Your browser is old and dusty. Try Google Chrome!

Details for sll0763

ORF sll0763
Accession NP_442056.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -373 -359 2.16287 0.178
NP_441061.1_2 Forward -148 -134 1.76955 0.183
NP_440795.1_7 Reverse -366 -373 12.2322 0.0614
NP_441418.1_6 Forward -374 -355 -21.83 0.16
NP_441418.1_6 Reverse -348 -367 -28.2215 0.203
NP_441418.1_6 Reverse -365 -384 -29.4015 0.224
NP_441418.1_6 Forward -260 -241 -29.7948 0.238
NP_441480.1_1 Forward -341 -322 0.392778 0.287
NP_441453.1_4 Forward -374 -366 14.4741 0.019
NP_441453.1_4 Reverse -365 -373 6.90259 0.121
NP_441453.1_4 Reverse -94 -102 4.73931 0.252
NP_441960.1_3 Forward -254 -235 12.7459 0.291
NP_442151.1_6 Forward -374 -360 12.4876 0.0722
NP_441818.1_1 Forward -148 -137 10.5796 0.232
NP_441818.1_1 Forward -356 -345 9.89126 0.232
NP_441818.1_9 Reverse -357 -376 8.65258 0.112
NP_441818.1_9 Forward -272 -253 0.294447 0.191
NP_440226.1_1 Reverse -365 -384 9.43923 0.0726
NP_440226.1_1 Reverse -94 -113 1.57275 0.3
NP_440150.1_2 Forward -147 -128 4.71854 0.281
NP_440150.1_6 Reverse -345 -364 1.76941 0.284
NP_440996.1_2 Forward -90 -81 14.4544 0.293
NP_442655.1_10 Reverse -131 -150 -13.4719 0.266
NP_442173.1_1 Forward -373 -365 6.01761 0.2
NP_442173.1_1 Reverse -366 -374 5.62429 0.206
NP_442173.1_6 Reverse -39 -53 12.6843 0.154
NP_442752.1_4 Reverse -348 -355 10.8555 0.0846
NP_442752.1_4 Reverse -140 -147 10.5605 0.1
NP_442752.1_4 Reverse -94 -101 4.26735 0.293
NP_442752.1_4 Forward -374 -367 4.26735 0.293
NP_442975.1_10 Reverse -361 -375 2.8506 0.269
NP_442975.1_10 Forward -107 -93 2.5556 0.273
NP_440784.1_7 Forward -373 -366 6.23397 0.241
NP_440784.1_7 Reverse -366 -373 6.23397 0.241
NP_440061.1_9 Forward -376 -362 9.93039 0.134
NP_440061.1_9 Reverse -249 -263 9.34041 0.148
NP_440061.1_9 Forward -369 -355 5.50552 0.283
NP_441476.1_5 Reverse -21 -40 -1.27885 0.202
NP_441476.1_5 Forward -379 -360 -8.16202 0.296
NP_442062.1_8 Reverse -365 -375 9.7148 0.0559
NP_442062.1_8 Forward -374 -364 8.4365 0.075
NP_442062.1_8 Reverse -178 -188 3.42162 0.272
NP_441859.1_3 Forward -375 -356 2.26028 0.263
NP_440304.1_4 Reverse -363 -373 8.4365 0.0776
NP_442242.1_4 Forward -373 -366 11.8388 0.0776
NP_441200.1_4 Forward -244 -225 7.66927 0.272
NP_441594.1_6 Reverse -356 -375 12.5858 0.109
NP_441082.1_10 Forward -265 -252 13.3923 0.236
NP_441925.1_4 Reverse -244 -263 -10.2277 0.237
NP_441925.1_4 Reverse -278 -297 -10.326 0.239
NP_441925.1_4 Forward -366 -347 -16.8158 0.285
NP_441925.1_4 Reverse -242 -261 -16.9142 0.287
NP_440856.1_4 Forward -364 -345 -2.85214 0.222
NP_441083.1_5 Forward -374 -364 9.61647 0.0243
NP_441083.1_5 Forward -357 -347 7.25653 0.0608
NP_441083.1_5 Reverse -365 -375 1.55333 0.204
NP_441083.1_5 Reverse -154 -164 0.0783647 0.245
NP_441434.1_7 Reverse -367 -381 4.81781 0.225
NP_441738.1_2 Forward -185 -178 11.8385 0.0469
NP_441558.1_5 Reverse -363 -382 8.06259 0.162
NP_440209.1_1 Forward -374 -366 8.37755 0.0576
NP_440209.1_1 Reverse -365 -373 8.27922 0.0687
NP_442889.1_1 Reverse -224 -243 -12.4886 0.23
NP_441716.1_1 Reverse -134 -148 6.3911 0.198
NP_442111.1_4 Forward -375 -361 9.93102 0.0575
NP_441163.1_1 Forward -286 -269 4.95467 0.282
NP_441215.1_1 Reverse -80 -99 5.30933 0.298
NP_441533.1_7 Forward -147 -129 11.4247 0.299
NP_440906.1_5 Forward -373 -366 12.0355 0.0724
NP_440906.1_5 Reverse -366 -373 6.0373 0.262
NP_440747.1_10 Forward -377 -365 -2.4193 0.0434
NP_440747.1_10 Reverse -362 -374 -11.8591 0.161
NP_440747.1_10 Reverse -91 -103 -12.2524 0.254
NP_440747.1_10 Forward -360 -348 -12.3507 0.27
NP_440747.1_10 Forward -190 -178 -12.5474 0.297
NP_441130.1_10 Reverse -363 -377 7.57108 0.155
NP_441486.1_1 Forward -377 -363 -4.62196 0.204
NP_441880.2_10 Forward -373 -355 8.96727 0.263
NP_442850.1_8 Reverse -353 -372 17.1812 0.243
NP_440403.1_4 Forward -383 -364 -7.37537 0.241
NP_440403.1_10 Reverse -356 -375 2.94938 0.278
NP_440842.1_6 Reverse -280 -299 9.53674 0.298
NP_441014.1_8 Forward -360 -341 -4.6221 0.253
NP_441014.1_8 Reverse -15 -34 -5.99873 0.276
NP_443018.1_3 Forward -373 -366 5.84064 0.174
NP_443018.1_3 Reverse -366 -373 5.54565 0.187
NP_440376.1_1 Forward -374 -365 17.601 0.00222
NP_440376.1_1 Reverse -365 -374 9.63616 0.0385
NP_440376.1_1 Forward -260 -251 8.06287 0.0463
NP_440376.1_1 Forward -30 -21 -0.786921 0.293
NP_442687.1_7 Forward -375 -365 12.7631 0.0661
NP_442687.1_7 Reverse -364 -374 10.1081 0.0994
NP_442485.1_3 Reverse -346 -365 -1.47551 0.259
NP_441846.1_10 Reverse -347 -366 -10.522 0.19
NP_441846.1_10 Forward -34 -15 -15.1435 0.245
NP_441846.1_10 Reverse -348 -367 -22.715 0.264
NP_441422.1_7 Forward -376 -359 -0.649475 0.168
NP_440667.1_2 Forward -26 -7 -8.26035 0.289
NP_441950.1_7 Reverse -353 -372 -2.65548 0.201
NP_440360.1_5 Forward -155 -136 -4.81876 0.297
NP_440360.1_10 Forward -372 -358 2.75286 0.261
NP_442658.1_1 Reverse -363 -373 8.3377 0.199
NP_442658.1_1 Forward -376 -366 7.94438 0.199
NP_441855.2_4 Reverse -243 -262 13.1865 0.173
NP_441855.2_4 Reverse -357 -376 9.52306 0.275
NP_442544.1_2 Reverse -213 -227 -1.77037 0.287
NP_441414.1_9 Reverse -348 -367 -10.3253 0.28
NP_441414.1_9 Forward -357 -338 -10.522 0.287
NP_439968.1_2 Reverse -244 -263 11.995 0.297
NP_443061.1_4 Forward -60 -41 2.55606 0.233
NP_440607.1_5 Forward -47 -28 0.982764 0.262
NP_440607.1_5 Reverse -350 -369 -1.47551 0.297
NP_441487.1_9 Forward -394 -375 2.45773 0.18
NP_441487.1_9 Forward -366 -347 -2.75381 0.293
NP_442937.1_5 Forward -379 -360 13.4708 0.0906
NP_442937.1_5 Forward -277 -258 7.96426 0.237
NP_442321.1_4 Reverse -233 -252 -0.000545616 0.255
NP_441958.1_5 Reverse -364 -374 10.6981 0.0112
NP_441958.1_5 Forward -375 -365 2.53664 0.0409
NP_441958.1_5 Reverse -347 -357 -0.708283 0.221
NP_441127.1_1 Reverse -242 -256 7.9644 0.3
NP_442057.1_5 Forward -74 -56 18.4659 0.0926
NP_442836.1_5 Reverse -359 -378 5.80098 0.185
NP_442025.1_7 Reverse -94 -112 19.6758 0.11
NP_442911.1_2 Forward -197 -178 -8.16202 0.228
NP_441580.1_6 Reverse -354 -373 -6.68705 0.235
NP_441580.1_6 Forward -385 -366 -8.35868 0.258
NP_440153.1_8 Forward -368 -355 6.21414 0.172
NP_443055.1_6 Forward -374 -356 -0.276578 0.256
NP_443055.1_6 Reverse -243 -261 -0.473239 0.261
NP_443055.1_6 Forward -382 -364 -2.04653 0.287
NP_441891.1_8 Reverse -356 -375 13.3725 0.282
NP_441348.1_3 Forward -290 -271 14.2574 0.135
NP_441129.1_3 Forward -49 -30 -17.1101 0.281
NP_441099.1_5 Reverse -355 -374 -0.590531 0.0954
NP_441099.1_5 Forward -367 -348 -2.75381 0.126
NP_442002.1_1 Reverse -339 -357 -7.65067 0.251
NP_442002.1_9 Reverse -347 -354 14.1004 0.074
NP_441294.1_7 Forward -59 -45 13.0902 0.0747
NP_441294.1_7 Forward -378 -364 12.7062 0.0876
NP_441646.1_1 Reverse -358 -377 11.6025 0.098
NP_442438.1_10 Forward -118 -104 -0.885388 0.283
NP_442431.1_10 Reverse -360 -378 1.10079 0.26
NP_441000.1_5 Forward -141 -122 4.71854 0.284
NP_441000.1_6 Reverse -364 -378 14.2576 0.0396
NP_442771.1_1 Forward -376 -358 1.19912 0.081
NP_442870.1_1 Forward -264 -245 16.5191 0.139
NP_440147.1_4 Forward -376 -363 9.95071 0.0362
NP_440147.1_4 Reverse -363 -376 8.77074 0.0465
NP_440147.1_4 Forward -47 -34 2.37923 0.208
NP_441550.1_8 Reverse -363 -373 10.206 0.0733
NP_441916.1_7 Forward -374 -364 13.8447 0.0172
NP_441916.1_7 Reverse -365 -375 8.63316 0.0437
NP_441916.1_7 Forward -103 -93 6.07655 0.108
NP_441916.1_7 Reverse -94 -104 4.10993 0.19
NP_441041.1_4 Reverse -134 -153 -8.65367 0.205
NP_441041.1_4 Forward -357 -338 -13.7669 0.295
NP_441041.1_7 Forward -377 -365 8.58373 0.133
NP_440016.1_9 Forward -51 -32 10.6192 0.259
NP_440703.1_9 Reverse -276 -289 8.96682 0.226
NP_440703.1_9 Reverse -251 -264 8.67183 0.226
NP_441725.1_4 Reverse -360 -374 6.78381 0.262
NP_441725.1_5 Forward -373 -363 9.51814 0.0553
NP_441725.1_5 Forward -356 -346 1.455 0.135
NP_439966.1_7 Forward -376 -366 8.23937 0.14
NP_439966.1_7 Forward -359 -349 7.94438 0.145
NP_439966.1_9 Forward -263 -254 4.12963 0.253
NP_442941.1_3 Reverse -366 -376 0.963343 0.16
NP_442941.1_3 Forward -356 -346 -0.708283 0.267
NP_440289.1_2 Forward -377 -364 20.6688 0.00313
NP_440289.1_2 Reverse -362 -375 -5.09393 0.297
NP_440260.1_8 Reverse -356 -374 1.59244 0.183
NP_442281.1_1 Forward -379 -365 8.84875 0.075
NP_442281.1_1 Reverse -173 -187 2.5556 0.263
NP_442281.1_1 Reverse -89 -103 1.76896 0.29
NP_442847.1_7 Reverse -347 -366 21.0423 0.0643
NP_442500.1_2 Forward -259 -240 7.07928 0.283
NP_441457.1_7 Reverse -363 -382 2.65439 0.255
NP_441644.1_6 Forward -374 -364 6.46942 0.157
NP_442215.1_2 Reverse -267 -283 -7.21796 0.289
NP_442029.1_10 Reverse -28 -47 6.39097 0.284
NP_440253.1_2 Forward -187 -169 8.08229 0.0625
NP_440929.1_8 Forward -374 -365 9.53783 0.0296
NP_440929.1_8 Reverse -365 -374 9.4395 0.0326
NP_442933.1_10 Forward -374 -365 7.96454 0.0937
NP_442933.1_10 Reverse -365 -374 7.76787 0.11
NP_442933.1_10 Forward -103 -94 5.3096 0.203
NP_441751.2_8 Forward -148 -134 -0.590395 0.129
NP_441751.2_8 Forward -373 -359 -5.01529 0.19
NP_442926.1_1 Reverse -369 -388 -6.39206 0.285
NP_442926.1_5 Reverse -360 -379 9.20238 0.282
NP_442554.1_8 Forward -373 -363 7.84651 0.0825
NP_442554.1_8 Reverse -366 -376 4.89658 0.168
NP_442554.1_8 Forward -44 -34 2.24165 0.276
NP_441762.1_7 Forward -375 -363 2.0056 0.0705
NP_441762.1_7 Reverse -364 -376 1.7106 0.0735
NP_441762.1_7 Reverse -347 -359 -5.95921 0.258
NP_442142.1_4 Forward -146 -133 3.95196 0.239
NP_442292.1_1 Reverse -366 -375 -0.000272808 0.239
NP_442292.1_1 Forward -373 -364 -0.196935 0.239
NP_440895.1_6 Forward -272 -259 11.229 0.202
NP_440895.1_10 Reverse -287 -304 3.97208 0.149
NP_442381.1_8 Forward -377 -358 -6.49039 0.16
NP_442381.1_8 Forward -368 -349 -7.4737 0.188
NP_443009.1_5 Reverse -364 -375 11.6612 0.0602
NP_442301.1_2 Reverse -241 -260 9.83173 0.2
NP_441715.1_4 Reverse -366 -376 9.02648 0.105
NP_440183.1_1 Forward -373 -354 4.81767 0.293
NP_441198.1_8 Reverse -363 -373 13.369 0.108
NP_440379.1_5 Reverse -356 -375 -3.3438 0.204
NP_440379.1_5 Forward -38 -19 -10.3253 0.28
NP_441468.1_1 Forward -373 -366 6.43063 0.175
NP_441468.1_1 Reverse -366 -373 6.0373 0.223
NP_439939.1_1 Reverse -55 -74 16.3215 0.275
NP_441673.1_1 Forward -374 -365 11.1111 0.0121
NP_441673.1_1 Reverse -365 -374 11.0128 0.018
NP_441826.1_2 Reverse -359 -373 -2.55701 0.273
NP_441826.1_5 Reverse -30 -49 1.17943 0.295
NP_442868.1_6 Reverse -363 -373 7.15819 0.086
NP_442868.1_6 Reverse -250 -260 2.83163 0.205
NP_442868.1_6 Forward -376 -366 0.57002 0.217
NP_442868.1_6 Reverse -30 -40 0.373358 0.234
NP_441612.1_2 Forward -92 -82 12.0345 0.21
NP_441911.1_7 Reverse -64 -83 -18.9791 0.261
NP_442808.1_1 Forward -375 -365 16.8925 0.00954
NP_442808.1_1 Forward -358 -348 16.8925 0.00954
NP_442808.1_1 Reverse -250 -260 12.6642 0.0481
NP_440031.1_10 Forward -49 -30 0.491109 0.276
NP_442820.1_4 Forward -256 -239 13.6085 0.265
NP_442542.1_2 Reverse -363 -376 9.75405 0.131
NP_442542.1_2 Reverse -357 -370 7.88576 0.168
NP_442542.1_2 Forward -376 -363 7.19745 0.19
NP_442050.1_5 Reverse -363 -373 10.8943 0.126
NP_442050.1_5 Forward -105 -95 9.12434 0.193
NP_442342.1_9 Forward -359 -343 7.43336 0.207
NP_442342.1_9 Forward -376 -360 3.40179 0.26
NP_441114.1_3 Forward -141 -132 7.37455 0.239
NP_440558.1_2 Reverse -242 -261 -7.37537 0.293
NP_441518.1_3 Forward -384 -365 -9.24366 0.213
NP_441878.1_4 Reverse -126 -145 4.03102 0.294
NP_441878.1_6 Reverse -364 -374 10.9931 0.0176
NP_441878.1_6 Forward -375 -365 2.24165 0.0462
NP_441878.1_6 Reverse -35 -45 0.865012 0.132
NP_441878.1_6 Forward -279 -269 -6.50981 0.191
NP_441036.1_8 Reverse -221 -231 8.23984 0.176
NP_441036.1_8 Forward -375 -365 8.04317 0.177
NP_441036.1_8 Forward -358 -348 5.28991 0.295
NP_441557.1_5 Forward -374 -365 10.2261 0.0144
NP_441557.1_5 Reverse -365 -374 10.1278 0.0188
NP_441557.1_5 Reverse -94 -103 -0.786921 0.239
NP_441557.1_8 Forward -365 -355 17.8758 0.136
NP_441557.1_8 Reverse -252 -262 15.0242 0.183
NP_441445.1_1 Forward -383 -364 0.0977854 0.283
NP_442419.1_2 Reverse -360 -379 -5.01543 0.295
NP_442183.1_1 Forward -374 -360 8.25939 0.119
NP_442183.1_1 Reverse -365 -379 4.42448 0.261
NP_442397.1_9 Reverse -244 -263 2.65439 0.273
NP_440829.1_7 Forward -238 -224 19.6658 0.165
NP_442645.1_2 Reverse -357 -376 -22.3217 0.29
NP_442645.1_4 Reverse -242 -261 10.4225 0.204
NP_441037.1_4 Reverse -363 -373 14.627 0.0304
NP_442594.1_8 Reverse -132 -151 7.37428 0.213
NP_440151.1_5 Forward -266 -247 3.53937 0.288
NP_441633.1_3 Forward -376 -363 15.1623 0.0109
NP_440136.1_2 Forward -373 -366 6.52896 0.116
NP_440136.1_2 Reverse -366 -373 6.13563 0.193
NP_442590.1_10 Forward -266 -247 8.35759 0.208
NP_442590.1_10 Forward -41 -22 4.42435 0.276
NP_442590.1_10 Reverse -29 -48 4.12936 0.281
NP_442998.1_10 Reverse -367 -374 13.5105 0.0225
NP_442998.1_10 Forward -101 -94 13.5105 0.0225
NP_442998.1_10 Forward -372 -365 12.5271 0.0457
NP_442998.1_10 Forward -355 -348 6.0373 0.205
NP_442998.1_10 Reverse -16 -23 3.97235 0.297
NP_440899.1_5 Forward -376 -357 2.26107 0.283
NP_440299.1_1 Reverse -90 -103 11.5234 0.0484
NP_440299.1_1 Reverse -361 -374 9.65513 0.0681
NP_441799.1_1 Forward -153 -139 3.93223 0.274
NP_442802.1_6 Forward -126 -107 15.7324 0.019
NP_441007.1_10 Reverse -360 -373 1.29759 0.203
NP_442334.1_2 Reverse -355 -372 -3.00942 0.2
NP_440256.1_1 Forward -106 -87 -5.60541 0.187
NP_440256.1_1 Reverse -175 -194 -7.4737 0.238
NP_440256.1_1 Reverse -362 -381 -10.3253 0.299
NP_440087.1_1 Reverse -348 -367 2.0644 0.167
NP_441559.1_8 Forward -361 -347 -5.31028 0.259
NP_440915.1_6 Reverse -361 -375 5.1128 0.0935
NP_440915.1_6 Forward -378 -364 2.35953 0.119
NP_440915.1_6 Reverse -344 -358 1.08123 0.147
NP_440915.1_6 Forward -49 -35 -0.885388 0.212
NP_440134.1_2 Reverse -190 -209 0.786102 0.298
NP_442866.1_1 Forward -296 -277 -8.65367 0.282
NP_441464.1_8 Forward -374 -360 7.47274 0.206
NP_440026.1_2 Forward -293 -274 11.9958 0.297
NP_440026.1_7 Forward -38 -23 15.8112 0.188
NP_440787.1_5 Reverse -330 -344 9.43936 0.272
NP_441199.1_6 Forward -378 -359 2.65439 0.197
NP_442957.1_8 Forward -262 -243 8.16093 0.287
NP_442993.1_1 Reverse -94 -110 -7.80794 0.146
NP_442993.1_1 Reverse -365 -381 -9.67623 0.19
NP_442386.1_9 Forward -358 -349 12.2907 0.0676
NP_442386.1_9 Forward -375 -366 6.29249 0.226
NP_442386.1_9 Reverse -250 -259 5.60418 0.245
NP_441750.1_7 Reverse -356 -366 15.9097 0.254
NP_441340.1_5 Forward -373 -366 13.2155 0.0437
NP_441340.1_5 Reverse -366 -373 6.13563 0.175
NP_440168.1_9 Forward -262 -243 6.68596 0.227
NP_441952.1_10 Forward -160 -141 21.2381 0.101
NP_440327.1_6 Forward -272 -253 10.9142 0.188
NP_440327.1_6 Reverse -122 -141 3.93269 0.276
NP_440586.1_1 Reverse -355 -374 2.16274 0.227
NP_440192.1_5 Forward -258 -239 13.6675 0.116
NP_441262.1_3 Forward -374 -367 5.25066 0.215
NP_441262.1_3 Reverse -94 -101 5.25066 0.215
NP_440027.1_3 Reverse -245 -263 1.69003 0.299
NP_440027.1_8 Reverse -32 -51 4.62021 0.287
NP_443051.1_1 Reverse -364 -373 8.25953 0.0414
NP_443051.1_1 Reverse -347 -356 5.3096 0.0964
NP_443051.1_1 Forward -375 -366 0.688044 0.134
NP_440451.1_10 Reverse -30 -49 9.53674 0.264
NP_439937.1_9 Forward -358 -341 -12.9415 0.278
NP_441595.1_5 Reverse -358 -376 16.3421 0.122
NP_440408.1_6 Reverse -31 -49 16.5388 0.19
NP_440439.1_1 Forward -360 -347 8.27909 0.0547
NP_440439.1_1 Forward -377 -364 2.47756 0.133
NP_440439.1_1 Reverse -91 -104 -1.35735 0.263
NP_442239.1_8 Forward -270 -251 9.93088 0.249
NP_442239.1_8 Reverse -359 -378 8.94757 0.249
NP_440372.1_2 Forward -373 -366 6.62729 0.151
NP_440372.1_2 Reverse -366 -373 6.52896 0.188
NP_440271.1_2 Reverse -125 -144 0.0977854 0.292
NP_441138.1_5 Forward -169 -156 3.69047 0.297
NP_441789.1_7 Forward -367 -348 0.588665 0.245
NP_441789.1_7 Forward -366 -347 -2.16459 0.257
NP_440316.1_10 Reverse -356 -366 8.1415 0.24
NP_439977.1_5 Forward -380 -361 9.24257 0.0937
NP_439977.1_5 Forward -51 -32 -0.295539 0.222
NP_439977.1_5 Forward -363 -344 -3.14714 0.296
NP_440139.1_1 Forward -380 -361 7.27514 0.134
NP_442384.1_10 Forward -55 -42 5.23083 0.134
NP_442384.1_10 Forward -374 -361 3.16588 0.199
NP_442384.1_10 Reverse -251 -264 2.2809 0.23
NP_440364.1_3 Forward -26 -7 18.4857 0.165
NP_441604.1_4 Forward -286 -267 -2.16383 0.212
NP_441877.1_7 Forward -379 -360 0.686995 0.255
NP_441018.1_7 Forward -264 -245 13.4708 0.135
NP_442790.1_4 Reverse -356 -375 -7.37537 0.153
NP_442262.1_10 Forward -373 -366 10.4622 0.145
NP_442262.1_10 Reverse -95 -102 9.18389 0.211
NP_441689.1_5 Forward -105 -95 7.94438 0.18
NP_440163.1_10 Reverse -32 -42 16.008 0.0762
NP_440344.1_10 Forward -381 -364 -7.82764 0.119
NP_440344.1_10 Reverse -358 -375 -11.3676 0.212
NP_440282.1_2 Forward -374 -355 14.9458 0.0817
NP_440282.1_3 Reverse -313 -332 -3.93378 0.298
NP_440531.1_6 Reverse -28 -47 0.982764 0.183
NP_441965.1_10 Reverse -137 -153 4.0901 0.249
NP_440297.1_9 Forward -373 -363 0.766681 0.282
NP_440297.1_9 Forward -356 -346 -0.511621 0.289
NP_442280.1_10 Reverse -227 -245 6.62323 0.27
NP_441592.1_4 Forward -372 -353 -2.85214 0.272
NP_441896.1_3 Reverse -356 -375 -0.295539 0.237
NP_443036.1_1 Reverse -86 -105 15.2399 0.224
NP_443036.1_1 Forward -286 -267 8.55343 0.291
NP_440999.1_9 Forward -378 -364 -0.590395 0.212
NP_440999.1_9 Forward -49 -35 -2.45868 0.27
NP_440888.1_2 Reverse -365 -379 5.70218 0.267
NP_440888.1_2 Reverse -178 -192 5.50552 0.276
NP_440888.1_4 Forward -272 -258 16.5273 0.224
NP_440491.1_1 Reverse -117 -136 9.54836 0.21
NP_440491.1_1 Reverse -175 -194 7.79413 0.258
NP_442033.1_10 Forward -376 -357 -7.4737 0.186
NP_442033.1_10 Forward -359 -340 -13.6686 0.287
NP_441543.1_2 Reverse -366 -375 16.9127 0.00359
NP_441543.1_2 Reverse -95 -104 7.96454 0.107
NP_441543.1_2 Forward -102 -93 7.07956 0.131
NP_441543.1_2 Forward -373 -364 6.29291 0.153
NP_441319.1_5 Forward -373 -354 10.6192 0.25
NP_441469.1_8 Forward -375 -366 6.8829 0.227
NP_442315.1_1 Forward -262 -244 3.26407 0.292
NP_443064.1_6 Forward -357 -347 8.39772 0.292
NP_442578.1_7 Reverse -95 -102 11.4455 0.0898
NP_442578.1_7 Forward -373 -366 11.3472 0.102
NP_440710.1_1 Reverse -261 -279 -2.0458 0.189
NP_440071.1_1 Reverse -268 -285 11.9361 0.226
NP_440071.1_6 Reverse -353 -367 13.514 0.267
NP_441462.1_2 Forward -374 -364 10.4031 0.011
NP_441462.1_2 Reverse -365 -375 1.74999 0.0811
NP_441462.1_2 Reverse -94 -104 0.176696 0.161
NP_441462.1_4 Forward -383 -364 -3.54046 0.2
NP_441621.1_7 Reverse -363 -377 -4.91696 0.248
NP_441621.1_7 Forward -376 -362 -5.21195 0.248
NP_443062.1_1 Forward -103 -85 6.30325 0.204
NP_441601.1_4 Reverse -24 -43 0.58944 0.262
NP_440939.1_5 Forward -263 -247 10.8749 0.273
NP_442204.1_1 Reverse -90 -101 3.40192 0.266
NP_441351.1_8 Reverse -363 -382 7.07928 0.192
NP_440516.1_8 Reverse -348 -357 9.14451 0.0354
NP_440516.1_8 Forward -374 -365 7.17789 0.0754
NP_440516.1_8 Reverse -365 -374 7.07956 0.0867
NP_442428.1_5 Forward -373 -366 6.52896 0.109
NP_442428.1_5 Reverse -366 -373 6.0373 0.212
NP_440673.1_2 Reverse -355 -374 11.8529 0.162
NP_440673.1_3 Forward -289 -282 6.3323 0.283
NP_440865.1_9 Forward -380 -361 -7.37537 0.244
NP_441052.1_2 Reverse -365 -375 7.25653 0.0765
NP_441052.1_2 Forward -374 -364 0.865012 0.256
NP_441052.1_2 Reverse -318 -328 0.176696 0.262
NP_442219.1_8 Forward -289 -270 7.49067 0.267
NP_440436.1_4 Reverse -366 -375 8.55409 0.0997
NP_440436.1_4 Forward -373 -364 6.39082 0.162
NP_441884.1_8 Reverse -347 -366 3.24438 0.0952
NP_441884.1_9 Forward -290 -271 -22.6167 0.281
NP_440314.1_9 Forward -373 -354 18.879 0.00651
NP_441719.1_4 Forward -373 -366 6.62729 0.151
NP_441719.1_4 Reverse -366 -373 6.52896 0.188
NP_441719.1_4 Reverse -95 -102 3.77569 0.285
NP_441733.1_10 Reverse -362 -375 6.80412 0.171
NP_441733.1_10 Reverse -345 -358 6.31247 0.192
NP_441004.1_1 Reverse -359 -378 -6.78538 0.19
NP_441004.1_1 Forward -257 -238 -9.73531 0.211
NP_441004.1_1 Reverse -128 -147 -10.9153 0.229
NP_441004.1_2 Reverse -354 -373 7.47261 0.17
NP_441004.1_2 Forward -262 -243 -3.54046 0.282
NP_441004.1_4 Forward -342 -332 13.353 0.216
NP_442694.1_3 Reverse -349 -367 -2.24246 0.265
NP_442206.1_10 Reverse -348 -363 1.06154 0.238
NP_443054.1_2 Forward -376 -362 7.07942 0.169
NP_442308.1_3 Reverse -356 -375 11.7992 0.251
NP_441851.1_10 Reverse -364 -374 7.64985 0.135
NP_441851.1_10 Forward -375 -365 7.05986 0.149
NP_441851.1_10 Reverse -93 -103 4.3066 0.277
NP_442208.1_5 Forward -253 -234 -8.85033 0.282
NP_442856.1_7 Reverse -131 -150 -1.27885 0.223
NP_441668.1_4 Forward -288 -269 14.0608 0.0636
NP_442515.1_1 Forward -375 -361 7.07942 0.0949
NP_440463.1_2 Forward -391 -372 18.1927 0.19
NP_440463.1_7 Forward -369 -355 15.1426 0.285
NP_440463.1_8 Forward -261 -242 6.0477 0.271
NP_441661.1_3 Reverse -223 -240 1.21881 0.226
NP_440432.1_9 Reverse -366 -381 -3.85501 0.193
NP_441150.1_6 Forward -146 -127 14.1583 0.256
NP_442450.1_5 Reverse -346 -356 7.84651 0.13
NP_440588.1_2 Forward -158 -139 -6.78538 0.292
NP_440195.1_4 Forward -125 -106 4.916 0.292
NP_441570.1_1 Reverse -348 -366 -6.86402 0.0823
NP_441570.1_1 Reverse -342 -360 -17.6804 0.287
NP_440078.1_10 Reverse -134 -153 2.55606 0.269
NP_441078.1_4 Reverse -365 -374 18.0926 0.00155
NP_441078.1_4 Forward -374 -365 17.1093 0.00375
NP_441078.1_4 Forward -103 -94 -1.47524 0.266
NP_442729.1_8 Reverse -361 -374 8.67241 0.125
NP_441663.1_8 Forward -363 -344 -1.57384 0.243
NP_442348.1_2 Forward -295 -286 10.6195 0.259
NP_442443.1_1 Reverse -349 -368 -1.18052 0.231
NP_441091.1_5 Reverse -314 -333 1.96607 0.29
NP_440526.1_3 Forward -373 -362 1.72983 0.267
NP_440526.1_3 Reverse -10 -21 0.451529 0.281
NP_441432.1_8 Reverse -364 -373 7.07956 0.105
NP_442320.1_8 Forward -380 -366 6.98109 0.0223
NP_442320.1_8 Reverse -359 -373 -2.16369 0.0867
NP_440760.1_1 Forward -374 -355 -2.95047 0.0334
NP_442797.1_7 Forward -375 -357 4.83737 0.217
NP_440199.1_10 Forward -336 -326 13.4514 0.108
NP_440199.1_10 Reverse -137 -147 11.7798 0.149
NP_441057.1_3 Reverse -184 -203 -11.8003 0.24
NP_442510.1_3 Forward -366 -347 13.4708 0.245
NP_442489.1_7 Forward -374 -365 10.9145 0.00565
NP_442489.1_7 Reverse -365 -374 10.3245 0.0193
NP_442489.1_7 Reverse -178 -187 -1.96689 0.28
NP_442489.1_7 Forward -187 -178 -2.16355 0.295
NP_441706.1_10 Reverse -362 -381 7.47261 0.292
NP_440559.1_1 Forward -373 -364 7.57121 0.106
NP_442763.1_10 Reverse -21 -40 0.982764 0.282
NP_441659.2_8 Forward -374 -364 9.61647 0.0284
NP_441659.2_8 Reverse -365 -375 2.43831 0.2
NP_441659.2_8 Reverse -269 -279 1.16001 0.248
NP_440363.1_8 Reverse -357 -376 9.93088 0.288
NP_442776.1_1 Reverse -270 -289 3.73603 0.279
NP_442346.1_5 Reverse -364 -374 14.238 0.0146
NP_442346.1_10 Forward -40 -21 -1.18052 0.286
NP_440831.1_3 Reverse -356 -375 8.42576 0.225
NP_441629.1_1 Forward -63 -44 6.29264 0.258
NP_440459.1_2 Forward -383 -366 8.20031 0.267
NP_440459.1_2 Reverse -27 -44 7.61033 0.285
NP_441653.1_2 Forward -373 -354 5.75219 0.238
NP_441948.1_4 Reverse -341 -359 -2.43913 0.166
NP_441833.1_4 Forward -373 -366 6.23397 0.163
NP_441833.1_4 Reverse -366 -373 6.13563 0.198
NP_442699.1_8 Forward -99 -80 -11.7019 0.238
NP_442162.1_9 Forward -373 -366 6.62729 0.142
NP_442162.1_9 Reverse -366 -373 6.43063 0.208
NP_442404.1_9 Reverse -157 -171 8.3571 0.296
NP_441044.1_2 Reverse -361 -380 6.98095 0.21
NP_440772.1_8 Reverse -270 -289 8.84924 0.253
NP_442199.1_5 Forward -382 -363 1.17943 0.165
NP_442140.1_3 Forward -373 -363 11.2881 0.0793
NP_442140.1_3 Reverse -366 -376 4.50326 0.243
NP_441671.1_10 Forward -256 -237 -0.688862 0.3
NP_440875.1_9 Forward -101 -91 7.69067 0.255
NP_440875.1_9 Reverse -367 -377 7.00932 0.287
NP_441813.1_5 Forward -376 -366 9.7148 0.0241
NP_441813.1_5 Forward -359 -349 6.56821 0.0875
NP_441813.1_5 Reverse -92 -102 -0.0199663 0.227
NP_441227.1_7 Forward -44 -25 11.9863 0.275
NP_440590.1_4 Reverse -366 -379 2.08423 0.101
NP_440590.1_4 Forward -373 -360 1.39592 0.125
NP_440590.1_4 Forward -44 -31 -4.9956 0.272
NP_440590.1_4 Forward -102 -89 -5.97891 0.296
NP_440590.1_9 Forward -38 -20 21.1603 0.0238
NP_440567.1_1 Forward -373 -359 5.60446 0.1
NP_442497.1_10 Forward -373 -364 10.1278 0.0166
NP_442497.1_10 Reverse -366 -375 0.589713 0.153
NP_442497.1_10 Forward -356 -347 0.29472 0.199
NP_440821.1_4 Reverse -363 -373 9.7148 0.0274
NP_440821.1_4 Forward -376 -366 0.471689 0.174
NP_440821.1_4 Reverse -346 -356 0.275027 0.19
NP_442707.1_2 Forward -350 -340 17.3846 0.251
NP_441239.1_9 Forward -359 -347 12.3303 0.0477
NP_441239.1_9 Forward -376 -364 8.79043 0.122
NP_441239.1_9 Reverse -363 -375 8.6921 0.125
NP_441239.1_9 Reverse -34 -46 8.29878 0.137
NP_441009.1_4 Forward -103 -84 11.2092 0.26
NP_440400.1_1 Reverse -278 -297 -0.591301 0.285
NP_440796.1_3 Reverse -341 -359 7.88485 0.282
NP_442270.1_9 Reverse -354 -373 -10.0303 0.249
NP_442643.1_3 Reverse -30 -49 -3.54046 0.261
NP_441017.1_8 Reverse -43 -58 13.3529 0.174
NP_441526.1_8 Forward -49 -30 -3.44213 0.29
NP_442138.1_10 Reverse -365 -384 3.53937 0.114
NP_442052.1_7 Forward -36 -22 12.8809 0.253
NP_442809.1_3 Forward -393 -374 19.4681 0.156
NP_440546.1_4 Forward -374 -364 10.046 0.109
NP_440546.1_4 Reverse -365 -375 8.6886 0.176
NP_440546.1_4 Reverse -357 -367 7.04032 0.264
NP_441230.1_5 Forward -379 -360 0.196116 0.273
NP_440462.1_4 Reverse -133 -147 5.30946 0.29
NP_440462.1_6 Forward -359 -349 11.5831 0.0396
NP_440462.1_6 Forward -376 -366 7.55152 0.0741
NP_440462.1_6 Reverse -92 -102 4.3066 0.205
NP_440868.1_4 Forward -378 -366 0.628964 0.206
NP_440868.1_4 Forward -361 -349 -0.157684 0.248
NP_442499.1_1 Reverse -237 -256 7.37428 0.203
NP_442499.1_1 Forward -373 -354 6.39097 0.206
NP_442499.1_3 Forward -375 -357 21.8486 0.0396
NP_442499.1_3 Reverse -296 -314 10.3439 0.234
NP_441249.1_8 Forward -333 -314 4.42435 0.259
NP_442479.1_5 Reverse -331 -350 14.2087 0.222
NP_441474.1_5 Reverse -38 -57 6.58763 0.163
NP_440653.1_10 Forward -284 -265 3.04771 0.285
NP_440696.1_3 Forward -361 -343 -2.83245 0.279
NP_442039.1_4 Forward -373 -366 12.1338 0.063
NP_442039.1_4 Reverse -349 -356 8.10225 0.221
NP_441811.1_4 Forward -376 -357 -0.4922 0.295
NP_441811.1_8 Reverse -359 -373 8.45605 0.238
NP_442837.1_3 Forward -373 -366 6.0373 0.25
NP_442837.1_3 Reverse -366 -373 5.93897 0.265
NP_439994.1_1 Reverse -358 -377 12.9791 0.12
NP_442053.1_1 Forward -357 -348 11.1111 0.0437
NP_442053.1_1 Forward -374 -365 8.65285 0.0741
NP_442053.1_1 Reverse -365 -374 8.55452 0.0784
NP_440505.1_3 Forward -376 -366 14.4347 0.0217
NP_440505.1_3 Forward -25 -15 9.81313 0.122
NP_440505.1_3 Reverse -92 -102 5.5849 0.222
NP_441252.1_6 Forward -156 -149 11.6422 0.288
NP_441011.1_8 Reverse -366 -375 14.1594 0.0269
NP_441011.1_8 Reverse -349 -358 8.25953 0.144
NP_442533.1_1 Forward -263 -244 -7.37537 0.188
NP_442533.1_6 Reverse -365 -374 8.55452 0.0747
NP_442533.1_6 Forward -374 -365 8.06287 0.082
NP_442533.1_6 Reverse -251 -260 4.62128 0.179
NP_442533.1_6 Reverse -324 -333 2.85133 0.236
NP_442533.1_6 Reverse -36 -45 1.86802 0.284
NP_442533.1_6 Forward -366 -357 1.37636 0.3
NP_441089.1_8 Forward -376 -357 15.0432 0.266
NP_442232.1_3 Reverse -357 -376 -11.3086 0.282
NP_442322.1_4 Reverse -248 -265 6.0363 0.162
NP_441482.1_7 Reverse -359 -373 -1.18038 0.0637
NP_441482.1_7 Reverse -342 -356 -1.8687 0.0876
NP_439944.1_9 Forward -373 -363 7.94484 0.123
NP_442269.1_10 Forward -271 -252 6.98095 0.21
NP_441028.1_6 Reverse -85 -95 13.2542 0.159
NP_440116.1_8 Forward -373 -354 -1.96717 0.122
NP_440116.1_8 Reverse -95 -114 -4.22878 0.164
NP_440116.1_8 Forward -40 -21 -7.4737 0.231
NP_440007.1_9 Reverse -344 -358 1.86788 0.282
NP_442716.1_6 Reverse -357 -375 21.062 0.103
NP_443045.1_9 Forward -374 -356 15.4563 0.152
NP_441602.1_3 Forward -379 -360 -2.45882 0.233
NP_441602.1_3 Reverse -360 -379 -5.21209 0.28
NP_441972.1_5 Reverse -54 -73 -9.93197 0.294
NP_441106.1_1 Forward -375 -366 8.65285 0.0522
NP_441420.1_1 Forward -375 -356 -5.99873 0.297
NP_440429.1_2 Forward -373 -354 8.25926 0.272
NP_441216.1_5 Reverse -240 -259 10.6184 0.298
NP_442306.1_10 Forward -379 -360 -19.2734 0.197
NP_441286.1_1 Forward -375 -363 4.95553 0.027
NP_440670.1_8 Forward -374 -365 8.84951 0.0606
NP_440670.1_8 Reverse -365 -374 8.55452 0.066
NP_439955.1_10 Forward -370 -351 12.4867 0.258
NP_440886.1_7 Forward -375 -365 8.04271 0.0805
NP_440886.1_7 Reverse -364 -374 7.45273 0.093
NP_440886.1_7 Forward -358 -348 6.76441 0.114
NP_440886.1_7 Reverse -250 -260 4.60114 0.227
NP_440828.1_1 Forward -366 -347 -1.27961 0.285
NP_440404.1_9 Forward -91 -72 9.21455 0.238
NP_442072.1_9 Reverse -364 -382 -21.9087 0.215
NP_442072.1_9 Forward -375 -357 -23.3836 0.292
NP_442401.1_2 Forward -375 -356 18.2882 0.0904
NP_442022.1_4 Forward -272 -253 12.8808 0.168
NP_440907.2_8 Forward -373 -363 9.71433 0.103
NP_440907.2_8 Forward -356 -346 5.09279 0.222
NP_440907.2_8 Reverse -366 -376 4.69947 0.25
NP_441021.1_1 Forward -373 -354 2.0644 0.083
NP_441463.1_3 Forward -384 -365 -10.0303 0.288
NP_442056.1_1 Forward -386 -368 20.472 0.137
NP_442056.1_3 Forward -348 -329 21.2389 0.0401
NP_441626.1_2 Forward -373 -366 14.2971 0.0271
NP_441626.1_2 Reverse -366 -373 5.93897 0.231
NP_441626.1_2 Reverse -95 -102 4.66067 0.267
NP_442362.1_7 Reverse -354 -372 9.65558 0.298
NP_442794.1_1 Forward -191 -179 4.26721 0.27
NP_442615.1_1 Forward -383 -365 3.46073 0.0542
NP_442615.1_1 Reverse -356 -374 -3.42244 0.161
NP_441962.1_4 Reverse -360 -379 -9.53865 0.218
NP_440387.1_1 Forward -374 -358 16.4798 0.0047
NP_440387.1_1 Reverse -94 -110 -6.03799 0.262
NP_440855.1_2 Reverse -235 -254 11.405 0.299
NP_441431.1_2 Forward -377 -363 11.602 0.136
NP_441431.1_2 Forward -365 -351 5.99717 0.281
NP_441488.1_7 Reverse -359 -378 4.22769 0.193
NP_440634.1_1 Forward -376 -357 11.8975 0.277
NP_441993.1_1 Reverse -359 -378 14.5187 0.0768
NP_440114.1_10 Reverse -365 -379 15.1426 0.0294
NP_441510.2_6 Reverse -241 -260 11.8967 0.298
NP_440287.1_6 Forward -172 -153 0.491109 0.29
NP_440293.1_3 Forward -40 -21 4.71934 0.192
NP_440293.1_3 Reverse -357 -376 4.12936 0.192
NP_440293.1_3 Forward -247 -228 -4.6221 0.264
NP_440766.1_4 Reverse -344 -358 4.03116 0.137
NP_441237.1_9 Reverse -145 -155 10.5014 0.228
NP_439910.1_2 Forward -382 -365 -12.6459 0.0924
NP_439910.1_2 Forward -111 -94 -14.3175 0.183
NP_440457.1_1 Reverse -344 -356 9.28209 0.0929
NP_440457.1_1 Reverse -361 -373 5.34885 0.141
NP_440457.1_1 Forward -27 -15 -0.649339 0.271
NP_441984.1_3 Forward -378 -360 12.9988 0.157
NP_441332.1_6 Forward -366 -356 11.8404 0.244
NP_442509.1_9 Reverse -348 -358 11.2876 0.138
NP_442509.1_9 Forward -357 -347 9.321 0.192
NP_442509.1_9 Forward -374 -364 7.64939 0.21
NP_442509.1_9 Reverse -365 -375 6.56775 0.263
NP_441496.1_3 Forward -62 -43 12.4867 0.289
NP_440524.1_2 Forward -147 -128 -2.45882 0.27
NP_440554.1_4 Reverse -366 -376 6.8632 0.111
NP_442862.1_3 Forward -171 -154 10.7569 0.202
NP_442737.1_5 Forward -182 -163 15.012 0.177
NP_441885.1_5 Reverse -365 -375 10.2065 0.012
NP_441885.1_5 Forward -374 -364 1.65166 0.106
NP_442310.1_1 Forward -376 -357 13.7658 0.188
NP_442341.1_7 Forward -375 -361 14.6509 0.0277
NP_442341.1_7 Forward -358 -344 4.71948 0.181
NP_442341.1_9 Reverse -32 -46 5.01387 0.284
NP_441756.1_5 Forward -376 -357 2.75272 0.206
NP_440423.1_6 Reverse -357 -376 -12.4886 0.195
NP_440423.1_6 Reverse -340 -359 -21.3384 0.288
NP_443000.1_7 Forward -376 -366 1.84832 0.228
NP_440507.2_3 Reverse -356 -375 18.5831 0.0413
NP_441842.1_10 Reverse -171 -185 7.9644 0.238
NP_440275.1_3 Reverse -363 -373 9.7148 0.0533
NP_440275.1_3 Forward -376 -366 5.68323 0.136
NP_440091.1_1 Forward -117 -105 1.80894 0.197
NP_440091.1_1 Forward -378 -366 1.02229 0.218
NP_443060.1_5 Reverse -45 -64 8.16011 0.217
NP_440679.1_10 Forward -42 -23 -12.7836 0.213
NP_442451.1_2 Forward -382 -363 -6.78538 0.232
NP_441122.1_1 Forward -344 -329 4.40479 0.28
NP_439962.1_4 Reverse -357 -376 -2.0655 0.224
NP_439962.1_4 Reverse -18 -37 -2.26216 0.226
NP_439962.1_4 Reverse -21 -40 -4.91709 0.272
NP_439962.1_4 Reverse -348 -367 -7.08038 0.287
NP_441105.1_3 Forward -385 -366 -3.93378 0.188
NP_441105.1_3 Reverse -231 -250 -6.98204 0.243
NP_441105.1_3 Reverse -354 -373 -8.65367 0.275
NP_440216.1_1 Reverse -365 -379 6.29277 0.0156
NP_440216.1_1 Forward -103 -89 -11.7018 0.212
NP_440216.1_1 Forward -374 -360 -12.2918 0.256
NP_440216.1_1 Reverse -348 -362 -12.5868 0.288
NP_440216.1_9 Forward -244 -235 9.04618 0.286
NP_440172.1_1 Forward -374 -364 6.96153 0.0959
NP_442015.1_3 Forward -367 -348 9.7334 0.296
NP_442015.1_10 Forward -361 -348 -0.177378 0.255
NP_442329.1_8 Forward -251 -232 8.25926 0.177
NP_441226.1_7 Reverse -349 -356 9.77352 0.131
NP_441226.1_7 Reverse -366 -373 5.54531 0.289
NP_441226.1_7 Reverse -252 -259 5.34865 0.289
NP_442034.1_2 Reverse -252 -271 6.39097 0.255
NP_441111.1_7 Forward -373 -365 8.96754 0.0463
NP_441111.1_7 Reverse -366 -374 8.86921 0.0589
NP_441766.1_2 Forward -374 -365 7.76787 0.0714
NP_441766.1_2 Reverse -365 -374 7.66954 0.0723
NP_441766.1_2 Forward -357 -348 5.01461 0.148
NP_441766.1_9 Reverse -349 -368 4.42435 0.205
NP_442252.1_4 Reverse -347 -366 13.2741 0.269
NP_443052.1_8 Forward -384 -365 -10.3253 0.207
NP_443052.1_9 Forward -376 -357 -7.08038 0.293
NP_440072.1_5 Reverse -351 -369 -3.6191 0.281
NP_440591.1_9 Reverse -358 -376 16.4404 0.0752
NP_442154.1_1 Forward -37 -19 0.510803 0.102
NP_442154.1_1 Reverse -349 -367 -15.6155 0.222
NP_442154.1_1 Forward -293 -275 -17.2871 0.251
NP_442154.1_1 Forward -262 -244 -17.4838 0.257
NP_440261.1_5 Forward -373 -360 -10.0105 0.201
NP_440988.1_10 Forward -99 -85 6.64146 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAATGCAGCAACAGCAGACTGAACCGGCGATAGCCCCAGCCCCCGGATCGCCCTAGATTGGCTAATGGTTATGGGCTTGACCTATGGTACTGAAACTGAAACGGGGGACTTGGTTGCTCTGGACAGTGGCCTTAATGCTGGGGTTGGGCGTAGTGGCCTGGGAAATGAGTCGCACTCCTGAAGAGGGTACAACTACTGTCCAAAGTCCCTCTGTAAATCGCCATTTTGATTTCAGTGCTGATTTGGTGCAATCCATCACCATTACCCAGTCTGAGCCGAACCGAGCAGAGATCAAAATCTATCGCCGGGGGAAAGATAATAATGGTGACTCTGTTTGGTTGATGGATAATCCCCAGCCAGCGGCCGTGAGTGGTCCGGCGGTAGGATTTTTTGCTCAGT

CDS

GTGGTCTTGGGCAGTCAGAACGACCGGGATTTTGAGGTGCCCACAGCGGAATTAACGGACTACGGCCTTAATCCTGCCGGGACAGAGTTAACTATTCAATTGGTCAATGGTAAAACCCACCGTCTCCAGTTAGGTAACCCCGACTTTGCAGGGAATTCTCTCTACGCTCTGGTTAACCCGGTGGAGAATGCTGATATCCCGGCAGAAAGCCAACAAGTTAGTCTAGTGCCCCGTTCTCTGGAAGAATTGACCAGGCGATCGCCAGCGGATTGGCAACAGGCAGATTTAGAAAGTGATGATGAAAATTTAGATGGTAGCGGTCCTGAAGGTGGCGTTTCCTCCGAATTCCCGGCAAGATAG

Protein

MVLGSQNDRDFEVPTAELTDYGLNPAGTELTIQLVNGKTHRLQLGNPDFAGNSLYALVNPVENADIPAESQQVSLVPRSLEELTRRSPADWQQADLESDDENLDGSGPEGGVSSEFPAR