.1_6 Forward -64 -54 5.68278 0.18
NP_443049.1_6 Reverse -101 -111 11.3482 0.263
NP_442215.1_2 Forward -222 -206 -0.728113 0.171
NP_442215.1_2 Forward -113 -97 -5.64466 0.254
NP_442029.1_6 Forward -299 -280 5.211 0.255
NP_440929.1_8 Forward -111 -102 17.4043 0.00289
NP_440929.1_8 Reverse -102 -111 17.4043 0.00289
NP_440929.1_8 Reverse -285 -294 7.17789 0.0713
NP_442933.1_10 Reverse -102 -111 9.04618 0.063
NP_442933.1_10 Forward -111 -102 8.94785 0.0643
NP_441751.2_8 Forward -110 -96 13.1759 0.0173
NP_441751.2_8 Reverse -103 -117 -1.77037 0.13
NP_442554.1_8 Forward -110 -100 16.9913 0.0065
NP_442554.1_8 Reverse -103 -113 9.91146 0.053
NP_442554.1_8 Forward -293 -283 4.60159 0.18
NP_442554.1_8 Reverse -205 -215 1.94665 0.288
NP_441762.1_7 Reverse -101 -113 11.347 0.0142
NP_441762.1_7 Forward -112 -100 4.26721 0.0518
NP_442292.1_1 Forward -110 -101 9.53783 0.0183
NP_442292.1_1 Reverse -103 -112 9.04618 0.0226
NP_442292.1_5 Reverse -98 -117 -1.57384 0.265
NP_442476.1_6 Forward -110 -96 11.7993 0.0543
NP_443009.1_5 Reverse -101 -112 19.5276 0.00172
NP_440357.1_3 Forward -113 -94 17.2074 0.0928
NP_442076.1_8 Reverse -91 -110 17.0107 0.118
NP_441198.1_8 Reverse -100 -110 15.2245 0.0427
NP_441198.1_8 Reverse -127 -137 11.4158 0.207
NP_441198.1_8 Forward -178 -168 11.0251 0.228
NP_441468.1_1 Forward -110 -103 15.8704 0.0124
NP_441468.1_1 Reverse -103 -110 15.8704 0.0124
NP_441020.2_6 Reverse -100 -117 7.80699 0.218
NP_441673.1_1 Reverse -102 -111 11.1111 0.0121
NP_441673.1_1 Forward -111 -102 11.0128 0.018
NP_441673.1_1 Forward -294 -285 1.67135 0.0404
NP_441673.1_1 Reverse -285 -294 1.47469 0.0936
NP_441826.1_2 Reverse -96 -110 10.226 0.0498
NP_441826.1_2 Reverse -285 -299 0.491246 0.184
NP_441826.1_2 Forward -117 -103 0.491246 0.184
NP_441330.1_1 Reverse -232 -251 -15.3402 0.275
NP_441764.1_8 Forward -277 -267 11.8849 0.284
NP_442868.1_6 Reverse -100 -110 16.7946 0.0131
NP_442719.1_2 Reverse -346 -364 -4.60312 0.213
NP_441251.1_2 Forward -392 -374 10.9339 0.262
NP_441612.1_2 Reverse -63 -73 8.25885 0.228
NP_442808.1_1 Forward -112 -102 9.81266 0.0481
NP_442808.1_1 Reverse -290 -300 2.43787 0.266
NP_441101.1_10 Reverse -98 -117 -7.08038 0.29
NP_440145.1_3 Forward -320 -301 -5.21209 0.261
NP_442050.1_5 Reverse -100 -110 14.9258 0.0175
NP_441114.1_3 Forward -218 -209 6.5879 0.262
NP_440558.1_2 Reverse -240 -259 2.94938 0.164
NP_440558.1_2 Reverse -234 -253 -1.47551 0.214
NP_440558.1_2 Reverse -125 -144 -3.04881 0.232
NP_440558.1_2 Forward -147 -128 -7.17871 0.289
NP_441878.1_6 Reverse -101 -111 10.5014 0.0176
NP_441878.1_6 Forward -112 -102 0.57002 0.14
NP_441036.1_8 Forward -112 -102 16.7946 0.00239
NP_441036.1_8 Reverse -97 -107 5.78156 0.258
NP_441036.1_8 Forward -295 -285 5.5849 0.271
NP_442650.1_2 Forward -258 -244 3.44117 0.202
NP_441557.1_5 Forward -111 -102 17.4043 0.0023
NP_441557.1_5 Reverse -102 -111 10.8161 0.00464
NP_441557.1_5 Forward -294 -285 0.786375 0.106
NP_441557.1_5 Reverse -285 -294 0.589713 0.134
NP_442183.1_1 Forward -111 -97 9.63603 0.0954
NP_442183.1_1 Reverse -102 -116 5.30946 0.223
NP_442183.1_9 Forward -206 -196 9.41981 0.296
NP_442166.1_7 Forward -293 -279 8.84938 0.215
NP_442494.1_7 Reverse -200 -219 3.34271 0.246
NP_442347.1_2 Reverse -103 -112 8.75118 0.0772
NP_442347.1_2 Forward -110 -101 3.34298 0.284
NP_442645.1_2 Reverse -126 -145 -18.8801 0.28
NP_441037.1_4 Reverse -100 -110 18.9151 0.00351
NP_441037.1_4 Forward -113 -103 13.6524 0.0561
NP_441037.1_4 Reverse -283 -293 8.97447 0.237
NP_441633.1_3 Forward -113 -100 24.4054 0.00371
NP_441633.1_3 Reverse -165 -178 1.69091 0.109
NP_440136.1_2 Forward -110 -103 15.9687 0.0123
NP_440136.1_2 Reverse -103 -110 15.9687 0.0123
NP_442998.1_10 Forward -109 -102 15.5754 0.0102
NP_442998.1_10 Reverse -287 -294 6.0373 0.205
NP_442998.1_10 Reverse -104 -111 5.84064 0.235
NP_440299.1_1 Forward -115 -102 6.70522 0.133
NP_441799.1_1 Reverse -98 -112 17.7968 0.0105
NP_441007.1_10 Reverse -97 -110 18.7022 0.0299
NP_441007.1_10 Forward -339 -326 0.412608 0.23
NP_440256.1_1 Reverse -282 -301 -3.3438 0.131
NP_440087.1_1 Reverse -93 -112 -6.29373 0.252
NP_441090.1_5 Forward -269 -251 16.9321 0.234
NP_441559.1_8 Reverse -259 -273 -7.17857 0.287
NP_440915.1_6 Forward -115 -101 1.86788 0.131
NP_440915.1_6 Forward -298 -284 0.392915 0.165
NP_441179.1_9 Reverse -289 -299 15.2208 0.246
NP_440319.1_5 Reverse -167 -186 15.0432 0.265
NP_441704.1_8 Reverse -156 -175 13.47 0.112
NP_440748.1_5 Reverse -131 -150 -0.688862 0.26
NP_441464.1_1 Reverse -250 -269 6.39097 0.293
NP_441464.1_8 Forward -111 -97 8.16106 0.2
NP_441464.1_8 Reverse -102 -116 4.22782 0.28
NP_440306.1_8 Forward -198 -179 -3.83621 0.299
NP_441494.1_6 Reverse -97 -110 10.639 0.225
NP_439985.1_7 Forward -258 -239 2.0644 0.296
NP_442386.1_9 Forward -112 -103 14.4539 0.0289
NP_442386.1_9 Reverse -101 -110 6.39082 0.219
NP_441340.1_5 Forward -110 -103 15.6737 0.0124
NP_441340.1_5 Reverse -103 -110 15.6737 0.0124
NP_441340.1_5 Forward -293 -286 4.07068 0.239
NP_440168.1_9 Forward -263 -244 -1.27885 0.273
NP_442240.1_1 Forward -221 -202 5.89851 0.261
NP_440586.1_8 Forward -110 -103 13.2151 0.026
NP_440586.1_8 Reverse -103 -110 13.2151 0.026
NP_442251.1_6 Forward -110 -103 15.2804 0.0124
NP_442251.1_6 Reverse -103 -110 15.2804 0.0124
NP_440684.1_9 Reverse -96 -110 10.0294 0.209
NP_440684.1_9 Forward -117 -103 9.93102 0.214
NP_441262.1_3 Forward -111 -104 14.8871 0.0223
NP_441262.1_3 Reverse -102 -109 14.7888 0.0223
NP_441262.1_3 Forward -294 -287 5.34899 0.181
NP_440027.1_3 Reverse -204 -222 10.1465 0.176
NP_443051.1_1 Reverse -101 -110 18.0926 0.00402
NP_443051.1_1 Forward -112 -103 8.35786 0.0371
NP_443051.1_1 Reverse -284 -293 0.196389 0.213
NP_439984.1_3 Reverse -95 -109 17.0102 0.098
NP_439937.1_8 Forward -113 -94 -4.03212 0.276
NP_439937.1_9 Forward -112 -95 -6.45167 0.157
NP_439937.1_9 Reverse -101 -118 -16.973 0.291
NP_442294.1_3 Forward -79 -65 14.4536 0.239
NP_440398.1_2 Reverse -90 -109 1.27776 0.271
NP_440408.1_7 Reverse -204 -223 7.57094 0.287
NP_440626.1_1 Reverse -103 -122 11.11 0.219
NP_440626.1_1 Forward -384 -365 9.93006 0.253
NP_440439.1_1 Reverse -99 -112 2.77255 0.128
NP_440372.1_2 Forward -110 -103 16.3621 0.0124
NP_440372.1_2 Reverse -103 -110 16.3621 0.0124
NP_440372.1_2 Forward -293 -286 4.36568 0.205
NP_440819.1_5 Reverse -181 -189 7.59091 0.272
NP_439977.1_7 Reverse -232 -251 11.3067 0.262
NP_441572.1_7 Reverse -96 -115 -1.67217 0.19
NP_442384.1_10 Reverse -285 -298 4.14919 0.167
NP_442384.1_10 Forward -111 -98 2.67422 0.216
NP_442384.1_10 Forward -219 -206 1.49425 0.257
NP_442114.1_4 Forward -111 -100 8.61347 0.197
NP_441018.1_7 Forward -304 -285 10.6192 0.201
NP_442790.1_4 Reverse -93 -112 -8.85033 0.176
NP_442262.1_10 Forward -110 -103 14.1988 0.0123
NP_442262.1_10 Reverse -103 -110 14.1988 0.0123
NP_440163.1_10 Forward -297 -287 10.5014 0.201
NP_440344.1_10 Forward -118 -101 -8.0243 0.121
NP_440344.1_10 Reverse -95 -112 -13.1375 0.276
NP_440531.1_6 Reverse -94 -113 0.786102 0.187
NP_442910.1_1 Forward -118 -99 -5.99873 0.254
NP_440189.1_10 Reverse -164 -183 7.37428 0.242
NP_440297.1_9 Forward -110 -100 9.51814 0.0917
NP_440297.1_9 Reverse -103 -113 0.176696 0.282
NP_440350.1_1 Forward -219 -200 -5.80207 0.294
NP_440937.1_5 Forward -220 -201 8.25926 0.287
NP_440999.1_9 Reverse -213 -227 1.57289 0.162
NP_440999.1_9 Forward -115 -101 0.982901 0.172
NP_440888.1_2 Reverse -285 -299 13.8636 0.0231
NP_442277.1_4 Forward -120 -101 5.89851 0.171
NP_441543.1_2 Forward -110 -101 9.34117 0.0818
NP_441543.1_2 Reverse -103 -112 8.94785 0.0968
NP_442845.1_2 Forward -300 -286 8.65272 0.19
NP_442845.1_2 Reverse -96 -110 6.58777 0.207
NP_442845.1_4 Reverse -100 -119 8.55425 0.185
NP_441469.1_8 Forward -112 -103 16.5193 0.00797
NP_441469.1_8 Reverse -101 -110 13.3727 0.073
NP_442578.1_7 Forward -110 -103 14.5921 0.026
NP_442578.1_7 Reverse -103 -110 14.5921 0.026
NP_442578.1_7 Reverse -215 -222 6.62729 0.18
NP_442578.1_8 Forward -128 -114 17.3912 0.263
NP_441462.1_2 Forward -111 -101 10.3048 0.0123
NP_441462.1_2 Forward -294 -284 9.02648 0.0256
NP_441462.1_2 Reverse -102 -112 2.7333 0.0792
NP_441462.1_2 Reverse -285 -295 0.275027 0.159
NP_441621.1_7 Forward -113 -99 -2.75368 0.188
NP_441621.1_7 Reverse -100 -114 -3.24533 0.188
NP_443062.1_1 Reverse -102 -120 6.10824 0.209
NP_443062.1_6 Forward -119 -100 8.84924 0.135
NP_441601.1_4 Reverse -200 -219 -2.95047 0.293
NP_441560.1_8 Forward -225 -206 11.6101 0.292
NP_442487.1_5 Forward -311 -292 3.04693 0.289
NP_440516.1_2 Forward -117 -99 -0.472507 0.253
NP_440516.1_8 Reverse -102 -111 9.53783 0.0136
NP_440516.1_8 Forward -294 -285 7.47288 0.0581
NP_440516.1_8 Forward -111 -102 7.07956 0.0867
NP_440516.1_8 Reverse -285 -294 5.3096 0.116
NP_440516.1_8 Forward -263 -254 -0.295266 0.232
NP_442428.1_5 Forward -110 -103 15.8704 0.0124
NP_442428.1_5 Reverse -103 -110 15.8704 0.0124
NP_440618.1_1 Reverse -60 -79 -6.49039 0.247
NP_442120.1_10 Reverse -211 -230 -14.9469 0.289
NP_440673.1_3 Forward -109 -102 12.4288 0.0426
NP_440673.1_3 Reverse -177 -184 9.57722 0.185
NP_440673.1_3 Reverse -104 -111 5.34899 0.298
NP_441052.1_2 Forward -111 -101 1.84832 0.225
NP_441052.1_2 Reverse -102 -112 0.766681 0.256
NP_441052.1_2 Reverse -285 -295 0.57002 0.256
NP_442219.1_9 Forward -110 -101 8.25953 0.0681
NP_440436.1_4 Forward -110 -101 15.9289 0.00508
NP_440436.1_4 Reverse -103 -112 9.04574 0.092
NP_440436.1_4 Reverse -238 -247 5.11253 0.222
NP_441884.1_9 Forward -114 -95 -16.1268 0.138
NP_440648.1_1 Forward -294 -275 13.7658 0.0817
NP_441719.1_4 Forward -110 -103 16.3621 0.0124
NP_441719.1_4 Reverse -103 -110 16.3621 0.0124
NP_441733.1_10 Forward -114 -101 8.47575 0.14
NP_441733.1_10 Reverse -99 -112 3.75586 0.288
NP_441004.1_1 Forward -190 -171 -17.8968 0.295
NP_442366.1_3 Reverse -101 -119 7.88563 0.0708
NP_442366.1_3 Forward -295 -277 2.67408 0.125
NP_442366.1_5 Forward -53 -43 12.0743 0.147
NP_443054.1_2 Reverse -100 -114 3.44117 0.24
NP_443054.1_4 Forward -225 -206 14.4533 0.192
NP_442430.1_10 Forward -186 -167 10.6184 0.262
NP_441851.1_10 Reverse -101 -111 17.2863 0.00552
NP_441851.1_10 Forward -112 -102 14.4347 0.016
NP_441851.1_10 Forward -177 -167 4.3066 0.277
NP_442622.1_8 Forward -111 -93 -18.9587 0.293
NP_441668.1_5 Reverse -209 -228 9.73422 0.225
NP_442515.1_1 Forward -112 -98 4.62115 0.107
NP_441396.1_5 Reverse -94 -103 8.75118 0.21
NP_441982.1_6 Reverse -180 -189 11.5304 0.288
NP_441349.1_10 Forward -121 -102 -9.34199 0.289
NP_441349.1_10 Forward -304 -285 -9.93197 0.3
NP_442314.1_8 Forward -296 -279 11.4452 0.144
NP_442843.1_1 Forward -175 -156 -10.7186 0.28
NP_440474.1_8 Reverse -103 -117 13.7653 0.0695
NP_440474.1_8 Forward -110 -96 7.17714 0.207
NP_440474.1_8 Forward -49 -35 4.62054 0.271
NP_440474.1_8 Reverse -215 -229 4.32555 0.284
NP_440396.1_10 Forward -110 -94 13.8241 0.151
NP_441477.1_10 Forward -220 -202 2.87075 0.23
NP_442450.1_5 Reverse -100 -110 10.1081 0.115
NP_442168.1_6 Forward -141 -122 12.9791 0.202
NP_440588.1_2 Forward -120 -101 1.27776 0.138
NP_440195.1_5 Forward -182 -163 6.29264 0.21
NP_441570.1_1 Reverse -285 -303 -17.2871 0.269
NP_440078.1_10 Forward -294 -275 4.916 0.237
NP_441078.1_4 Reverse -102 -111 9.93116 0.0203
NP_441078.1_4 Forward -111 -102 9.83282 0.0226
NP_441078.1_4 Forward -294 -285 0.491382 0.188
NP_441078.1_4 Reverse -285 -294 0.29472 0.205
NP_442729.1_5 Forward -185 -175 8.23984 0.248
NP_442729.1_8 Reverse -98 -111 7.29578 0.158
NP_442388.1_3 Forward -312 -293 8.55425 0.229
NP_440526.1_3 Forward -110 -99 11.3662 0.0646
NP_440526.1_3 Reverse -168 -179 5.17139 0.253
NP_440526.1_3 Reverse -103 -114 0.451529 0.281
NP_441432.1_8 Reverse -101 -110 8.35786 0.0755
NP_441432.1_8 Forward -138 -129 5.40793 0.158
NP_441432.1_8 Forward -295 -286 4.81794 0.196
NP_441432.1_8 Reverse -300 -309 2.55633 0.298
NP_443024.1_3 Forward -178 -168 16.7946 0.251
NP_442320.1_8 Forward -300 -286 -4.22864 0.151
NP_442320.1_9 Forward -188 -174 12.0943 0.256
NP_441732.1_2 Reverse -281 -297 -7.90627 0.0983
NP_441732.1_2 Forward -115 -99 -16.3627 0.165
NP_440760.1_1 Forward -111 -92 -14.5535 0.133
NP_440760.1_1 Forward -176 -157 -17.5035 0.2
NP_441945.1_10 Forward -220 -201 7.57094 0.284
NP_440913.1_1 Forward -215 -197 9.65558 0.176
NP_440713.1_4 Forward -304 -285 12.2908 0.106
NP_440713.1_4 Reverse -200 -219 2.45773 0.262
NP_442489.1_7 Reverse -102 -111 10.4228 0.0151
NP_442489.1_7 Forward -111 -102 10.3245 0.0193
NP_442489.1_7 Forward -294 -285 0.983037 0.121
NP_442489.1_7 Reverse -285 -294 0.983037 0.121
NP_440565.1_3 Reverse -164 -183 14.6128 0.264
NP_440559.1_1 Forward -110 -101 17.306 0.00658
NP_440559.1_1 Reverse -103 -112 7.86621 0.0856
NP_441659.2_8 Reverse -285 -295 12.0747 0.0147
NP_441659.2_8 Forward -111 -101 9.81313 0.0269
NP_441659.2_8 Reverse -102 -112 8.63316 0.0405
NP_441659.2_8 Forward -294 -284 1.94665 0.22
NP_442913.1_10 Reverse -276 -295 -4.13045 0.227
NP_442346.1_5 Reverse -101 -111 16.6963 0.00248
NP_440545.1_3 Forward -115 -98 5.34871 0.0623
NP_440545.1_3 Reverse -98 -115 -1.63279 0.171
NP_440545.1_3 Forward -262 -245 -3.69774 0.21
NP_441856.1_3 Forward -297 -278 -0.688862 0.225
NP_440459.1_2 Reverse -202 -219 13.9035 0.122
NP_442311.1_8 Reverse -201 -220 8.65258 0.285
NP_441888.1_7 Reverse -238 -252 0.491246 0.295
NP_441888.1_7 Forward -116 -102 0.392915 0.299
NP_441948.1_4 Forward -118 -100 -0.374176 0.139
NP_441833.1_4 Forward -110 -103 15.9687 0.0124
NP_441833.1_4 Reverse -103 -110 15.9687 0.0124
NP_442162.1_9 Forward -110 -103 16.2637 0.0124
NP_442162.1_9 Reverse -103 -110 16.2637 0.0124
NP_442162.1_9 Forward -293 -286 3.4807 0.246
NP_442162.1_9 Reverse -286 -293 3.38237 0.276
NP_440671.1_4 Forward -300 -286 6.19444 0.257
NP_440671.1_4 Forward -117 -103 6.19444 0.257
NP_442404.1_9 Forward -108 -94 9.73373 0.263
NP_440772.1_6 Forward -269 -250 7.27595 0.292
NP_442140.1_3 Reverse -103 -113 17.188 0.0228
NP_442140.1_3 Forward -110 -100 14.828 0.0433
NP_442140.1_3 Forward -212 -202 5.5849 0.202
NP_440875.1_9 Reverse -207 -217 7.496 0.262
NP_440875.1_9 Reverse -104 -114 6.91198 0.294
NP_441813.1_5 Forward -113 -103 9.12481 0.0308
NP_441813.1_5 Reverse -100 -110 8.92815 0.0347
NP_440594.1_8 Forward -110 -97 9.36014 0.186
NP_439901.1_3 Reverse -230 -249 9.78393 0.29
NP_440590.1_4 Reverse -205 -218 -1.45568 0.22
NP_440590.1_4 Forward -110 -97 -3.81562 0.255
NP_440590.1_4 Forward -293 -280 -5.29059 0.277
NP_440567.1_1 Forward -110 -96 14.8476 0.0186
NP_440567.1_1 Reverse -103 -117 6.98109 0.0795
NP_442497.1_10 Forward -110 -101 19.8626 0.00532
NP_442497.1_10 Reverse -103 -112 8.55452 0.0294
NP_440821.1_4 Reverse -100 -110 19.5479 0.00399
NP_440821.1_4 Forward -113 -103 9.61647 0.0286
NP_440821.1_4 Forward -178 -168 -0.609952 0.279
NP_441239.1_9 Forward -113 -101 15.8703 0.0178
NP_441239.1_9 Reverse -252 -264 13.0187 0.0389
NP_441239.1_9 Reverse -100 -112 12.9203 0.0402
NP_441892.1_1 Reverse -93 -110 3.48043 0.125
NP_442643.1_1 Forward -300 -281 34.9069 0.0000259
NP_442643.1_2 Forward -99 -80 30.0887 0.000338
NP_442643.1_3 Forward -219 -200 32.4487 0.000115
NP_442643.1_4 Forward -342 -323 29.0071 0.000746
NP_442643.1_5 Forward -250 -231 31.7604 0.0002
NP_442643.1_6 Forward -180 -161 30.3837 0.000432
NP_442643.1_7 Forward -155 -136 27.2371 0.0033
NP_442643.1_8 Forward -392 -374 25.3877 0.00995
NP_442643.1_9 Forward -126 -107 26.0572 0.0109
NP_442643.1_10 Forward -279 -260 20.8456 0.0489
NP_440989.1_3 Reverse -97 -116 13.7658 0.18
NP_440900.1_5 Reverse -97 -116 15.3408 0.263
NP_440546.1_4 Forward -213 -203 6.65249 0.288
NP_440546.1_6 Forward -153 -134 10.7175 0.245
NP_440462.1_6 Reverse -100 -110 10.4031 0.0396
NP_440868.1_4 Reverse -98 -110 12.3303 0.0242
NP_440868.1_4 Forward -115 -103 0.727295 0.201
NP_440401.1_9 Reverse -198 -205 14.5917 0.287
NP_441084.1_6 Reverse -235 -249 12.4467 0.16
NP_442039.1_4 Forward -110 -103 15.1821 0.0124
NP_442039.1_4 Reverse -103 -110 15.1821 0.0124
NP_441811.1_8 Reverse -96 -110 12.1926 0.209
NP_440825.1_7 Reverse -103 -113 15.6422 0.152
NP_440825.1_7 Forward -175 -165 11.0554 0.278
NP_442837.1_3 Forward -110 -103 15.7721 0.0124
NP_442837.1_3 Reverse -103 -110 15.7721 0.0124
NP_441760.1_1 Forward -263 -244 14.0608 0.14
NP_442053.1_1 Reverse -102 -111 9.34117 0.0666
NP_442053.1_1 Forward -111 -102 8.84951 0.072
NP_442053.1_1 Reverse -285 -294 7.57121 0.0946
NP_440505.1_3 Forward -296 -286 11.6814 0.0698
NP_440505.1_3 Reverse -100 -110 7.84651 0.147
NP_442532.1_7 Forward -111 -97 2.06454 0.254
NP_440914.1_1 Reverse -129 -139 7.44401 0.237
NP_440914.1_1 Reverse -102 -112 6.3705 0.283
NP_440914.1_1 Reverse -285 -295 6.27291 0.288
NP_441011.1_8 Forward -110 -101 14.356 0.0249
NP_441011.1_8 Reverse -103 -112 9.24284 0.131
NP_442533.1_6 Reverse -102 -111 7.86621 0.0862
NP_442533.1_6 Forward -111 -102 7.37455 0.0898
NP_442533.1_6 Reverse -285 -294 4.91628 0.165
NP_442533.1_6 Forward -294 -285 4.81794 0.172
NP_442533.1_6 Forward -213 -204 1.67135 0.293
NP_442541.1_10 Reverse -243 -257 3.8339 0.252
NP_442232.1_3 Reverse -94 -113 -4.6221 0.163
NP_443016.1_1 Forward -117 -98 -3.24547 0.225
NP_441482.1_7 Reverse -96 -110 -10.5218 0.209
NP_441482.1_7 Reverse -279 -293 -12.0951 0.29
NP_439944.1_9 Forward -110 -100 17.4829 0.00423
NP_441028.1_6 Forward -69 -59 6.0761 0.232
NP_440115.1_6 Reverse -99 -109 18.2696 0.0139
NP_439965.1_1 Forward -303 -284 4.12936 0.0949
NP_441347.1_4 Forward -113 -95 15.9202 0.296
NP_441544.1_1 Forward -216 -204 15.9686 0.242
NP_440608.1_6 Forward -175 -156 8.25844 0.238
NP_441106.1_1 Reverse -101 -110 9.73449 0.0311
NP_441106.1_1 Forward -112 -103 9.04618 0.0371
NP_441106.1_1 Reverse -284 -293 6.09625 0.101
NP_439903.1_6 Reverse -234 -253 1.27698 0.249
NP_441286.1_1 Forward -112 -100 13.412 0.00765
NP_441286.1_1 Reverse -166 -178 -5.76255 0.223
NP_442674.1_3 Reverse -94 -113 3.44025 0.294
NP_440670.1_8 Reverse -102 -111 16.3227 0.00291
NP_440670.1_8 Forward -111 -102 15.1427 0.00768
NP_440670.1_8 Forward -294 -285 8.65285 0.0627
NP_440670.1_8 Reverse -285 -294 6.29291 0.124
NP_440886.1_7 Forward -112 -102 8.92768 0.0805
NP_440886.1_7 Reverse -200 -210 7.15773 0.103
NP_440886.1_7 Reverse -284 -294 5.78111 0.163
NP_442072.1_9 Reverse -101 -119 -12.8622 0.0926
NP_441808.1_8 Forward -225 -206 11.4058 0.222
NP_440907.2_8 Forward -110 -100 19.449 0.00351
NP_440907.2_8 Reverse -103 -113 12.3692 0.0661
NP_440907.2_8 Reverse -250 -260 5.38779 0.203
NP_442264.1_2 Reverse -92 -109 8.00365 0.223
NP_441021.1_1 Forward -110 -91 -7.96535 0.192
NP_441021.1_8 Forward -116 -98 2.18243 0.251
NP_441463.1_6 Reverse -127 -141 7.38227 0.261
NP_442842.1_4 Forward -203 -184 2.75272 0.265
NP_441626.1_2 Forward -110 -103 15.7721 0.0124
NP_441626.1_2 Reverse -103 -110 15.7721 0.0124
NP_442365.1_5 Reverse -168 -187 9.0459 0.212
NP_442365.1_5 Forward -110 -91 6.4893 0.279
NP_442615.1_1 Forward -120 -102 -1.06249 0.124
NP_441962.1_4 Reverse -97 -116 -7.86702 0.195
NP_441962.1_4 Reverse -362 -381 -10.522 0.229
NP_441962.1_4 Forward -257 -238 -10.817 0.232
NP_440387.1_1 Forward -294 -278 3.10679 0.0651
NP_440387.1_1 Reverse -102 -118 -1.21977 0.142
NP_440387.1_1 Forward -111 -95 -2.30141 0.147
NP_441431.1_2 Reverse -99 -113 15.9285 0.0421
NP_441488.1_7 Reverse -96 -115 10.4225 0.113
NP_441174.1_4 Reverse -61 -71 14.533 0.267
NP_440114.1_10 Reverse -102 -116 12.291 0.0866
NP_440114.1_10 Forward -111 -97 6.09611 0.285
NP_440725.1_4 Forward -142 -123 1.0811 0.229
NP_442087.1_2 Reverse -140 -159 17.762 0.117
NP_440766.1_4 Forward -122 -108 1.17956 0.249
NP_440766.1_4 Reverse -98 -112 0.88457 0.263
NP_441237.1_9 Forward -110 -100 17.2863 0.00348
NP_442743.1_1 Reverse -234 -253 5.99684 0.268
NP_442930.1_1 Forward -274 -264 9.41933 0.287
NP_440457.1_1 Reverse -98 -110 9.97041 0.092
NP_440457.1_1 Forward -298 -286 9.57708 0.092
NP_440798.1_6 Reverse -103 -116 4.44418 0.145
NP_440798.1_6 Forward -110 -97 2.96921 0.158
NP_442680.1_5 Reverse -61 -80 11.4043 0.124
NP_440942.1_8 Reverse -242 -261 13.8641 0.0779
NP_441984.1_3 Reverse -233 -251 13.0972 0.157
NP_440473.1_9 Reverse -91 -110 1.76941 0.102
NP_442509.1_9 Forward -111 -101 13.3526 0.0571
NP_442509.1_9 Reverse -102 -112 12.4676 0.09
NP_442582.1_3 Reverse -5 -19 13.285 0.283
NP_442936.1_10 Reverse -184 -198 9.07246 0.269
NP_442514.1_5 Forward -398 -379 -7.08111 0.275
NP_440554.1_4 Reverse -103 -113 8.63316 0.0695
NP_440554.1_4 Forward -110 -100 6.27322 0.123
NP_441885.1_5 Reverse -102 -112 2.33998 0.0799
NP_441885.1_5 Reverse -285 -295 1.55333 0.109
NP_441885.1_5 Forward -111 -101 1.55333 0.109
NP_441885.1_5 Forward -294 -284 -0.314959 0.195
NP_441275.1_5 Forward -377 -358 13.2733 0.276
NP_440478.1_10 Forward -113 -99 8.16106 0.257
NP_442341.1_7 Forward -112 -98 5.1128 0.167
NP_442341.1_9 Forward -113 -99 5.21053 0.277
NP_442341.1_9 Forward -296 -282 4.71887 0.294
NP_440409.1_1 Reverse -159 -178 0.392778 0.212
NP_440423.1_6 Reverse -94 -113 -21.24 0.284
NP_443000.1_7 Reverse -100 -110 2.14332 0.226
NP_441842.1_1 Forward -109 -96 10.9334 0.28
NP_441842.1_10 Reverse -95 -109 9.93102 0.178
NP_440275.1_3 Reverse -100 -110 19.5479 0.00756
NP_440275.1_3 Forward -113 -103 8.4365 0.0602
NP_440091.1_1 Forward -115 -103 12.3303 0.0381
NP_440091.1_1 Reverse -98 -110 0.825626 0.227
NP_440091.1_1 Reverse -210 -222 -0.354346 0.273
NP_441902.1_3 Reverse -370 -380 13.6619 0.23
NP_443010.1_10 Forward -114 -97 3.25396 0.258
NP_442451.1_2 Forward -119 -100 -11.0136 0.284
NP_440149.1_8 Forward -124 -105 -7.76869 0.292
NP_441105.1_3 Forward -122 -103 -0.197208 0.132
NP_441105.1_3 Reverse -91 -110 -0.39387 0.136
NP_441105.1_3 Reverse -117 -136 -9.44032 0.289
NP_440216.1_1 Reverse -102 -116 -2.06536 0.0458
NP_440216.1_1 Forward -111 -97 -11.1118 0.163
NP_440216.1_9 Forward -174 -165 5.3096 0.298
NP_440172.1_1 Forward -111 -101 6.46988 0.103
NP_440172.1_1 Reverse -285 -295 2.53664 0.277
NP_440172.1_1 Reverse -102 -112 2.14332 0.283
NP_440167.1_6 Forward -225 -211 16.7159 0.295
NP_442015.1_10 Forward -115 -102 4.14919 0.178
NP_442015.1_10 Reverse -281 -294 0.314277 0.231
NP_441226.1_7 Forward -110 -103 14.4934 0.0123
NP_441226.1_7 Reverse -103 -110 14.4934 0.0123
NP_441226.1_7 Forward -293 -286 10.0685 0.103
NP_441111.1_7 Forward -110 -102 18.7023 0.00294
NP_441111.1_7 Reverse -103 -111 8.96754 0.0463
NP_441111.1_7 Forward -293 -285 -0.472234 0.131
NP_441111.1_7 Reverse -286 -294 -0.668896 0.274
NP_441766.1_2 Forward -111 -102 16.2243 0.0047
NP_441766.1_2 Reverse -102 -111 9.14451 0.0337
NP_441766.1_2 Forward -294 -285 4.52295 0.179
NP_441766.1_2 Reverse -285 -294 4.42462 0.181
NP_440416.1_9 Forward -118 -99 -4.72043 0.0783
NP_442154.1_1 Forward -212 -194 -12.2722 0.217
NP_442154.1_1 Forward -308 -290 -12.3706 0.217
NP_440261.1_5 Forward -110 -97 16.5389 0.0105
NP_440988.1_10 Forward -254 -240 8.09365 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGATCAGTTTGCCTATCCAATTGTTGCCCTAGATACGGAGACTCCTGGTAAACCTACAGTAGTAGGTGCGGTGCGGATTTATGAAAATGAACCGAATGTCTGGTATGGCGGTCGGCTAGGAGTACATCAAAATTACCGGCGAGTGGGTCGCATTGGCAAGGGTTTGATTTATAAAGCTGTTACCGCTGCCCATGGTTGGGGTTGTACTAAGTTTTTCGCGACGGTGCAATTGCAAAATGTGCGTTTTTTTCAGCGACAACATTGGCATTCCCTTCAGGAAATTGAGATCTGCGATCGCCCCCATCATTTAATGGAAGCGGACTTAGATTTTTATCCCCCCGTGGTCTATAGTCGACCGAAGCTCGATCTTGCTTTATTGCAGGTTTCTTAAATCTCGGTT

CDS

ATGTTAACTGACTTAATTATTGAACTACAGCAAACCCTTGGCATTTTGCACAAGCAGGATATTCAATTGGCATCCCGTCAAGGTCAACAGCGATTGATCGGGGATGGTGAGGCGATTCGATTAGGTGATGATTGCGCTGCAATTCCAGACGAGAATGGCTATCTACTCCTTGCGGCTGAGGGGATGGCTCCCAGTTTAATTACCCAAGATCCTTGGTTTGCAGGGTGGTGCAGTGTTTTGGTCAATGTCAGTGATATTTATGCCATGGGGGGCAGGCCGATCGCCGTGGTGGATGCCCTATGGAGTAAGTCTTCTGACCAAGCTCAGCAAATTTGGGCAGGGATGCAAGCCGCTTCGGCTCGATTTAATGTGCCCATTGTGGGCGGCCATACCAATACCCACAGTGGTTATGATGCCTTGGGAGTGGCGATTTTAGGTCGGGCAAAGTCTTTAATCACCAGCTTTGATGCCCAGGTAGGCGATCGCCTGATTCTTGTAAGCAATTTTCAAGGCAAACCGCGACCCAATGCGCCCTATTGCTGGGATGCAGCAACGATGGCAGAAACAGAAACTTTGCAAAAACACTGGGATCTTTTACCCTACCTGGCCGAAAACAAGCTATGTGATGCGGGGAAAGATGTCAGTATGGGCGGCATTATTGGTACAGCATTAATGCTTTTAGAAACATCAAAATGTGGCGCAATCCTCGACCTTGATGCCATTTCCTGTCCGGCGGGTCTAGATTTTAGGCAATGGCTACTTAGTTTTCCGAGTTATGGTTTTTTGCTGAGCGTGCGTCCTCAGTTCGTCAAAACGGTCAAGGCTTGTTTTCAGGCTGAAGGTTTAATAGCAGAGGCGATCGCCACGATACAACCGGGTCATAATCTCACCCTTAAACTAGGTTCAGAGTCCCAACTATTTTGGGATTTGCAGCAAAACCCCCTCACTGGCTTTACCGGAGATTCATAA

Protein

MLTDLIIELQQTLGILHKQDIQLASRQGQQRLIGDGEAIRLGDDCAAIPDENGYLLLAAEGMAPSLITQDPWFAGWCSVLVNVSDIYAMGGRPIAVVDALWSKSSDQAQQIWAGMQAASARFNVPIVGGHTNTHSGYDALGVAILGRAKSLITSFDAQVGDRLILVSNFQGKPRPNAPYCWDAATMAETETLQKHWDLLPYLAENKLCDAGKDVSMGGIIGTALMLLETSKCGAILDLDAISCPAGLDFRQWLLSFPSYGFLLSVRPQFVKTVKACFQAEGLIAEAIATIQPGHNLTLKLGSESQLFWDLQQNPLTGFTGDS