Your browser is old and dusty. Try Google Chrome!

Details for sll0764

ORF sll0764
Accession NP_442055.1
Symbol urtD
Category urea transport system ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -288 -281 14.6904 0.0123
NP_440795.1_7 Reverse -281 -288 14.6904 0.0123
NP_441418.1_6 Forward -289 -270 -19.6667 0.093
NP_441418.1_6 Forward -372 -353 -30.3848 0.274
NP_441418.1_6 Reverse -280 -299 -30.5815 0.286
NP_441418.1_6 Reverse -268 -287 -30.5815 0.286
NP_440815.1_5 Reverse -203 -222 3.6377 0.286
NP_442291.1_5 Forward -290 -274 0.0585348 0.174
NP_442291.1_5 Reverse -154 -170 -2.98973 0.232
NP_442291.1_5 Reverse -226 -242 -3.97304 0.261
NP_440897.1_6 Forward -289 -270 5.11187 0.123
NP_440897.1_6 Reverse -363 -382 -4.91784 0.295
NP_441453.1_1 Forward -296 -278 4.54162 0.258
NP_441453.1_4 Reverse -280 -288 16.539 0.00633
NP_441453.1_4 Forward -289 -281 16.539 0.00633
NP_442151.1_6 Forward -289 -275 11.701 0.0933
NP_441818.1_1 Forward -288 -277 18.0527 0.00639
NP_440226.1_1 Reverse -280 -299 10.6192 0.061
NP_440226.1_1 Forward -289 -270 7.37428 0.107
NP_441465.1_5 Reverse -201 -215 15.5359 0.287
NP_441630.1_3 Forward -220 -201 1.96607 0.235
NP_442173.1_1 Forward -288 -280 15.4574 0.00633
NP_442173.1_1 Reverse -281 -289 15.4574 0.00633
NP_442752.1_4 Forward -289 -282 13.8055 0.0199
NP_442752.1_4 Reverse -280 -287 13.8055 0.0199
NP_442752.1_4 Reverse -77 -84 5.25066 0.256
NP_443027.1_4 Forward -291 -281 13.2547 0.0521
NP_443027.1_4 Reverse -278 -288 11.0914 0.107
NP_443027.1_4 Reverse -153 -163 8.23984 0.215
NP_441812.1_3 Reverse -279 -293 10.4227 0.222
NP_442975.1_10 Forward -293 -279 3.93223 0.249
NP_442975.1_10 Reverse -276 -290 3.93223 0.249
NP_440784.1_7 Forward -288 -281 15.9687 0.0123
NP_440784.1_7 Reverse -281 -288 15.9687 0.0123
NP_440061.1_9 Forward -291 -277 21.6317 0.00189
NP_440061.1_9 Reverse -278 -292 12.3887 0.0971
NP_441054.1_4 Reverse -270 -288 20.472 0.0155
NP_442062.1_8 Forward -289 -279 17.3846 0.00193
NP_442062.1_8 Reverse -280 -290 10.3048 0.0493
NP_440304.1_4 Forward -291 -281 10.8948 0.051
NP_440304.1_4 Reverse -278 -288 1.84832 0.299
NP_442242.1_4 Forward -288 -281 14.3954 0.0124
NP_442242.1_4 Reverse -281 -288 14.3954 0.0124
NP_441781.1_7 Reverse -262 -281 3.83436 0.188
NP_441781.1_7 Forward -289 -270 3.6377 0.188
NP_442048.1_9 Forward -215 -196 11.9958 0.267
NP_441208.1_9 Reverse -277 -291 7.27608 0.223
NP_440370.1_10 Reverse -271 -290 9.0459 0.234
NP_442110.1_7 Forward -289 -275 9.63603 0.0715
NP_442110.1_7 Reverse -351 -365 4.12949 0.205
NP_442110.1_7 Reverse -280 -294 2.2612 0.222
NP_440856.1_4 Forward -296 -277 0.687771 0.167
NP_440856.1_7 Forward -202 -183 -9.24366 0.284
NP_441083.1_5 Forward -289 -279 20.3345 0.00053
NP_441083.1_5 Reverse -280 -290 11.2881 0.0159
NP_441083.1_5 Reverse -344 -354 2.53664 0.194
NP_442827.1_8 Reverse -272 -291 -2.55791 0.282
NP_441738.1_2 Forward -287 -280 15.28 0.0102
NP_441738.1_2 Reverse -282 -289 15.28 0.0102
NP_441558.1_5 Forward -291 -272 21.4356 0.00316
NP_441558.1_5 Reverse -278 -297 9.0459 0.132
NP_440209.1_1 Reverse -280 -288 18.1123 0.00295
NP_440209.1_1 Forward -289 -281 18.1123 0.00295
NP_442889.1_8 Reverse -152 -166 11.4053 0.0733
NP_441713.1_1 Forward -295 -276 -6.98204 0.125
NP_440178.1_7 Forward -290 -271 -12.3902 0.121
NP_441716.1_1 Forward -289 -275 13.4709 0.0689
NP_441327.1_1 Reverse -235 -254 4.98225 0.261
NP_442111.1_4 Reverse -279 -293 13.1759 0.0394
NP_442111.1_4 Forward -290 -276 9.34103 0.0609
NP_440906.1_5 Forward -288 -281 15.8704 0.0124
NP_440906.1_5 Reverse -281 -288 15.8704 0.0124
NP_440747.1_10 Forward -292 -280 17.1486 0.000663
NP_440747.1_10 Reverse -277 -289 16.8536 0.00143
NP_441847.1_6 Forward -233 -214 8.55425 0.252
NP_441130.1_10 Forward -291 -277 8.94771 0.131
NP_441130.1_10 Reverse -278 -292 5.40779 0.231
NP_441486.1_1 Reverse -152 -166 -0.0987402 0.148
NP_441486.1_1 Reverse -277 -291 -2.55701 0.175
NP_442634.1_4 Reverse -278 -292 8.16106 0.0479
NP_442634.1_4 Forward -291 -277 -1.96703 0.149
NP_442848.1_1 Reverse -274 -288 -0.688726 0.263
NP_443018.1_3 Forward -288 -281 14.8871 0.0123
NP_443018.1_3 Reverse -281 -288 14.8871 0.0123
NP_443018.1_3 Reverse -156 -163 11.3472 0.0846
NP_443018.1_3 Forward -10 -3 7.6106 0.156
NP_443018.1_3 Forward -163 -156 4.16902 0.278
NP_441634.1_8 Reverse -278 -292 -3.24533 0.295
NP_441634.1_8 Forward -291 -277 -3.63866 0.295
NP_440376.1_1 Forward -289 -280 19.4693 0.000692
NP_440376.1_1 Reverse -280 -289 19.4693 0.000692
NP_440376.1_1 Reverse -8 -17 3.04799 0.21
NP_440376.1_1 Forward -271 -262 1.86802 0.238
NP_440376.1_1 Forward -278 -269 -0.0986038 0.285
NP_442687.1_7 Forward -290 -280 9.02648 0.0994
NP_442687.1_7 Reverse -279 -289 8.92815 0.0994
NP_442191.1_4 Forward -371 -357 10.5083 0.298
NP_442485.1_3 Forward -288 -269 -4.03212 0.277
NP_442958.1_3 Reverse -269 -288 17.8957 0.0206
NP_442530.1_2 Forward -118 -108 14.4347 0.204
NP_441422.1_7 Reverse -278 -295 -3.10775 0.227
NP_440533.1_9 Reverse -280 -299 4.62101 0.22
NP_442296.1_9 Reverse -156 -175 -0.983855 0.197
NP_442658.1_1 Forward -291 -281 14.2375 0.0237
NP_442658.1_1 Reverse -278 -288 7.94438 0.199
NP_442782.1_2 Reverse -280 -294 11.7993 0.173
NP_442205.1_9 Forward -295 -279 -1.61309 0.264
NP_441414.1_9 Forward -289 -270 -2.0655 0.11
NP_441958.1_5 Forward -290 -280 21.2195 0.000805
NP_441958.1_5 Reverse -279 -289 12.2714 0.00183
NP_441127.1_1 Reverse -2 -16 16.2242 0.101
NP_442836.1_5 Reverse -274 -293 5.60432 0.185
NP_442836.1_5 Reverse -256 -275 4.62101 0.204
NP_439905.1_1 Forward -288 -275 11.7207 0.204
NP_439905.1_2 Forward -91 -77 8.55439 0.258
NP_440984.1_7 Reverse -275 -289 11.8976 0.122
NP_440984.1_7 Forward -294 -280 6.29277 0.219
NP_439990.1_5 Reverse -275 -288 5.32916 0.298
NP_442911.1_2 Reverse -270 -289 3.73603 0.042
NP_442911.1_2 Forward -299 -280 -0.787193 0.0786
NP_441580.1_6 Reverse -269 -288 -4.72043 0.235
NP_440153.1_5 Forward -288 -274 12.4876 0.0645
NP_440993.1_3 Reverse -270 -289 3.04693 0.19
NP_440602.1_2 Reverse -275 -294 11.4058 0.162
NP_440138.1_6 Reverse -204 -223 3.14526 0.246
NP_440138.1_7 Reverse -270 -288 17.9545 0.245
NP_441099.1_5 Reverse -270 -289 11.0125 0.0257
NP_440809.1_9 Forward -260 -242 -1.35749 0.225
NP_440809.1_9 Forward -298 -280 -8.14232 0.227
NP_441294.1_7 Reverse -276 -290 12.2263 0.107
NP_441294.1_7 Forward -275 -261 11.5544 0.137
NP_442438.1_10 Reverse -275 -289 8.35772 0.0782
NP_441000.1_6 Reverse -279 -293 -3.83532 0.225
NP_441000.1_6 Forward -290 -276 -3.93365 0.225
NP_440147.1_4 Forward -291 -278 17.9155 0.00539
NP_440147.1_4 Reverse -278 -291 15.7522 0.0148
NP_440147.1_4 Reverse -349 -362 4.8375 0.146
NP_440147.1_4 Reverse -330 -343 3.36254 0.188
NP_441295.1_4 Reverse -275 -294 -2.85214 0.29
NP_441550.1_8 Forward -291 -281 15.8108 0.0132
NP_441550.1_8 Reverse -278 -288 15.1225 0.0132
NP_441916.1_7 Reverse -280 -290 18.9579 0.00144
NP_441916.1_7 Forward -289 -279 10.3048 0.0261
NP_441041.1_4 Forward -289 -270 0.0977854 0.0907
NP_441041.1_7 Forward -292 -280 13.3454 0.0485
NP_442004.1_6 Forward -289 -275 2.45787 0.264
NP_441725.1_4 Forward -294 -280 12.2903 0.0693
NP_441725.1_5 Forward -288 -278 2.04498 0.115
NP_441725.1_5 Reverse -281 -291 1.94665 0.115
NP_439966.1_7 Reverse -278 -288 15.3192 0.0152
NP_439966.1_7 Forward -291 -281 14.3359 0.0203
NP_442941.1_3 Forward -288 -278 19.2529 0.00262
NP_442941.1_3 Reverse -281 -291 19.2529 0.00262
NP_440289.1_2 Forward -292 -279 3.16588 0.0811
NP_440289.1_2 Reverse -277 -290 -3.61896 0.267
NP_440289.1_7 Reverse -329 -348 4.62101 0.257
NP_441076.1_3 Forward -30 -11 15.2399 0.148
NP_442281.1_1 Forward -294 -280 15.6336 0.0113
NP_442281.1_1 Reverse -275 -289 7.86545 0.0907
NP_442281.1_1 Reverse -346 -360 7.07881 0.108
NP_442281.1_1 Forward -46 -32 1.5723 0.296
NP_442256.1_2 Forward -291 -273 1.98577 0.107
NP_440437.1_1 Reverse -143 -162 -0.295539 0.178
NP_441556.1_10 Reverse -275 -289 16.8407 0.102
NP_440498.1_1 Forward -298 -280 -1.16082 0.222
NP_441644.1_6 Reverse -280 -290 19.0557 0.000803
NP_441644.1_6 Forward -289 -279 17.3841 0.00127
NP_441644.1_6 Forward -11 -1 7.0594 0.137
NP_441795.1_7 Reverse -4 -23 20.1278 0.156
NP_442177.1_3 Reverse -372 -391 14.4541 0.279
NP_442029.1_6 Forward -294 -275 11.4058 0.16
NP_442029.1_10 Forward -48 -29 10.3242 0.204
NP_440929.1_8 Forward -289 -280 19.2726 0.000701
NP_440929.1_8 Reverse -280 -289 19.2726 0.000701
NP_440469.1_3 Forward -297 -278 16.4207 0.251
NP_440780.1_1 Reverse -8 -27 7.11373 0.287
NP_442933.1_10 Forward -289 -280 17.601 0.00325
NP_442933.1_10 Reverse -280 -289 17.601 0.00325
NP_441751.2_8 Reverse -281 -295 5.1128 0.0448
NP_442926.1_3 Reverse -263 -282 7.17762 0.19
NP_442554.1_4 Forward -152 -133 10.7175 0.276
NP_442554.1_8 Reverse -281 -291 17.2863 0.00543
NP_442554.1_8 Forward -288 -278 16.2046 0.0065
NP_442075.1_4 Reverse -154 -173 11.7008 0.255
NP_441762.1_7 Reverse -303 -315 -3.50094 0.11
NP_441762.1_7 Forward -290 -278 -6.64753 0.284
NP_441762.1_7 Reverse -279 -291 -6.84419 0.284
NP_442142.1_4 Forward -292 -279 12.9 0.0406
NP_442142.1_4 Reverse -277 -290 4.93527 0.206
NP_442292.1_1 Forward -288 -279 18.486 0.00229
NP_442292.1_1 Reverse -281 -290 17.5026 0.00435
NP_442292.1_1 Reverse -156 -165 5.21127 0.152
NP_442476.1_6 Forward -288 -274 13.5693 0.0417
NP_442476.1_6 Reverse -281 -295 2.35953 0.186
NP_440895.1_6 Forward -295 -282 9.16406 0.228
NP_442381.1_8 Reverse -277 -296 -14.9469 0.29
NP_441523.1_6 Forward -293 -274 7.66927 0.191
NP_441523.1_6 Reverse -276 -295 6.58763 0.212
NP_443009.1_5 Reverse -279 -290 14.5128 0.02
NP_443009.1_5 Forward -290 -279 10.1862 0.0792
NP_443009.1_5 Reverse -382 -393 4.58141 0.239
NP_441865.1_3 Forward -37 -19 16.2438 0.185
NP_441715.1_4 Forward -288 -278 17.3846 0.0106
NP_441715.1_4 Reverse -281 -291 16.7946 0.0106
NP_440357.1_3 Reverse -201 -220 1.17943 0.275
NP_440379.1_5 Reverse -265 -284 5.99764 0.133
NP_440379.1_5 Reverse -276 -295 -9.73531 0.264
NP_441468.1_1 Forward -288 -281 15.8704 0.0124
NP_441468.1_1 Reverse -281 -288 15.8704 0.0124
NP_441468.1_1 Forward -163 -156 3.97235 0.277
NP_441015.1_10 Forward -294 -275 9.73422 0.0723
NP_441673.1_1 Forward -289 -280 20.8459 0.000698
NP_441673.1_1 Reverse -280 -289 20.8459 0.000698
NP_442253.1_7 Forward -214 -200 15.7325 0.226
NP_441956.1_9 Reverse -273 -292 5.50599 0.274
NP_441826.1_2 Reverse -274 -288 5.40779 0.0975
NP_441826.1_5 Forward -288 -269 9.43923 0.2
NP_441330.1_1 Forward -294 -275 -12.3902 0.183
NP_441637.1_9 Reverse -324 -342 -3.02911 0.293
NP_441764.1_4 Forward -123 -106 11.2231 0.231
NP_442868.1_6 Reverse -278 -288 19.2529 0.00563
NP_442868.1_6 Forward -291 -281 10.4031 0.038
NP_441612.1_2 Forward -289 -279 8.54929 0.21
NP_442427.1_8 Forward -298 -279 11.4058 0.152
NP_442808.1_1 Forward -290 -280 8.73102 0.0481
NP_442808.1_1 Reverse -279 -289 8.63269 0.0481
NP_442775.1_6 Forward -163 -144 9.73422 0.292
NP_440145.1_3 Forward -299 -280 -5.70374 0.275
NP_442542.1_2 Forward -291 -278 7.88576 0.168
NP_442113.1_10 Reverse -171 -190 -9.24366 0.295
NP_442050.1_5 Forward -291 -281 15.9091 0.0091
NP_442050.1_5 Reverse -278 -288 14.3359 0.0206
NP_440601.1_7 Forward -228 -214 15.4376 0.278
NP_440558.1_2 Reverse -265 -284 -5.11376 0.253
NP_440558.1_2 Forward -298 -279 -6.98204 0.284
NP_440093.1_7 Reverse -92 -111 11.0125 0.276
NP_441878.1_6 Forward -290 -280 10.5014 0.0176
NP_441878.1_6 Reverse -279 -289 10.4031 0.0176
NP_441878.1_6 Reverse -1 -11 -7.39479 0.222
NP_441878.1_6 Reverse -312 -322 -7.49312 0.231
NP_441036.1_8 Forward -290 -280 15.713 0.00724
NP_441036.1_8 Reverse -279 -289 8.33817 0.174
NP_441557.1_4 Reverse -5 -19 9.5377 0.291
NP_441557.1_5 Forward -289 -280 19.9609 0.000699
NP_441557.1_5 Reverse -280 -289 19.9609 0.000699
NP_441445.1_1 Forward -298 -279 4.52268 0.193
NP_441445.1_1 Forward -239 -220 0.196116 0.281
NP_441590.1_2 Forward -223 -210 17.6205 0.295
NP_441433.1_8 Forward -314 -295 -0.590531 0.248
NP_442777.1_1 Forward -321 -302 4.22689 0.3
NP_442419.1_2 Reverse -275 -294 4.42435 0.184
NP_440101.1_3 Forward -294 -275 2.16274 0.259
NP_442830.1_5 Forward -86 -72 -1.77094 0.299
NP_442183.1_1 Reverse -280 -294 5.40779 0.218
NP_442397.1_9 Reverse -344 -363 4.03102 0.26
NP_441819.1_5 Reverse -132 -151 15.4215 0.195
NP_441549.1_9 Reverse -276 -294 5.72234 0.0925
NP_442347.1_2 Forward -288 -279 12.4878 0.056
NP_442347.1_2 Reverse -281 -290 3.34298 0.284
NP_442645.1_2 Reverse -272 -291 -21.7317 0.29
NP_441037.1_4 Forward -291 -281 7.22024 0.237
NP_442594.1_8 Forward -245 -226 2.94938 0.291
NP_441633.1_3 Reverse -278 -291 3.36254 0.0699
NP_441633.1_3 Forward -291 -278 -3.71729 0.177
NP_440136.1_2 Forward -288 -281 15.9687 0.0123
NP_440136.1_2 Reverse -281 -288 15.9687 0.0123
NP_442590.1_10 Forward -289 -270 5.211 0.267
NP_442998.1_10 Forward -287 -280 15.5754 0.0102
NP_442998.1_10 Reverse -282 -289 15.5754 0.0102
NP_440299.1_1 Reverse -276 -289 17.9149 0.00502
NP_441799.1_1 Forward -293 -279 14.3553 0.0242
NP_441799.1_1 Reverse -276 -290 9.43874 0.0922
NP_441007.1_10 Forward -294 -281 3.36254 0.182
NP_441007.1_10 Reverse -275 -288 -0.669033 0.287
NP_442201.1_10 Reverse -269 -288 -14.9469 0.295
NP_440256.1_1 Forward -292 -273 11.8975 0.0134
NP_440256.1_1 Reverse -277 -296 4.62101 0.0429
NP_441559.1_8 Reverse -275 -289 2.94952 0.143
NP_441559.1_8 Forward -397 -383 2.5562 0.143
NP_441559.1_8 Forward -294 -280 1.57289 0.155
NP_441559.1_8 Reverse -188 -202 -5.80194 0.27
NP_440915.1_5 Forward -185 -166 14.8111 0.283
NP_440915.1_6 Reverse -276 -290 11.8976 0.0236
NP_440915.1_6 Forward -293 -279 1.08123 0.147
NP_440717.1_1 Forward -277 -258 8.94757 0.251
NP_442785.1_7 Forward -291 -277 20.9441 0.0439
NP_442785.1_7 Forward -280 -266 8.94771 0.279
NP_440702.1_2 Forward -232 -213 -8.65367 0.299
NP_440026.1_7 Forward -294 -279 14.4346 0.251
NP_441939.1_3 Forward -288 -269 12.8808 0.0961
NP_441939.1_3 Reverse -281 -300 12.1925 0.103
NP_441939.1_3 Reverse -352 -371 7.07928 0.212
NP_442993.1_1 Reverse -280 -296 -11.1512 0.235
NP_442386.1_9 Reverse -279 -288 13.8639 0.0289
NP_442386.1_9 Forward -290 -281 6.39082 0.219
NP_441340.1_5 Forward -288 -281 15.6737 0.0124
NP_441340.1_5 Reverse -281 -288 15.6737 0.0124
NP_441340.1_5 Reverse -156 -163 4.07068 0.239
NP_442484.1_2 Reverse -269 -288 9.3409 0.131
NP_440168.1_9 Reverse -192 -211 -2.65548 0.283
NP_442240.1_2 Forward -288 -269 -12.1936 0.159
NP_441160.1_3 Forward -158 -139 -2.75381 0.228
NP_440586.1_8 Forward -288 -281 13.2151 0.026
NP_440586.1_8 Reverse -281 -288 13.2151 0.026
NP_440586.1_8 Reverse -156 -163 12.8218 0.0395
NP_440586.1_8 Forward -334 -327 7.1186 0.272
NP_442251.1_6 Forward -288 -281 15.2804 0.0124
NP_442251.1_6 Reverse -281 -288 15.2804 0.0124
NP_440192.1_4 Forward -215 -196 8.9125 0.289
NP_441262.1_3 Reverse -280 -287 14.7888 0.0223
NP_441262.1_3 Forward -289 -282 14.7888 0.0223
NP_440027.1_8 Reverse -277 -296 11.8967 0.214
NP_440027.1_8 Forward -292 -273 5.50519 0.279
NP_440027.1_8 Reverse -266 -285 5.50519 0.279
NP_440027.1_8 Forward -286 -267 5.01354 0.285
NP_443051.1_1 Forward -290 -281 19.5676 0.00335
NP_443051.1_1 Reverse -279 -288 10.4228 0.00754
NP_443051.1_5 Reverse -97 -116 4.52268 0.283
NP_439937.1_9 Forward -214 -197 -13.3348 0.285
NP_439937.1_9 Forward -290 -273 -15.9897 0.287
NP_439937.1_9 Reverse -191 -208 -17.268 0.296
NP_440408.1_7 Forward -289 -270 7.96426 0.284
NP_440408.1_7 Forward -283 -264 7.66927 0.284
NP_440439.1_1 Reverse -277 -290 11.1307 0.0339
NP_440439.1_1 Forward -292 -279 10.934 0.0339
NP_439943.1_7 Reverse -275 -294 9.63589 0.168
NP_440372.1_2 Forward -288 -281 16.3621 0.0124
NP_440372.1_2 Reverse -281 -288 16.3621 0.0124
NP_440316.1_10 Reverse -1 -11 16.9913 0.153
NP_441803.1_2 Forward -294 -275 4.42435 0.178
NP_439977.1_5 Forward -295 -276 4.32602 0.153
NP_441572.1_7 Reverse -274 -293 -1.18052 0.186
NP_441572.1_7 Forward -295 -276 -2.36049 0.193
NP_440267.1_2 Forward -294 -280 12.5853 0.125
NP_442384.1_10 Forward -289 -276 22.4387 0.00194
NP_442384.1_10 Reverse -280 -293 9.95071 0.047
NP_442262.1_10 Forward -288 -281 14.1988 0.0123
NP_442262.1_10 Reverse -281 -288 14.1988 0.0123
NP_442262.1_10 Reverse -156 -163 10.3639 0.153
NP_442262.1_10 Forward -10 -3 8.8889 0.219
NP_441689.1_5 Forward -291 -281 8.3377 0.132
NP_441689.1_5 Reverse -278 -288 5.78111 0.197
NP_440344.1_10 Forward -296 -279 -6.05768 0.111
NP_440344.1_10 Reverse -356 -373 -10.2859 0.174
NP_440344.1_10 Reverse -335 -352 -11.9575 0.235
NP_440282.1_10 Reverse -359 -378 -10.1286 0.294
NP_441060.1_6 Forward -283 -267 13.1366 0.254
NP_441965.1_3 Reverse -270 -289 14.1591 0.076
NP_441965.1_10 Reverse -277 -293 7.04003 0.157
NP_440297.1_9 Forward -288 -278 -0.118297 0.282
NP_440297.1_9 Reverse -281 -291 -0.216628 0.282
NP_440297.1_9 Forward -163 -153 -0.511621 0.289
NP_442280.1_10 Forward -45 -27 4.96742 0.291
NP_441592.1_4 Reverse -2 -21 -3.3438 0.28
NP_441103.1_9 Forward -82 -72 12.3919 0.298
NP_440999.1_9 Reverse -276 -290 6.58777 0.0964
NP_440999.1_9 Forward -293 -279 0.687908 0.177
NP_440999.1_9 Reverse -347 -361 -2.85201 0.279
NP_440888.1_2 Forward -289 -275 19.7634 0.000978
NP_440888.1_2 Reverse -280 -294 11.5037 0.0657
NP_440888.1_2 Reverse -351 -365 6.58715 0.228
NP_440052.1_5 Reverse -269 -288 -2.65548 0.214
NP_442948.1_2 Forward -290 -271 4.52268 0.26
NP_442033.1_10 Forward -291 -272 -8.85033 0.207
NP_440575.1_8 Forward -114 -95 1.17943 0.18
NP_440575.1_8 Forward -115 -96 -2.75381 0.239
NP_441543.1_2 Forward -288 -279 16.9127 0.00359
NP_441543.1_2 Reverse -281 -290 15.9293 0.00518
NP_442845.1_2 Forward -289 -275 7.37441 0.195
NP_442845.1_2 Reverse -274 -288 6.19444 0.215
NP_442845.1_2 Forward -295 -281 4.81781 0.251
NP_441551.1_5 Reverse -276 -292 8.31764 0.238
NP_441469.1_8 Forward -290 -281 6.5879 0.227
NP_441469.1_8 Reverse -279 -288 6.48957 0.227
NP_441469.1_8 Reverse -154 -163 5.50626 0.265
NP_441469.1_8 Forward -352 -343 5.3096 0.277
NP_443064.1_6 Forward -289 -279 12.5669 0.0796
NP_443064.1_6 Reverse -280 -290 10.8217 0.13
NP_442646.1_9 Reverse -182 -201 10.7175 0.242
NP_442578.1_7 Forward -288 -281 14.5921 0.026
NP_442578.1_7 Reverse -281 -288 14.5921 0.026
NP_440148.1_1 Reverse -19 -38 -0.590531 0.219
NP_441462.1_2 Reverse -280 -290 20.2362 0.000805
NP_441462.1_2 Forward -289 -279 11.5831 0.00406
NP_441621.1_7 Reverse -278 -292 -5.21195 0.248
NP_441929.1_6 Forward -276 -257 4.32602 0.294
NP_443062.1_1 Reverse -280 -298 7.08331 0.185
NP_443062.1_1 Forward -289 -271 5.71821 0.22
NP_441601.1_2 Reverse -345 -364 -4.13045 0.28
NP_441410.1_3 Forward -298 -279 5.50599 0.236
NP_442204.1_1 Forward -293 -282 11.3667 0.0565
NP_442204.1_1 Reverse -276 -287 9.79344 0.0736
NP_442204.1_2 Forward -299 -280 9.3409 0.225
NP_440516.1_8 Forward -289 -280 16.9127 0.00442
NP_440516.1_8 Reverse -280 -289 16.9127 0.00442
NP_440516.1_8 Reverse -2 -11 -0.491928 0.262
NP_442428.1_5 Forward -288 -281 15.8704 0.0124
NP_442428.1_5 Reverse -281 -288 15.8704 0.0124
NP_442428.1_5 Forward -163 -156 4.36568 0.271
NP_442859.1_2 Reverse -275 -294 5.60432 0.201
NP_440673.1_3 Forward -287 -280 12.4288 0.0426
NP_440673.1_3 Reverse -282 -289 12.4288 0.0426
NP_440673.1_3 Forward -9 -2 8.98723 0.203
NP_441714.1_3 Forward -367 -349 14.178 0.196
NP_440865.1_9 Forward -295 -276 7.7676 0.0657
NP_441052.1_2 Forward -289 -279 19.9412 0.00106
NP_441052.1_2 Reverse -280 -290 10.4031 0.0285
NP_441052.1_2 Forward -17 -7 3.12662 0.184
NP_442219.1_9 Forward -288 -279 17.7976 0.00718
NP_442219.1_9 Reverse -281 -290 8.25953 0.0681
NP_440436.1_4 Forward -288 -279 17.2072 0.00233
NP_440436.1_4 Reverse -281 -290 9.24241 0.0871
NP_441884.1_9 Reverse -348 -367 -11.2103 0.103
NP_441884.1_9 Forward -292 -273 -22.6167 0.281
NP_440314.1_9 Forward -288 -269 -9.047 0.258
NP_442577.1_9 Forward -149 -135 11.5037 0.253
NP_441719.1_4 Forward -288 -281 16.3621 0.0124
NP_441719.1_4 Reverse -281 -288 16.3621 0.0124
NP_441115.1_4 Forward -290 -272 14.9646 0.0464
NP_442206.1_4 Reverse -281 -300 7.57094 0.259
NP_442854.1_6 Forward -289 -270 1.17943 0.285
NP_440328.1_4 Reverse -274 -293 16.6174 0.0282
NP_441851.1_10 Reverse -279 -289 15.8113 0.00552
NP_441851.1_10 Forward -290 -280 8.53483 0.114
NP_441851.1_10 Forward -213 -203 3.91327 0.296
NP_442622.1_1 Reverse -174 -193 -7.86702 0.257
NP_441668.1_4 Forward -303 -284 7.27595 0.151
NP_442515.1_1 Forward -272 -258 5.70279 0.107
NP_442515.1_1 Reverse -279 -293 3.04785 0.125
NP_442515.1_1 Forward -290 -276 0.491246 0.19
NP_442515.1_1 Reverse -7 -21 -4.62196 0.298
NP_440593.1_3 Reverse -275 -294 -6.09707 0.27
NP_442689.1_8 Forward -123 -106 -6.64766 0.286
NP_441349.1_10 Forward -299 -280 8.75091 0.026
NP_441349.1_10 Reverse -270 -289 -5.60541 0.207
NP_441409.1_6 Reverse -274 -293 8.06259 0.0261
NP_441409.1_6 Forward -295 -276 -15.3402 0.29
NP_440432.1_9 Reverse -281 -296 -4.05167 0.196
NP_440432.1_9 Forward -288 -273 -5.32998 0.245
NP_442843.1_1 Reverse -376 -395 -9.047 0.264
NP_440474.1_8 Forward -163 -149 10.2254 0.143
NP_441477.1_10 Reverse -273 -291 7.00065 0.181
NP_441124.1_5 Forward -31 -21 15.8729 0.188
NP_441124.1_5 Reverse -251 -261 10.8118 0.283
NP_440588.1_2 Reverse -271 -290 -4.13045 0.207
NP_442243.1_1 Reverse -274 -292 -2.63651 0.295
NP_441570.1_1 Forward -289 -271 -7.94566 0.0989
NP_441078.1_4 Forward -289 -280 19.6659 0.0007
NP_441078.1_4 Reverse -280 -289 19.6659 0.0007
NP_442729.1_8 Reverse -338 -351 4.44418 0.3
NP_442348.1_2 Forward -178 -169 7.07956 0.291
NP_440526.1_3 Forward -288 -277 0.943182 0.267
NP_441432.1_8 Reverse -279 -288 16.8143 0.00595
NP_441432.1_8 Forward -290 -281 16.8143 0.00595
NP_441432.1_8 Reverse -1 -10 3.83464 0.243
NP_442320.1_8 Reverse -274 -288 5.30946 0.0394
NP_442320.1_8 Forward -295 -281 -0.983719 0.0817
NP_441732.1_2 Forward -293 -277 3.00846 0.0141
NP_441732.1_2 Reverse -276 -292 -16.0677 0.164
NP_441732.1_2 Forward -345 -329 -16.5594 0.174
NP_440290.1_1 Forward -31 -22 15.65 0.292
NP_442003.1_4 Forward -288 -269 12.3892 0.27
NP_440760.1_1 Forward -289 -270 -12.5869 0.0942
NP_442797.1_2 Forward -294 -276 13.4343 0.239
NP_441057.1_4 Forward -228 -210 -2.14413 0.272
NP_442298.1_10 Forward -212 -193 10.8159 0.262
NP_441072.1_2 Reverse -66 -85 5.40766 0.296
NP_440713.1_4 Reverse -270 -289 3.6377 0.24
NP_442489.1_7 Forward -289 -280 20.1576 0.000695
NP_442489.1_7 Reverse -280 -289 20.1576 0.000695
NP_440559.1_1 Forward -288 -279 17.4043 0.00658
NP_440559.1_1 Reverse -281 -290 8.65285 0.0586
NP_441659.2_8 Reverse -280 -290 20.9245 0.000805
NP_441659.2_8 Forward -289 -279 18.1713 0.00133
NP_442913.1_10 Reverse -271 -290 8.45592 0.0477
NP_442008.1_2 Forward -292 -273 4.81767 0.232
NP_442776.1_1 Reverse -269 -288 6.29264 0.231
NP_442346.1_5 Reverse -279 -289 16.6963 0.00248
NP_442346.1_5 Forward -290 -280 16.303 0.00248
NP_440545.1_3 Forward -293 -276 6.52869 0.0551
NP_440545.1_3 Reverse -276 -293 5.44704 0.0616
NP_440545.1_3 Forward -168 -151 4.16874 0.0738
NP_441856.1_3 Reverse -5 -24 4.62101 0.151
NP_441856.1_3 Reverse -277 -296 0.982764 0.213
NP_440459.1_2 Forward -291 -274 14.1985 0.119
NP_440459.1_2 Reverse -271 -288 11.5436 0.173
NP_441653.1_2 Reverse -269 -288 15.029 0.079
NP_440010.1_4 Reverse -208 -227 10.6184 0.157
NP_442603.1_7 Forward -289 -275 21.5334 0.00436
NP_441888.1_7 Reverse -275 -289 4.03116 0.225
NP_440170.1_6 Forward -294 -275 14.9458 0.183
NP_441833.1_4 Forward -288 -281 15.9687 0.0124
NP_441833.1_4 Reverse -281 -288 15.9687 0.0124
NP_441329.1_6 Reverse -18 -37 10.1695 0.111
NP_441329.1_6 Forward -144 -125 3.00757 0.217
NP_442060.1_3 Reverse -252 -271 20.1564 0.116
NP_442699.1_8 Reverse -36 -55 -2.95047 0.218
NP_442162.1_9 Forward -288 -281 16.2637 0.0124
NP_442162.1_9 Reverse -281 -288 16.2637 0.0124
NP_442055.1_6 Forward -58 -39 13.7658 0.256
NP_440671.1_4 Forward -295 -281 7.07942 0.227
NP_440224.1_1 Reverse -269 -288 11.7992 0.0566
NP_442943.1_1 Forward -141 -126 9.42208 0.19
NP_442073.1_6 Forward -298 -279 2.16274 0.25
NP_442199.1_5 Forward -297 -278 17.8957 0.0212
NP_442140.1_3 Forward -288 -278 10.3048 0.0902
NP_442140.1_3 Reverse -281 -291 4.69992 0.238
NP_441671.1_10 Reverse -26 -45 9.0459 0.189
NP_440875.1_9 Reverse -282 -292 16.5483 0.0145
NP_441813.1_5 Reverse -278 -288 18.1713 0.00743
NP_441813.1_5 Forward -291 -281 18.1713 0.00743
NP_440590.1_4 Forward -288 -275 21.3571 0.00401
NP_440590.1_4 Reverse -281 -294 -5.38892 0.277
NP_440567.1_1 Forward -288 -274 9.73436 0.0422
NP_440567.1_1 Reverse -281 -295 2.94952 0.157
NP_442497.1_10 Reverse -281 -290 17.601 0.00813
NP_442497.1_10 Forward -288 -279 10.4228 0.0087
NP_440821.1_4 Reverse -278 -288 9.41981 0.0286
NP_440821.1_4 Forward -291 -281 2.24165 0.131
NP_441239.1_9 Forward -291 -279 13.0187 0.0389
NP_441239.1_9 Reverse -278 -290 5.25052 0.223
NP_441727.1_3 Forward -296 -277 4.42435 0.262
NP_442193.1_1 Forward -230 -212 14.3755 0.187
NP_442643.1_5 Forward -275 -256 3.83436 0.25
NP_441769.1_3 Reverse -236 -255 -4.72118 0.245
NP_440833.1_6 Forward -303 -289 7.76712 0.278
NP_440546.1_4 Reverse -280 -290 13.5365 0.0459
NP_440546.1_4 Forward -289 -279 10.046 0.109
NP_440462.1_6 Forward -291 -281 18.7612 0.00454
NP_440462.1_6 Reverse -278 -288 9.61647 0.0429
NP_442611.1_1 Reverse -269 -288 -1.96717 0.284
NP_440868.1_4 Forward -293 -281 14.7886 0.0169
NP_440868.1_4 Reverse -276 -288 10.5604 0.0364
NP_442479.1_9 Reverse -134 -153 1.37609 0.191
NP_442479.1_9 Reverse -19 -38 -13.4719 0.288
NP_442402.1_10 Reverse -354 -364 12.8609 0.204
NP_441848.1_4 Forward -124 -108 7.07321 0.297
NP_441084.1_6 Forward -291 -277 10.7015 0.231
NP_442039.1_4 Forward -288 -281 15.1821 0.0124
NP_442039.1_4 Reverse -281 -288 15.1821 0.0124
NP_442039.1_7 Reverse -4 -14 9.61647 0.257
NP_441811.1_1 Forward -20 -1 5.60432 0.28
NP_441811.1_8 Forward -170 -156 9.63603 0.227
NP_440008.1_9 Reverse -286 -305 6.29264 0.293
NP_442409.1_10 Forward -89 -75 17.0102 0.253
NP_442837.1_3 Forward -288 -281 15.7721 0.0124
NP_442837.1_3 Reverse -281 -288 15.7721 0.0124
NP_442053.1_1 Forward -289 -280 18.3876 0.0007
NP_442053.1_1 Reverse -280 -289 18.3876 0.0007
NP_440505.1_3 Reverse -278 -288 18.3679 0.00213
NP_440505.1_3 Forward -291 -281 17.188 0.00332
NP_440505.1_3 Forward -394 -384 7.05986 0.165
NP_440505.1_3 Reverse -191 -201 5.48657 0.227
NP_440914.1_1 Forward -289 -279 17.5935 0.000537
NP_440914.1_1 Reverse -280 -290 16.3248 0.00196
NP_440914.1_1 Reverse -2 -12 9.00547 0.186
NP_440914.1_1 Reverse -269 -279 7.63919 0.228
NP_440914.1_1 Reverse -203 -213 7.05364 0.254
NP_441011.1_8 Reverse -281 -290 16.6177 0.00602
NP_441011.1_8 Forward -288 -279 8.25953 0.144
NP_442101.1_9 Reverse -105 -124 17.5223 0.227
NP_442533.1_1 Forward -233 -214 -15.4385 0.254
NP_442533.1_6 Forward -289 -280 17.2076 0.00137
NP_442533.1_6 Reverse -280 -289 17.2076 0.00137
NP_442541.1_3 Reverse -211 -230 5.50599 0.244
NP_441482.1_7 Forward -295 -281 6.58777 0.0271
NP_441482.1_7 Reverse -274 -288 -10.0302 0.209
NP_441482.1_7 Forward -347 -333 -12.1934 0.29
NP_439944.1_9 Forward -288 -278 10.5014 0.0887
NP_439944.1_9 Reverse -281 -291 9.12481 0.1
NP_440116.1_8 Forward -288 -269 -1.67217 0.12
NP_441527.1_7 Forward -89 -70 13.0766 0.282
NP_440115.1_6 Reverse -277 -287 15.0247 0.0505
NP_440115.1_6 Forward -292 -282 14.0414 0.0615
NP_440115.1_6 Forward -230 -220 5.68323 0.227
NP_440007.1_4 Forward -300 -281 17.6007 0.104
NP_440007.1_9 Forward -293 -279 0.786239 0.29
NP_440007.1_9 Reverse -276 -290 0.392915 0.298
NP_441347.1_5 Forward -295 -281 12.782 0.238
NP_441602.1_3 Reverse -275 -294 -5.40875 0.285
NP_441972.1_5 Forward -288 -269 11.1109 0.0536
NP_441106.1_1 Forward -290 -281 18.486 0.0028
NP_441106.1_1 Reverse -279 -288 9.63616 0.0311
NP_441106.1_3 Forward -149 -130 10.3242 0.278
NP_442306.1_10 Reverse -275 -294 -18.5851 0.197
NP_441286.1_1 Reverse -279 -291 5.93884 0.0258
NP_441286.1_1 Forward -290 -278 3.48056 0.0467
NP_440670.1_8 Forward -289 -280 18.3876 0.000699
NP_440670.1_8 Reverse -280 -289 18.3876 0.000699
NP_441479.1_1 Forward -356 -337 10.9142 0.211
NP_441930.1_2 Reverse -1 -11 14.828 0.19
NP_440886.1_7 Reverse -223 -233 11.6809 0.0805
NP_440886.1_7 Forward -290 -280 8.04271 0.0805
NP_440886.1_7 Reverse -279 -289 7.94438 0.0805
NP_442614.1_2 Forward -289 -275 7.07942 0.275
NP_442072.1_9 Forward -290 -272 -11.9772 0.0799
NP_440907.2_8 Reverse -281 -291 9.616 0.103
NP_441021.1_1 Forward -288 -269 11.3075 0.0299
NP_440841.1_4 Reverse -278 -297 -5.60541 0.208
NP_442459.1_7 Reverse -106 -125 -0.197208 0.272
NP_441463.1_3 Forward -299 -280 -1.47551 0.141
NP_441463.1_3 Forward -222 -203 -7.17871 0.255
NP_441463.1_3 Reverse -270 -289 -8.85033 0.274
NP_442842.1_4 Forward -288 -269 2.55606 0.265
NP_441626.1_2 Forward -288 -281 15.7721 0.0124
NP_441626.1_2 Reverse -281 -288 15.7721 0.0124
NP_442211.1_3 Forward -164 -145 7.18021 0.288
NP_442365.1_7 Reverse -276 -295 0.58944 0.177
NP_442794.1_1 Reverse -276 -288 10.4621 0.0721
NP_442794.1_1 Reverse -214 -226 3.18557 0.286
NP_442615.1_1 Forward -298 -280 8.96727 0.0266
NP_440387.1_1 Forward -289 -273 -2.00642 0.145
NP_440387.1_1 Reverse -313 -329 -6.52964 0.292
NP_441431.1_2 Forward -292 -278 6.68548 0.263
NP_441431.1_3 Forward -230 -211 4.32602 0.263
NP_441488.1_8 Reverse -275 -289 9.14375 0.168
NP_441488.1_8 Reverse -352 -366 8.16044 0.204
NP_441836.1_2 Forward -295 -276 -1.7705 0.223
NP_441836.1_2 Reverse -26 -45 -4.72043 0.262
NP_441993.1_1 Reverse -274 -293 12.8619 0.0902
NP_440114.1_10 Reverse -280 -294 12.1926 0.0885
NP_442323.1_7 Reverse -275 -294 8.06178 0.163
NP_440766.1_5 Reverse -41 -53 10.5205 0.27
NP_441237.1_9 Reverse -156 -166 11.9764 0.146
NP_439910.1_2 Forward -297 -280 -22.184 0.215
NP_439910.1_2 Reverse -272 -289 -22.2823 0.22
NP_442867.1_8 Reverse -176 -195 5.50599 0.276
NP_440457.1_1 Reverse -276 -288 8.20045 0.101
NP_440457.1_1 Forward -293 -281 0.727295 0.25
NP_440798.1_6 Reverse -281 -294 0.707601 0.251
NP_441984.1_3 Forward -293 -275 5.91901 0.276
NP_441436.1_8 Forward -272 -253 9.93088 0.262
NP_440473.1_1 Forward -292 -273 14.6316 0.144
NP_442509.1_9 Forward -289 -279 8.14104 0.192
NP_442509.1_9 Reverse -280 -290 8.04271 0.192
NP_441489.1_3 Forward -149 -135 8.98786 0.232
YP_003858595.1_6 Forward -103 -84 9.63507 0.135
NP_441765.1_4 Forward -249 -230 15.1424 0.138
NP_440554.1_4 Reverse -281 -291 17.9746 0.0131
NP_440554.1_4 Forward -288 -278 8.92815 0.0646
NP_442862.1_3 Reverse -135 -152 7.31533 0.258
NP_442737.1_5 Forward -228 -209 12.2972 0.264
NP_441885.1_5 Forward -289 -279 20.9245 0.000538
NP_441885.1_5 Reverse -280 -290 11.3864 0.00668
NP_441885.1_5 Reverse -344 -354 -1.78992 0.284
NP_440478.1_4 Forward -293 -274 16.7157 0.128
NP_440478.1_10 Forward -291 -277 8.55439 0.257
NP_442341.1_7 Forward -290 -276 2.35953 0.259
NP_442341.1_9 Forward -291 -277 10.2254 0.136
NP_441756.1_5 Reverse -359 -378 -0.000545616 0.242
NP_441173.1_9 Reverse -139 -147 13.2937 0.17
NP_443000.1_7 Forward -291 -281 20.3345 0.00223
NP_443000.1_7 Reverse -278 -288 19.9412 0.00223
NP_441842.1_1 Forward -287 -274 17.2266 0.0342
NP_440275.1_3 Forward -291 -281 16.1063 0.0155
NP_440275.1_3 Reverse -278 -288 15.123 0.0182
NP_442638.1_3 Reverse -130 -149 10.074 0.298
NP_440175.1_7 Reverse -276 -294 9.65589 0.278
NP_440149.1_8 Forward -289 -270 -0.39387 0.147
NP_441105.1_3 Forward -300 -281 15.1424 0.0194
NP_442127.1_10 Reverse -350 -368 19.3903 0.152
NP_440216.1_1 Reverse -280 -294 15.1426 0.00419
NP_440216.1_1 Forward -289 -275 10.226 0.00589
NP_440216.1_1 Reverse -269 -283 -5.31028 0.126
NP_440216.1_9 Reverse -157 -166 13.3727 0.197
NP_440172.1_1 Reverse -280 -290 17.5813 0.00421
NP_440172.1_1 Forward -289 -279 15.0247 0.00945
NP_442371.1_1 Forward -305 -295 15.2208 0.173
NP_440249.1_2 Reverse -231 -241 14.4342 0.273
NP_442015.1_10 Reverse -276 -289 21.5538 0.00329
NP_442015.1_10 Forward -293 -280 3.75586 0.178
NP_441226.1_7 Forward -288 -281 14.4934 0.0123
NP_441226.1_7 Reverse -281 -288 14.4934 0.0123
NP_441111.1_7 Forward -288 -280 18.7023 0.00294
NP_441111.1_7 Reverse -281 -289 18.7023 0.00294
NP_442379.1_10 Reverse -273 -290 -1.53445 0.223
NP_441766.1_2 Forward -289 -280 17.5026 0.00297
NP_441766.1_2 Reverse -280 -289 17.5026 0.00297
NP_441766.1_2 Forward -313 -304 1.86802 0.271
NP_440416.1_1 Reverse -280 -299 -12.1936 0.272
NP_440416.1_9 Forward -296 -277 -3.3438 0.0743
NP_440416.1_9 Reverse -273 -292 -8.94866 0.123
NP_443052.1_9 Reverse -214 -233 -5.99873 0.276
NP_440820.2_4 Forward -365 -346 7.27595 0.228
NP_442154.1_1 Forward -226 -208 -12.4689 0.217
NP_442226.1_8 Reverse -22 -32 16.6963 0.164
NP_440261.1_5 Forward -288 -275 5.23083 0.045
NP_440261.1_5 Reverse -281 -294 -2.83231 0.0932
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTTTGCAGGGAATTCTCTCTACGCTCTGGTTAACCCGGTGGAGAATGCTGATATCCCGGCAGAAAGCCAACAAGTTAGTCTAGTGCCCCGTTCTCTGGAAGAATTGACCAGGCGATCGCCAGCGGATTGGCAACAGGCAGATTTAGAAAGTGATGATGAAAATTTAGATGGTAGCGGTCCTGAAGGTGGCGTTTCCTCCGAATTCCCGGCAAGATAGCTGAGGGGACTTGTGGTTTTCGATGGCAGTCAAATTTGGCAAAATACTTACAAGACTGTAGTAGTGCAAAAAATTTCGTTCCTGGTAAACAGTTTTCCGCCTCGCCCCTTGTTTGAATTGACAAGCAGGAATGTTTGTCCCAGCCTTGTCCTGCCAAAATTTTTAGGTTGTCCCCATTGCCC

CDS

ATGACCAGCAAAATCTTAGAAATTCAAGACCTGACGGTGAGCTTTGACGGCTTTAGGGCCCTCAACCATTTGACTTTTTCCATGAATCCGGGGGAATTGCGGGTAATTATTGGCCCCAACGGCGCAGGAAAAACAACTTTTTTAGACGTGATCACCGGTAAAGTTCAACCAACGGAAGGCCGGGTCCTATTCCAAGGCAAAGACATTCGTAAAATTCCGGAATATCGCATTGCCCGTCTGGGGGTGGGGCGGAAATTTCAAACTCCTAGGGTCTATCTCAATCTGACGGTGGCGGAAAATTTGGACTTGGCGGTAAACCGAAAAAAGTCCGTTTGGGGTACTTTGATGGGACAGGCTACCGGAGCTGAGCAGCGCAGTGTGGGAGGACTGTTGGAAACCATTGGCCTGACCCCCAAAGCTCACTTGGCGGCGGCCCTACTCTCCCACGGCGAAAAACAACGGCTTGAAATTGGCATGTTGGTGGCCCAGTCCCCCACTTTATTGTTGGTGGATGAGCCGGTGGCGGGATTGACTGATGAAGAAACGGAAAATGTGGGGGATTTGCTCTTGGCCCTGGCGGAAAGCCATTCCATCATTGTGATTGAACATGATATGGAGTTTGTGCGCCAAATTGCCCGCAAGGTGACAGTACTCCATCAGGGTTCAGTATTGTGTGAAGGTAACATGGACCAGATTCAAAATGATCCCAAAGTAATTGAAGTGTATTTAGGAGAAGCCCCCAGCCTTTCCCCCCAACAGTTTAAAATTCTTCGCACAGTGGCCGCTGTCGCCGCCGCCGACGGCAAAATTTCTGAGACAGAAATGGCGATTATTTTAGATAACCTCAGTCAGGTGTTTAAAGGCAGTGGATCTGATCCTCAGCATCTGCGACAGGAGTTGCAAGATTATTTGTTGCAGGGGGTTGAAGTGGACTTTGCTAACTTAACGGAAGAAATTCCCAAACAGGAAGACCGAGAATTGGTGTTGCGCCTGAGCCAAGAAATTGTGGCGGTACACCGACAAGAACCAGAACCTTTTTGGGAGTGGCAAGCCTATCAGGAATTACTGCGGGGTCTGAATTTACCCATCACGGCTATCAGTGTTGATGAGGATGGAGATTAG

Protein

MTSKILEIQDLTVSFDGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRIARLGVGRKFQTPRVYLNLTVAENLDLAVNRKKSVWGTLMGQATGAEQRSVGGLLETIGLTPKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAESHSIIVIEHDMEFVRQIARKVTVLHQGSVLCEGNMDQIQNDPKVIEVYLGEAPSLSPQQFKILRTVAAVAAADGKISETEMAIILDNLSQVFKGSGSDPQHLRQELQDYLLQGVEVDFANLTEEIPKQEDRELVLRLSQEIVAVHRQEPEPFWEWQAYQELLRGLNLPITAISVDEDGD