Your browser is old and dusty. Try Google Chrome!

Details for sll0762

ORF sll0762
Accession NP_442057.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -358 -372 14.3559 0.141
NP_441061.1_2 Forward -297 -283 3.04785 0.168
NP_441061.1_2 Forward -342 -328 2.35953 0.177
NP_441061.1_2 Forward -57 -43 2.16287 0.178
NP_440795.1_7 Reverse -50 -57 12.2322 0.0614
NP_441418.1_6 Forward -58 -39 -21.83 0.16
NP_441418.1_6 Reverse -32 -51 -28.2215 0.203
NP_441418.1_6 Reverse -49 -68 -29.4015 0.224
NP_441480.1_1 Forward -25 -6 0.392778 0.287
NP_440897.1_6 Forward -291 -272 -2.65624 0.219
NP_441453.1_4 Forward -58 -50 14.4741 0.019
NP_441453.1_4 Reverse -49 -57 6.90259 0.121
NP_441453.1_7 Forward -284 -277 11.9372 0.298
NP_442151.1_6 Forward -58 -44 12.4876 0.0722
NP_442151.1_6 Forward -343 -329 9.93102 0.137
NP_441818.1_1 Forward -40 -29 9.89126 0.232
NP_441818.1_9 Reverse -41 -60 8.65258 0.112
NP_441818.1_9 Reverse -93 -112 -8.65367 0.279
NP_440226.1_1 Reverse -49 -68 9.43923 0.0726
NP_441630.1_3 Forward -284 -265 4.22769 0.172
NP_442623.1_1 Reverse -340 -359 -17.6018 0.282
NP_440150.1_6 Reverse -29 -48 1.76941 0.284
NP_440996.1_4 Reverse -364 -374 16.303 0.244
NP_442173.1_1 Forward -57 -49 6.01761 0.2
NP_442173.1_1 Reverse -50 -58 5.62429 0.206
NP_442752.1_4 Reverse -32 -39 10.8555 0.0846
NP_442752.1_4 Reverse -334 -341 7.90559 0.144
NP_442752.1_4 Reverse -210 -217 5.25066 0.256
NP_442752.1_4 Forward -58 -51 4.26735 0.293
NP_443027.1_4 Reverse -265 -275 11.9764 0.0872
NP_443027.1_4 Reverse -208 -218 8.53483 0.199
NP_442975.1_10 Reverse -45 -59 2.8506 0.269
NP_441225.1_5 Forward -89 -70 8.94757 0.252
NP_440784.1_7 Forward -57 -50 6.23397 0.241
NP_440784.1_7 Reverse -50 -57 6.23397 0.241
NP_440061.1_9 Forward -60 -46 9.93039 0.134
NP_440061.1_9 Forward -53 -39 5.50552 0.283
NP_440110.1_8 Forward -321 -302 -2.55715 0.274
NP_441476.1_5 Forward -63 -44 -8.16202 0.296
NP_442062.1_8 Reverse -49 -59 9.7148 0.0559
NP_442062.1_8 Forward -58 -48 8.4365 0.075
NP_441900.1_2 Reverse -291 -309 -5.09477 0.288
NP_441859.1_3 Forward -59 -40 2.26028 0.263
NP_440304.1_4 Reverse -47 -57 8.4365 0.0776
NP_442242.1_4 Forward -57 -50 11.8388 0.0776
NP_440044.1_8 Forward -197 -178 -3.24547 0.281
NP_441594.1_6 Reverse -40 -59 12.5858 0.109
NP_440370.1_10 Forward -223 -204 7.37428 0.258
NP_440132.1_6 Reverse -321 -340 18.3873 0.0526
NP_440300.1_1 Reverse -215 -234 13.6666 0.121
NP_441925.1_4 Forward -347 -328 -15.3409 0.263
NP_441925.1_4 Forward -50 -31 -16.8158 0.285
NP_440856.1_4 Forward -48 -29 -2.85214 0.222
NP_441083.1_5 Forward -58 -48 9.61647 0.0243
NP_441083.1_5 Forward -41 -31 7.25653 0.0608
NP_441083.1_5 Reverse -49 -59 1.55333 0.204
NP_441434.1_7 Reverse -51 -65 4.81781 0.225
NP_441738.1_2 Forward -217 -210 8.00357 0.235
NP_441738.1_2 Forward -274 -267 6.03696 0.295
NP_441558.1_5 Reverse -47 -66 8.06259 0.162
NP_440209.1_1 Forward -58 -50 8.37755 0.0576
NP_440209.1_1 Reverse -49 -57 8.27922 0.0687
NP_440870.1_4 Reverse -209 -227 1.59244 0.235
NP_441716.1_1 Reverse -382 -396 4.52282 0.255
NP_441598.1_5 Reverse -90 -109 16.9124 0.192
NP_442111.1_4 Forward -59 -45 9.93102 0.0575
NP_442111.1_4 Reverse -209 -223 2.06454 0.291
NP_441387.1_10 Forward -110 -92 19.7828 0.155
NP_440906.1_5 Forward -57 -50 12.0355 0.0724
NP_440906.1_5 Reverse -50 -57 6.0373 0.262
NP_440747.1_10 Forward -61 -49 -2.4193 0.0434
NP_440747.1_10 Reverse -46 -58 -11.8591 0.161
NP_440747.1_10 Forward -44 -32 -12.3507 0.27
NP_441130.1_10 Reverse -47 -61 7.57108 0.155
NP_441486.1_1 Forward -61 -47 -4.62196 0.204
NP_441880.2_10 Forward -57 -39 8.96727 0.263
NP_442850.1_8 Reverse -37 -56 17.1812 0.243
NP_442634.1_4 Forward -278 -264 -3.04867 0.16
NP_441265.1_1 Forward -224 -205 2.0644 0.0148
NP_440403.1_4 Forward -67 -48 -7.37537 0.241
NP_440403.1_10 Reverse -40 -59 2.94938 0.278
NP_441014.1_8 Forward -44 -25 -4.6221 0.253
NP_441012.1_4 Forward -102 -89 7.39411 0.272
NP_443018.1_3 Forward -57 -50 5.84064 0.174
NP_443018.1_3 Reverse -50 -57 5.54565 0.187
NP_441634.1_8 Reverse -208 -222 -0.688726 0.265
NP_441634.1_9 Reverse -369 -388 8.06178 0.294
NP_441182.1_5 Reverse -93 -112 9.93088 0.215
NP_440376.1_1 Forward -58 -49 17.601 0.00222
NP_440376.1_1 Reverse -49 -58 9.63616 0.0385
NP_442687.1_7 Forward -59 -49 12.7631 0.0661
NP_442687.1_7 Reverse -245 -255 10.8948 0.0994
NP_442687.1_7 Reverse -48 -58 10.1081 0.0994
NP_442485.1_3 Forward -354 -335 4.12936 0.19
NP_442485.1_3 Reverse -30 -49 -1.47551 0.259
NP_441846.1_10 Reverse -31 -50 -10.522 0.19
NP_441846.1_10 Reverse -32 -51 -22.715 0.264
NP_441846.1_10 Forward -235 -216 -23.01 0.275
NP_441846.1_10 Reverse -281 -300 -23.1083 0.277
NP_440642.1_10 Forward -273 -259 4.62054 0.25
NP_441013.1_2 Forward -296 -278 -0.275845 0.266
NP_441422.1_7 Forward -60 -43 -0.649475 0.168
NP_441950.1_7 Reverse -37 -56 -2.65548 0.201
NP_440360.1_5 Forward -304 -285 4.81767 0.297
NP_440360.1_10 Forward -56 -42 2.75286 0.261
NP_442658.1_1 Reverse -47 -57 8.3377 0.199
NP_442658.1_1 Forward -60 -50 7.94438 0.199
NP_442198.1_3 Reverse -370 -389 7.07928 0.251
NP_442198.1_3 Reverse -361 -380 4.81767 0.268
NP_440141.1_4 Reverse -325 -344 -11.8986 0.298
NP_441855.2_4 Reverse -41 -60 9.52306 0.275
NP_441414.1_9 Reverse -32 -51 -10.3253 0.28
NP_441414.1_9 Forward -41 -22 -10.522 0.287
NP_440607.1_5 Reverse -325 -344 7.47261 0.18
NP_440607.1_5 Reverse -34 -53 -1.47551 0.297
NP_441487.1_9 Forward -78 -59 2.45773 0.18
NP_441487.1_9 Forward -50 -31 -2.75381 0.293
NP_442937.1_5 Forward -63 -44 13.4708 0.0906
NP_441958.1_5 Reverse -48 -58 10.6981 0.0112
NP_441958.1_5 Forward -59 -49 2.53664 0.0409
NP_441958.1_5 Reverse -31 -41 -0.708283 0.221
NP_442057.1_4 Forward -392 -373 20.4523 0.108
NP_442057.1_7 Forward -321 -303 22.1436 0.0912
NP_442486.1_6 Forward -349 -330 -6.1954 0.28
NP_442836.1_5 Reverse -43 -62 5.80098 0.185
NP_442836.1_10 Forward -236 -226 13.8447 0.212
NP_440203.1_5 Reverse -202 -212 13.2542 0.122
NP_440984.1_7 Forward -281 -267 8.06273 0.158
NP_439990.1_5 Forward -214 -201 6.21414 0.249
NP_441580.1_6 Reverse -38 -57 -6.68705 0.235
NP_441580.1_6 Forward -69 -50 -8.35868 0.258
NP_440153.1_8 Forward -52 -39 6.21414 0.172
NP_440153.1_8 Forward -298 -285 -3.52063 0.295
NP_443055.1_6 Forward -58 -40 -0.276578 0.256
NP_443055.1_6 Reverse -262 -280 -0.964891 0.271
NP_443055.1_6 Forward -66 -48 -2.04653 0.287
NP_441891.1_8 Reverse -40 -59 13.3725 0.282
NP_440388.1_1 Forward -110 -91 20.7473 0.161
NP_441429.1_4 Reverse -311 -330 9.04509 0.237
NP_441099.1_5 Reverse -39 -58 -0.590531 0.0954
NP_441099.1_5 Forward -51 -32 -2.75381 0.126
NP_442002.1_1 Reverse -23 -41 -7.65067 0.251
NP_442002.1_9 Reverse -31 -38 14.1004 0.074
NP_440809.1_9 Forward -400 -382 -9.0273 0.291
NP_441294.1_7 Forward -62 -48 12.7062 0.0876
NP_441646.1_1 Reverse -42 -61 11.6025 0.098
NP_442431.1_10 Reverse -44 -62 1.10079 0.26
NP_442431.1_10 Reverse -328 -346 0.412472 0.275
NP_441398.1_1 Reverse -94 -113 18.8043 0.159
NP_441000.1_6 Reverse -48 -62 14.2576 0.0396
NP_442771.1_1 Forward -60 -42 1.19912 0.081
NP_440147.1_4 Forward -60 -47 9.95071 0.0362
NP_440147.1_4 Reverse -47 -60 8.77074 0.0465
NP_441550.1_8 Reverse -47 -57 10.206 0.0733
NP_441916.1_7 Forward -58 -48 13.8447 0.0172
NP_441916.1_7 Reverse -49 -59 8.63316 0.0437
NP_441916.1_10 Forward -387 -368 3.93269 0.225
NP_441041.1_4 Reverse -328 -347 -10.0303 0.227
NP_441041.1_4 Forward -41 -22 -13.7669 0.295
NP_441041.1_7 Forward -61 -49 8.58373 0.133
NP_443063.1_7 Forward -292 -276 15.9882 0.126
NP_441725.1_4 Reverse -44 -58 6.78381 0.262
NP_441725.1_5 Forward -57 -47 9.51814 0.0553
NP_441725.1_5 Forward -40 -30 1.455 0.135
NP_439966.1_7 Forward -60 -50 8.23937 0.14
NP_439966.1_7 Forward -43 -33 7.94438 0.145
NP_439966.1_7 Forward -221 -211 6.46942 0.18
NP_439966.1_7 Reverse -219 -229 5.87944 0.204
NP_442941.1_3 Reverse -50 -60 0.963343 0.16
NP_442941.1_3 Forward -40 -30 -0.708283 0.267
NP_440289.1_2 Forward -61 -48 20.6688 0.00313
NP_440289.1_2 Reverse -46 -59 -5.09393 0.297
NP_440260.1_8 Reverse -40 -58 1.59244 0.183
NP_442281.1_1 Forward -63 -49 8.84875 0.075
NP_442281.1_1 Forward -341 -327 4.03056 0.21
NP_442281.1_1 Forward -296 -282 2.45727 0.266
NP_442847.1_7 Reverse -31 -50 21.0423 0.0643
NP_440177.1_5 Forward -86 -67 12.0942 0.268
NP_440177.1_9 Reverse -93 -112 10.9142 0.298
NP_442500.1_8 Forward -143 -129 8.9251 0.285
NP_441457.1_7 Reverse -47 -66 2.65439 0.255
NP_441644.1_6 Forward -58 -48 6.46942 0.157
NP_442215.1_2 Forward -156 -140 0.943514 0.144
NP_442215.1_2 Forward -318 -302 -7.0213 0.284
NP_442177.1_5 Forward -233 -219 7.76774 0.293
NP_442029.1_6 Forward -234 -215 9.3409 0.191
NP_440929.1_8 Forward -58 -49 9.53783 0.0296
NP_440929.1_8 Reverse -49 -58 9.4395 0.0326
NP_442933.1_10 Forward -58 -49 7.96454 0.0937
NP_442933.1_10 Reverse -49 -58 7.76787 0.11
NP_441751.2_8 Forward -57 -43 -5.01529 0.19
NP_442926.1_1 Reverse -53 -72 -6.39206 0.285
NP_442926.1_5 Reverse -44 -63 9.20238 0.282
NP_442554.1_8 Reverse -206 -216 8.63316 0.0712
NP_442554.1_8 Forward -57 -47 7.84651 0.0825
NP_442554.1_8 Reverse -50 -60 4.89658 0.168
NP_441762.1_7 Forward -59 -47 2.0056 0.0705
NP_441762.1_7 Reverse -48 -60 1.7106 0.0735
NP_441762.1_7 Reverse -31 -43 -5.95921 0.258
NP_442313.1_5 Reverse -102 -121 8.35759 0.211
NP_442142.1_4 Reverse -279 -292 3.06699 0.268
NP_442292.1_1 Reverse -50 -59 -0.000272808 0.239
NP_442292.1_1 Forward -57 -48 -0.196935 0.239
NP_441264.1_3 Forward -224 -205 0.687771 0.23
NP_442381.1_8 Forward -61 -42 -6.49039 0.16
NP_442381.1_8 Forward -52 -33 -7.4737 0.188
NP_443009.1_5 Reverse -48 -59 11.6612 0.0602
NP_441715.1_4 Reverse -50 -60 9.02648 0.105
NP_440183.1_1 Forward -57 -38 4.81767 0.293
NP_441198.1_8 Reverse -47 -57 13.369 0.108
NP_440379.1_5 Reverse -40 -59 -3.3438 0.204
NP_441468.1_1 Forward -57 -50 6.43063 0.175
NP_441468.1_1 Reverse -50 -57 6.0373 0.223
NP_441015.1_10 Reverse -322 -341 -3.83545 0.194
NP_441673.1_1 Forward -58 -49 11.1111 0.0121
NP_441673.1_1 Reverse -49 -58 11.0128 0.018
NP_441956.1_9 Forward -128 -109 8.35759 0.25
NP_441876.1_9 Forward -251 -241 10.5993 0.287
NP_441826.1_2 Reverse -328 -342 4.52282 0.102
NP_441826.1_2 Reverse -43 -57 -2.55701 0.273
NP_441826.1_5 Reverse -277 -296 11.7992 0.148
NP_441826.1_5 Reverse -283 -302 3.34271 0.271
NP_441330.1_1 Reverse -322 -341 -15.6352 0.289
NP_442868.1_6 Reverse -47 -57 7.15819 0.086
NP_442868.1_6 Forward -60 -50 0.57002 0.217
NP_442719.1_2 Reverse -68 -86 -11.4863 0.292
NP_442719.1_2 Forward -357 -339 -11.7812 0.296
NP_442808.1_1 Forward -59 -49 16.8925 0.00954
NP_442808.1_1 Forward -42 -32 16.8925 0.00954
NP_442808.1_1 Reverse -225 -235 2.43787 0.266
NP_440918.1_2 Reverse -366 -385 11.3075 0.259
NP_442775.1_6 Reverse -90 -109 11.0125 0.277
NP_440145.1_3 Reverse -257 -276 -3.44213 0.198
NP_442542.1_2 Reverse -47 -60 9.75405 0.131
NP_442542.1_2 Reverse -41 -54 7.88576 0.168
NP_442542.1_2 Forward -60 -47 7.19745 0.19
NP_442113.1_10 Reverse -218 -237 -6.58872 0.263
NP_442050.1_1 Reverse -327 -346 10.1275 0.243
NP_442050.1_5 Reverse -47 -57 10.8943 0.126
NP_442050.1_5 Forward -221 -211 9.616 0.193
NP_442342.1_9 Forward -43 -27 7.43336 0.207
NP_442342.1_9 Forward -60 -44 3.40179 0.26
NP_440558.1_2 Reverse -211 -230 -6.39206 0.274
NP_442789.1_4 Reverse -332 -351 -3.93378 0.257
NP_441518.1_3 Forward -68 -49 -9.24366 0.213
NP_441878.1_6 Reverse -48 -58 10.9931 0.0176
NP_441878.1_6 Forward -59 -49 2.24165 0.0462
NP_441878.1_6 Forward -344 -334 -1.00328 0.188
NP_441036.1_8 Forward -59 -49 8.04317 0.177
NP_441036.1_8 Reverse -172 -182 6.56821 0.225
NP_441036.1_8 Forward -42 -32 5.28991 0.295
NP_442650.1_4 Reverse -294 -313 11.2092 0.254
NP_441557.1_5 Forward -58 -49 10.2261 0.0144
NP_441557.1_5 Reverse -49 -58 10.1278 0.0188
NP_441557.1_8 Forward -49 -39 17.8758 0.136
NP_441445.1_1 Forward -67 -48 0.0977854 0.283
NP_442267.1_4 Reverse -110 -129 4.52268 0.203
NP_441433.1_8 Forward -290 -271 -2.45882 0.27
NP_442419.1_2 Reverse -44 -63 -5.01543 0.295
NP_441308.1_8 Forward -278 -268 12.9597 0.218
NP_441458.1_10 Reverse -86 -105 1.0811 0.298
NP_442183.1_1 Forward -58 -44 8.25939 0.119
NP_442183.1_1 Reverse -49 -63 4.42448 0.261
NP_440829.1_7 Forward -173 -159 18.7808 0.177
NP_442347.1_2 Forward -251 -242 4.62128 0.274
NP_442347.1_2 Forward -218 -209 4.0313 0.284
NP_442645.1_2 Reverse -41 -60 -22.3217 0.29
NP_441037.1_4 Reverse -47 -57 14.627 0.0304
NP_442594.1_8 Forward -231 -212 2.75272 0.293
NP_441633.1_3 Forward -60 -47 15.1623 0.0109
NP_440136.1_1 Reverse -126 -142 10.2842 0.238
NP_440136.1_2 Forward -57 -50 6.52896 0.116
NP_440136.1_2 Reverse -50 -57 6.13563 0.193
NP_440136.1_2 Reverse -211 -218 3.97235 0.288
NP_442998.1_10 Reverse -51 -58 13.5105 0.0225
NP_442998.1_10 Forward -56 -49 12.5271 0.0457
NP_442998.1_10 Forward -39 -32 6.0373 0.205
NP_440899.1_5 Forward -60 -41 2.26107 0.283
NP_440299.1_1 Reverse -45 -58 9.65513 0.0681
NP_440299.1_1 Forward -383 -370 3.46031 0.243
NP_441007.1_10 Reverse -44 -57 1.29759 0.203
NP_441007.1_10 Reverse -90 -103 0.0192843 0.254
NP_442334.1_2 Reverse -39 -56 -3.00942 0.2
NP_440256.1_1 Reverse -86 -105 -4.42544 0.155
NP_440256.1_1 Reverse -46 -65 -10.3253 0.299
NP_440087.1_1 Reverse -32 -51 2.0644 0.167
NP_441559.1_8 Forward -45 -31 -5.31028 0.259
NP_440915.1_6 Reverse -45 -59 5.1128 0.0935
NP_440915.1_6 Forward -62 -48 2.35953 0.119
NP_440915.1_6 Reverse -28 -42 1.08123 0.147
NP_442158.1_4 Reverse -136 -146 11.8781 0.264
NP_441296.1_9 Reverse -216 -229 19.3898 0.0761
NP_440717.1_3 Forward -340 -326 9.34041 0.25
NP_440748.1_5 Forward -196 -177 1.86774 0.224
NP_441464.1_8 Forward -58 -44 7.47274 0.206
NP_440787.1_5 Reverse -14 -28 9.43936 0.272
NP_441199.1_6 Forward -62 -43 2.65439 0.197
NP_442993.1_1 Reverse -49 -65 -9.67623 0.19
NP_442386.1_9 Forward -42 -33 12.2907 0.0676
NP_442386.1_9 Forward -59 -50 6.29249 0.226
NP_441750.1_7 Reverse -40 -50 15.9097 0.254
NP_441340.1_5 Forward -57 -50 13.2155 0.0437
NP_441340.1_5 Reverse -50 -57 6.13563 0.175
NP_441271.1_3 Forward -348 -330 12.6047 0.195
NP_441947.1_4 Forward -263 -244 16.4207 0.127
NP_442484.1_2 Forward -341 -322 -0.688862 0.271
NP_442484.1_2 Reverse -78 -97 -1.7705 0.298
NP_442240.1_1 Reverse -219 -238 3.83357 0.279
NP_442240.1_2 Forward -218 -199 -12.4886 0.163
NP_440586.1_1 Reverse -39 -58 2.16274 0.227
NP_441262.1_3 Forward -58 -51 5.25066 0.215
NP_441262.1_3 Reverse -210 -217 5.15232 0.265
NP_443051.1_1 Reverse -48 -57 8.25953 0.0414
NP_443051.1_1 Reverse -31 -40 5.3096 0.0964
NP_443051.1_1 Forward -59 -50 0.688044 0.134
NP_439937.1_8 Reverse -308 -327 -2.45882 0.259
NP_439937.1_9 Reverse -292 -309 -9.99156 0.22
NP_439937.1_9 Forward -42 -25 -12.9415 0.278
NP_441595.1_5 Reverse -42 -60 16.3421 0.122
NP_440439.1_1 Forward -44 -31 8.27909 0.0547
NP_440439.1_1 Forward -61 -48 2.47756 0.133
NP_442239.1_8 Reverse -43 -62 8.94757 0.249
NP_440372.1_2 Forward -57 -50 6.62729 0.151
NP_440372.1_2 Reverse -50 -57 6.52896 0.188
NP_441789.1_7 Forward -300 -281 1.47364 0.245
NP_441789.1_7 Forward -51 -32 0.588665 0.245
NP_441789.1_7 Forward -50 -31 -2.16459 0.257
NP_440316.1_10 Reverse -40 -50 8.1415 0.24
NP_440316.1_10 Reverse -339 -349 7.84651 0.245
NP_439977.1_5 Forward -64 -45 9.24257 0.0937
NP_439977.1_5 Forward -47 -28 -3.14714 0.296
NP_442368.1_10 Reverse -327 -346 16.8141 0.237
NP_440139.1_1 Forward -64 -45 7.27514 0.134
NP_441572.1_7 Reverse -328 -347 -2.95047 0.205
NP_442384.1_10 Forward -58 -45 3.16588 0.199
NP_441877.1_7 Forward -63 -44 0.686995 0.255
NP_442713.1_9 Forward -111 -92 13.5683 0.292
NP_441018.1_7 Reverse -91 -110 14.1591 0.128
NP_442790.1_4 Reverse -40 -59 -7.37537 0.153
NP_442262.1_10 Forward -57 -50 10.4622 0.145
NP_442244.1_6 Forward -343 -324 0.0977854 0.291
NP_440163.1_10 Reverse -307 -317 9.02648 0.25
NP_440344.1_10 Forward -65 -48 -7.82764 0.119
NP_440344.1_10 Reverse -42 -59 -11.3676 0.212
NP_440282.1_2 Forward -58 -39 14.9458 0.0817
NP_440297.1_9 Forward -57 -47 0.766681 0.282
NP_440297.1_9 Reverse -335 -345 -0.118297 0.282
NP_440297.1_9 Forward -40 -30 -0.511621 0.289
NP_439926.1_7 Forward -108 -90 5.13236 0.281
NP_442280.1_10 Reverse -107 -125 5.84403 0.281
NP_442280.1_10 Forward -340 -322 4.77262 0.294
NP_441592.1_4 Forward -56 -37 -2.85214 0.272
NP_441896.1_3 Reverse -40 -59 -0.295539 0.237
NP_440937.1_5 Reverse -89 -108 13.4708 0.275
NP_440999.1_9 Forward -62 -48 -0.590395 0.212
NP_440888.1_2 Reverse -282 -296 8.75042 0.149
NP_440888.1_2 Reverse -49 -63 5.70218 0.267
NP_439969.1_3 Forward -307 -288 4.22769 0.214
NP_442033.1_10 Forward -60 -41 -7.4737 0.186
NP_442033.1_10 Reverse -291 -310 -12.8819 0.277
NP_442033.1_10 Forward -43 -24 -13.6686 0.287
NP_442871.1_4 Reverse -217 -236 -2.45958 0.203
NP_440575.1_3 Forward -238 -219 17.0107 0.281
NP_441543.1_2 Reverse -50 -59 16.9127 0.00359
NP_441543.1_2 Forward -57 -48 6.29291 0.153
NP_441543.1_3 Reverse -224 -238 13.8636 0.163
NP_440089.1_1 Forward -238 -220 12.0155 0.3
NP_441319.1_5 Forward -57 -38 10.6192 0.25
NP_441469.1_8 Forward -59 -50 6.8829 0.227
NP_443064.1_6 Forward -41 -31 8.39772 0.292
NP_442578.1_7 Forward -57 -50 11.3472 0.102
NP_440071.1_6 Reverse -37 -51 13.514 0.267
NP_441462.1_2 Forward -58 -48 10.4031 0.011
NP_441462.1_2 Reverse -49 -59 1.74999 0.0811
NP_441462.1_4 Forward -67 -48 -3.54046 0.2
NP_441621.1_7 Reverse -47 -61 -4.91696 0.248
NP_441621.1_7 Forward -60 -46 -5.21195 0.248
NP_443062.1_1 Forward -219 -201 6.40076 0.202
NP_440349.1_3 Forward -261 -242 10.7167 0.283
NP_440519.1_8 Reverse -280 -296 7.82668 0.199
NP_441351.1_8 Reverse -47 -66 7.07928 0.192
NP_440516.1_8 Reverse -32 -41 9.14451 0.0354
NP_440516.1_8 Forward -58 -49 7.17789 0.0754
NP_440516.1_8 Reverse -49 -58 7.07956 0.0867
NP_442428.1_5 Forward -57 -50 6.52896 0.109
NP_442428.1_5 Reverse -50 -57 6.0373 0.212
NP_442120.1_10 Forward -110 -91 -16.1268 0.296
NP_440673.1_2 Reverse -39 -58 11.8529 0.162
NP_440673.1_3 Reverse -91 -98 5.54565 0.288
NP_440865.1_9 Forward -64 -45 -7.37537 0.244
NP_441052.1_2 Reverse -49 -59 7.25653 0.0765
NP_441052.1_2 Forward -391 -381 2.24165 0.213
NP_441052.1_2 Forward -58 -48 0.865012 0.256
NP_441052.1_2 Reverse -2 -12 0.176696 0.262
NP_442219.1_8 Forward -389 -370 8.16711 0.253
NP_440436.1_4 Reverse -50 -59 8.55409 0.0997
NP_440436.1_4 Forward -57 -48 6.39082 0.162
NP_441884.1_8 Reverse -31 -50 3.24438 0.0952
NP_440314.1_9 Forward -57 -38 18.879 0.00651
NP_440314.1_9 Forward -378 -359 3.53937 0.0849
NP_441719.1_4 Forward -57 -50 6.62729 0.151
NP_441719.1_4 Reverse -50 -57 6.52896 0.188
NP_441719.1_4 Reverse -211 -218 3.77569 0.285
NP_441733.1_10 Reverse -46 -59 6.80412 0.171
NP_441733.1_10 Reverse -29 -42 6.31247 0.192
NP_441004.1_1 Reverse -43 -62 -6.78538 0.19
NP_441004.1_1 Reverse -277 -296 -15.0452 0.271
NP_441004.1_1 Reverse -241 -260 -16.8151 0.287
NP_441004.1_2 Reverse -38 -57 7.47261 0.17
NP_441004.1_4 Forward -26 -16 13.353 0.216
NP_442813.1_4 Reverse -81 -100 -7.76869 0.299
NP_442873.1_3 Forward -353 -334 4.71854 0.262
NP_442694.1_3 Reverse -33 -51 -2.24246 0.265
NP_442206.1_10 Reverse -32 -47 1.06154 0.238
NP_443054.1_2 Forward -60 -46 7.07942 0.169
NP_442308.1_3 Reverse -40 -59 11.7992 0.251
NP_441851.1_10 Reverse -48 -58 7.64985 0.135
NP_441851.1_10 Forward -59 -49 7.05986 0.149
NP_442026.1_3 Reverse -310 -329 5.70265 0.153
NP_441668.1_4 Forward -238 -219 1.86774 0.209
NP_441668.1_4 Reverse -108 -127 -2.55715 0.291
NP_442515.1_1 Forward -59 -45 7.07942 0.0949
NP_442515.1_1 Forward -380 -366 -4.03198 0.298
NP_440463.1_2 Forward -75 -56 18.1927 0.19
NP_440463.1_7 Forward -53 -39 15.1426 0.285
NP_440940.1_5 Forward -109 -90 17.699 0.171
NP_440432.1_7 Forward -303 -284 13.2741 0.158
NP_440432.1_9 Reverse -50 -65 -3.85501 0.193
NP_442450.1_5 Reverse -30 -40 7.84651 0.13
NP_441570.1_1 Reverse -32 -50 -6.86402 0.0823
NP_441570.1_1 Reverse -26 -44 -17.6804 0.287
NP_441078.1_4 Reverse -49 -58 18.0926 0.00155
NP_441078.1_4 Forward -58 -49 17.1093 0.00375
NP_442729.1_8 Reverse -45 -58 8.67241 0.125
NP_441663.1_8 Forward -47 -28 -1.57384 0.243
NP_442443.1_1 Reverse -33 -52 -1.18052 0.231
NP_442443.1_1 Reverse -332 -351 -2.16383 0.252
NP_440526.1_3 Forward -57 -46 1.72983 0.267
NP_440526.1_3 Forward -342 -331 1.53316 0.267
NP_441432.1_8 Reverse -48 -57 7.07956 0.105
NP_442320.1_8 Forward -64 -50 6.98109 0.0223
NP_442320.1_8 Reverse -43 -57 -2.16369 0.0867
NP_440629.1_6 Reverse -261 -280 14.3596 0.181
NP_440760.1_1 Forward -58 -39 -2.95047 0.0334
NP_442797.1_6 Forward -341 -322 7.83721 0.273
NP_442797.1_7 Forward -59 -41 4.83737 0.217
NP_440199.1_10 Forward -20 -10 13.4514 0.108
NP_442510.1_3 Forward -50 -31 13.4708 0.245
NP_440713.1_4 Reverse -205 -224 5.50599 0.208
NP_442489.1_7 Forward -58 -49 10.9145 0.00565
NP_442489.1_7 Reverse -49 -58 10.3245 0.0193
NP_441706.1_10 Reverse -46 -65 7.47261 0.292
NP_440559.1_1 Forward -57 -48 7.57121 0.106
NP_442763.1_10 Forward -348 -329 -0.000545616 0.299
NP_441659.2_8 Forward -58 -48 9.61647 0.0284
NP_441659.2_8 Reverse -49 -59 2.43831 0.2
NP_440860.1_7 Reverse -128 -147 16.1257 0.256
NP_440363.1_8 Reverse -41 -60 9.93088 0.288
NP_442849.1_1 Reverse -256 -270 13.0776 0.201
NP_442346.1_5 Reverse -48 -58 14.238 0.0146
NP_440545.1_3 Forward -223 -206 -7.13932 0.298
NP_440831.1_3 Reverse -40 -59 8.42576 0.225
NP_440459.1_2 Forward -300 -283 8.88863 0.246
NP_440459.1_2 Forward -67 -50 8.20031 0.267
NP_441653.1_2 Forward -57 -38 5.75219 0.238
NP_440010.1_4 Forward -389 -370 -2.06626 0.273
NP_440847.1_3 Forward -370 -356 11.4053 0.263
NP_441888.1_7 Forward -296 -282 3.53951 0.225
NP_441948.1_4 Reverse -25 -43 -2.43913 0.166
NP_441833.1_4 Forward -57 -50 6.23397 0.163
NP_441833.1_4 Reverse -50 -57 6.13563 0.198
NP_442060.1_10 Forward -200 -181 12.1925 0.244
NP_442162.1_9 Forward -57 -50 6.62729 0.142
NP_442162.1_9 Reverse -50 -57 6.43063 0.208
NP_440224.1_1 Reverse -178 -197 -2.55715 0.224
NP_441044.1_2 Reverse -45 -64 6.98095 0.21
NP_442199.1_5 Forward -66 -47 1.17943 0.165
NP_442140.1_3 Forward -57 -47 11.2881 0.0793
NP_442140.1_3 Reverse -50 -60 4.50326 0.243
NP_442021.1_6 Reverse -106 -125 9.73422 0.262
NP_440875.1_9 Forward -217 -207 10.5134 0.212
NP_440875.1_9 Reverse -51 -61 7.00932 0.287
NP_441813.1_5 Forward -60 -50 9.7148 0.0241
NP_441813.1_5 Forward -43 -33 6.56821 0.0875
NP_440590.1_4 Reverse -50 -63 2.08423 0.101
NP_440590.1_4 Forward -57 -44 1.39592 0.125
NP_440590.1_4 Forward -152 -139 -2.24233 0.239
NP_440567.1_1 Forward -57 -43 5.60446 0.1
NP_442497.1_10 Forward -57 -48 10.1278 0.0166
NP_442497.1_10 Reverse -50 -59 0.589713 0.153
NP_442497.1_10 Forward -40 -31 0.29472 0.199
NP_440821.1_4 Reverse -47 -57 9.7148 0.0274
NP_440821.1_4 Forward -60 -50 0.471689 0.174
NP_440821.1_4 Reverse -30 -40 0.275027 0.19
NP_442707.1_2 Forward -34 -24 17.3846 0.251
NP_441239.1_9 Forward -43 -31 12.3303 0.0477
NP_441239.1_9 Forward -60 -48 8.79043 0.122
NP_441239.1_9 Reverse -47 -59 8.6921 0.125
NP_441239.1_9 Forward -338 -326 6.1355 0.2
NP_441239.1_9 Forward -293 -281 4.5622 0.251
NP_441009.1_4 Forward -291 -272 12.0942 0.243
NP_441727.1_3 Reverse -94 -113 2.45773 0.3
NP_440796.1_3 Reverse -25 -43 7.88485 0.282
NP_442270.1_9 Reverse -38 -57 -10.0303 0.249
NP_442138.1_9 Forward -304 -285 7.86512 0.282
NP_442138.1_10 Reverse -49 -68 3.53937 0.114
NP_442809.1_3 Forward -77 -58 19.4681 0.156
NP_440546.1_4 Forward -58 -48 10.046 0.109
NP_440546.1_4 Reverse -49 -59 8.6886 0.176
NP_440546.1_4 Reverse -41 -51 7.04032 0.264
NP_441230.1_5 Reverse -322 -341 8.55425 0.142
NP_441230.1_5 Forward -63 -44 0.196116 0.273
NP_440675.1_3 Forward -340 -321 5.50599 0.282
NP_440462.1_6 Forward -43 -33 11.5831 0.0396
NP_440462.1_6 Forward -60 -50 7.55152 0.0741
NP_440462.1_6 Reverse -208 -218 5.09324 0.168
NP_442465.1_8 Forward -116 -97 16.3215 0.156
NP_440868.1_4 Forward -62 -50 0.628964 0.206
NP_440868.1_4 Forward -45 -33 -0.157684 0.248
NP_442499.1_1 Forward -57 -38 6.39097 0.206
NP_442499.1_3 Forward -59 -41 21.8486 0.0396
NP_442479.1_5 Reverse -15 -34 14.2087 0.222
NP_441474.1_1 Reverse -221 -240 -0.689632 0.255
NP_442402.1_4 Reverse -136 -155 -10.031 0.296
NP_440696.1_3 Forward -45 -27 -2.83245 0.279
NP_442039.1_4 Forward -57 -50 12.1338 0.063
NP_442039.1_4 Reverse -33 -40 8.10225 0.221
NP_441811.1_4 Forward -60 -41 -0.4922 0.295
NP_441811.1_8 Reverse -43 -57 8.45605 0.238
NP_441811.1_8 Forward -225 -211 6.78443 0.263
NP_440825.1_6 Forward -238 -219 12.9791 0.244
NP_442837.1_3 Forward -218 -211 8.79057 0.165
NP_442837.1_3 Forward -57 -50 6.0373 0.25
NP_442837.1_3 Reverse -50 -57 5.93897 0.265
NP_439994.1_1 Reverse -42 -61 12.9791 0.12
NP_442053.1_1 Forward -41 -32 11.1111 0.0437
NP_442053.1_1 Forward -58 -49 8.65285 0.0741
NP_442053.1_1 Reverse -49 -58 8.55452 0.0784
NP_440505.1_3 Forward -60 -50 14.4347 0.0217
NP_441788.1_10 Reverse -295 -314 14.1591 0.252
NP_440914.1_1 Forward -198 -188 7.5416 0.232
NP_441011.1_8 Reverse -50 -59 14.1594 0.0269
NP_441011.1_8 Reverse -33 -42 8.25953 0.144
NP_442533.1_1 Reverse -331 -350 -14.2585 0.241
NP_442533.1_6 Reverse -49 -58 8.55452 0.0747
NP_442533.1_6 Forward -58 -49 8.06287 0.082
NP_442533.1_6 Reverse -8 -17 2.85133 0.236
NP_442533.1_6 Forward -50 -41 1.37636 0.3
NP_441089.1_8 Forward -60 -41 15.0432 0.266
NP_442232.1_3 Reverse -41 -60 -11.3086 0.282
NP_442322.1_4 Reverse -223 -240 0.234807 0.21
NP_442322.1_4 Forward -343 -326 -4.09173 0.253
NP_440854.1_1 Forward -385 -366 8.83258 0.152
NP_443016.1_5 Forward -270 -251 4.52188 0.284
NP_441482.1_7 Reverse -43 -57 -1.18038 0.0637
NP_441482.1_7 Reverse -26 -40 -1.8687 0.0876
NP_439944.1_9 Forward -57 -47 7.94484 0.123
NP_441028.1_6 Forward -251 -241 3.8145 0.281
NP_440116.1_8 Forward -57 -38 -1.96717 0.122
NP_440007.1_9 Reverse -28 -42 1.86788 0.282
NP_442716.1_6 Reverse -41 -59 21.062 0.103
NP_443045.1_9 Forward -58 -40 15.4563 0.152
NP_441602.1_3 Forward -63 -44 -2.45882 0.233
NP_441602.1_3 Reverse -44 -63 -5.21209 0.28
NP_441602.1_8 Forward -302 -283 15.3391 0.236
NP_441972.1_5 Forward -342 -323 -6.29373 0.229
NP_441972.1_5 Forward -97 -78 -9.53865 0.288
NP_441106.1_1 Forward -59 -50 8.65285 0.0522
NP_441420.1_1 Forward -59 -40 -5.99873 0.297
NP_440429.1_2 Forward -57 -38 8.25926 0.272
NP_442306.1_10 Forward -63 -44 -19.2734 0.197
NP_441286.1_1 Forward -59 -47 4.95553 0.027
NP_442674.1_3 Forward -293 -274 4.62021 0.288
NP_440670.1_6 Reverse -219 -238 15.2408 0.292
NP_440670.1_8 Forward -58 -49 8.84951 0.0606
NP_440670.1_8 Reverse -49 -58 8.55452 0.066
NP_441930.1_2 Reverse -339 -349 12.8614 0.248
NP_439955.1_10 Forward -54 -35 12.4867 0.258
NP_440886.1_7 Forward -59 -49 8.04271 0.0805
NP_440886.1_7 Reverse -48 -58 7.45273 0.093
NP_440886.1_7 Forward -42 -32 6.76441 0.114
NP_440828.1_1 Forward -50 -31 -1.27961 0.285
NP_442072.1_9 Reverse -48 -66 -21.9087 0.215
NP_442072.1_9 Forward -344 -326 -22.302 0.229
NP_442072.1_9 Reverse -281 -299 -22.7936 0.259
NP_442072.1_9 Forward -59 -41 -23.3836 0.292
NP_442401.1_2 Forward -59 -40 18.2882 0.0904
NP_440907.2_8 Reverse -211 -221 11.091 0.0969
NP_440907.2_8 Forward -57 -47 9.71433 0.103
NP_440907.2_8 Forward -40 -30 5.09279 0.222
NP_440907.2_8 Reverse -50 -60 4.69947 0.25
NP_441021.1_1 Forward -57 -38 2.0644 0.083
NP_441463.1_3 Forward -350 -331 -8.45701 0.27
NP_441463.1_3 Forward -68 -49 -10.0303 0.288
NP_442056.1_1 Forward -70 -52 20.472 0.137
NP_442056.1_3 Forward -32 -13 21.2389 0.0401
NP_441626.1_2 Forward -57 -50 14.2971 0.0271
NP_441626.1_2 Reverse -50 -57 5.93897 0.231
NP_442362.1_7 Reverse -38 -56 9.65558 0.298
NP_442615.1_1 Forward -67 -49 3.46073 0.0542
NP_442615.1_1 Reverse -40 -58 -3.42244 0.161
NP_441962.1_4 Reverse -44 -63 -9.53865 0.218
NP_440387.1_1 Forward -58 -42 16.4798 0.0047
NP_440387.1_1 Reverse -210 -226 -5.448 0.232
NP_440387.1_5 Forward -352 -333 11.9031 0.26
NP_441431.1_2 Forward -61 -47 11.602 0.136
NP_441431.1_2 Forward -49 -35 5.99717 0.281
NP_441488.1_7 Reverse -43 -62 4.22769 0.193
NP_441836.1_2 Forward -304 -285 -5.01543 0.269
NP_440634.1_1 Forward -60 -41 11.8975 0.277
NP_440634.1_4 Reverse -326 -345 8.16093 0.257
NP_441993.1_1 Reverse -43 -62 14.5187 0.0768
NP_440114.1_10 Reverse -49 -63 15.1426 0.0294
NP_441500.1_8 Forward -120 -106 15.2096 0.264
NP_440293.1_3 Reverse -41 -60 4.12936 0.192
NP_440766.1_4 Reverse -28 -42 4.03116 0.137
NP_442743.1_1 Reverse -216 -235 9.7334 0.262
NP_439910.1_2 Forward -66 -49 -12.6459 0.0924
NP_440457.1_1 Reverse -28 -40 9.28209 0.0929
NP_440457.1_1 Reverse -45 -57 5.34885 0.141
NP_440457.1_1 Reverse -206 -218 3.2839 0.199
NP_440457.1_1 Forward -228 -216 1.51394 0.236
NP_441984.1_3 Forward -62 -44 12.9988 0.157
NP_441332.1_6 Forward -50 -40 11.8404 0.244
NP_442509.1_9 Reverse -32 -42 11.2876 0.138
NP_442509.1_9 Forward -41 -31 9.321 0.192
NP_442509.1_9 Forward -58 -48 7.64939 0.21
NP_442509.1_9 Reverse -49 -59 6.56775 0.263
NP_440554.1_4 Reverse -50 -60 6.8632 0.111
NP_441845.1_6 Forward -314 -296 -0.865831 0.279
NP_441885.1_5 Reverse -49 -59 10.2065 0.012
NP_441885.1_5 Forward -58 -48 1.65166 0.106
NP_442310.1_1 Forward -60 -41 13.7658 0.188
NP_442341.1_7 Forward -59 -45 14.6509 0.0277
NP_442341.1_7 Forward -42 -28 4.71948 0.181
NP_442341.1_7 Reverse -195 -209 3.63784 0.217
NP_441756.1_5 Forward -60 -41 2.75272 0.206
NP_440423.1_6 Reverse -41 -60 -12.4886 0.195
NP_440423.1_6 Reverse -24 -43 -21.3384 0.288
NP_443000.1_7 Forward -60 -50 1.84832 0.228
NP_440507.2_3 Reverse -40 -59 18.5831 0.0413
NP_440727.1_2 Forward -393 -374 -4.22878 0.295
NP_440275.1_3 Reverse -47 -57 9.7148 0.0533
NP_440275.1_3 Forward -60 -50 5.68323 0.136
NP_440091.1_1 Forward -62 -50 1.02229 0.218
NP_441359.1_5 Reverse -279 -298 0.491109 0.29
NP_442451.1_2 Forward -66 -47 -6.78538 0.232
NP_441122.1_1 Forward -28 -13 4.40479 0.28
NP_439962.1_4 Reverse -41 -60 -2.0655 0.224
NP_439962.1_4 Reverse -32 -51 -7.08038 0.287
NP_439962.1_4 Forward -344 -325 -8.45701 0.294
NP_441105.1_3 Forward -69 -50 -3.93378 0.188
NP_441105.1_3 Reverse -38 -57 -8.65367 0.275
NP_440216.1_1 Reverse -49 -63 6.29277 0.0156
NP_440216.1_1 Forward -219 -205 -11.9968 0.236
NP_440216.1_1 Forward -58 -44 -12.2918 0.256
NP_440216.1_1 Reverse -32 -46 -12.5868 0.288
NP_440172.1_1 Forward -58 -48 6.96153 0.0959
NP_442015.1_3 Forward -51 -32 9.7334 0.296
NP_442015.1_10 Forward -283 -270 1.10092 0.213
NP_442015.1_10 Forward -45 -32 -0.177378 0.255
NP_441226.1_7 Reverse -33 -40 9.77352 0.131
NP_441226.1_7 Reverse -50 -57 5.54531 0.289
NP_442222.1_1 Forward -293 -276 20.2942 0.15
NP_441111.1_7 Forward -57 -49 8.96754 0.0463
NP_441111.1_7 Reverse -50 -58 8.86921 0.0589
NP_441766.1_2 Forward -58 -49 7.76787 0.0714
NP_441766.1_2 Reverse -49 -58 7.66954 0.0723
NP_441766.1_2 Forward -41 -32 5.01461 0.148
NP_441766.1_9 Reverse -33 -52 4.42435 0.205
NP_442252.1_4 Reverse -31 -50 13.2741 0.269
NP_443052.1_8 Forward -68 -49 -10.3253 0.207
NP_443052.1_9 Forward -296 -277 2.65439 0.169
NP_443052.1_9 Reverse -278 -297 -2.65548 0.241
NP_443052.1_9 Forward -60 -41 -7.08038 0.293
NP_440072.1_5 Reverse -35 -53 -3.6191 0.281
NP_442403.1_8 Reverse -366 -385 -1.18052 0.256
NP_440591.1_9 Reverse -42 -60 16.4404 0.0752
NP_440591.1_9 Reverse -282 -300 7.19731 0.21
NP_442154.1_1 Reverse -33 -51 -15.6155 0.222
NP_442226.1_8 Reverse -364 -374 14.9263 0.254
NP_440261.1_5 Forward -57 -44 -10.0105 0.201
NP_440261.1_5 Reverse -335 -348 -12.4687 0.297
NP_440988.1_10 Reverse -219 -233 7.90002 0.212
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CACTTGGAGCCTGATGACCATGAAGACAGCCCAAATAACCCGCTGTTTAGCCCTCAGTGCCCTCACCACTGGCCTGTTCAGTTTCGCCCCCGTTCAGGGTCAATCCACCGGCACTGTCCCTGGAGAAGATCCCTTTGTTTCCAACAACGTTGACCCCAGTAAGCAGGGTTTGGGAGGGGGATTCGATCCCATGTCGTTGATTCACAATGCCAATTTGAGTCGCACCCGTAATGGGTCAGACTTTGCTGAGGATACCCAGAGAAATATCAATAAAGCCGCAGACCAGTTCAAGCAACTGCAACAGCAACGACTAATGGAAATGCAGCAACAGCAGACTGAACCGGCGATAGCCCCAGCCCCCGGATCGCCCTAGATTGGCTAATGGTTATGGGCTTGACCT

CDS

ATGGTACTGAAACTGAAACGGGGGACTTGGTTGCTCTGGACAGTGGCCTTAATGCTGGGGTTGGGCGTAGTGGCCTGGGAAATGAGTCGCACTCCTGAAGAGGGTACAACTACTGTCCAAAGTCCCTCTGTAAATCGCCATTTTGATTTCAGTGCTGATTTGGTGCAATCCATCACCATTACCCAGTCTGAGCCGAACCGAGCAGAGATCAAAATCTATCGCCGGGGGAAAGATAATAATGGTGACTCTGTTTGGTTGATGGATAATCCCCAGCCAGCGGCCGTGAGTGGTCCGGCGGTAGGATTTTTTGCTCAGTGTGGTCTTGGGCAGTCAGAACGACCGGGATTTTGA

Protein

MVLKLKRGTWLLWTVALMLGLGVVAWEMSRTPEEGTTTVQSPSVNRHFDFSADLVQSITITQSEPNRAEIKIYRRGKDNNGDSVWLMDNPQPAAVSGPAVGFFAQCGLGQSERPGF