Your browser is old and dusty. Try Google Chrome!

Details for sll0761

ORF sll0761
Accession NP_442058.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_2 Forward -26 -12 14.4536 0.234
NP_442655.1_10 Forward -180 -161 -11.7019 0.259
NP_442975.1_10 Reverse -374 -388 2.94893 0.266
NP_441802.1_1 Reverse -346 -365 11.4058 0.197
NP_440044.1_8 Forward -302 -283 -1.7705 0.251
NP_441781.1_7 Forward -217 -198 2.26107 0.21
NP_441434.1_8 Forward -35 -16 16.4671 0.122
NP_442889.1_10 Reverse -363 -382 13.1174 0.181
NP_442570.1_3 Forward -234 -215 -3.54046 0.222
NP_442570.1_10 Forward -351 -332 14.1591 0.189
NP_441327.1_5 Reverse -358 -367 13.9627 0.261
NP_440343.1_9 Forward -316 -297 6.29264 0.3
NP_440747.1_10 Reverse -291 -303 -12.2524 0.254
NP_441014.1_10 Reverse -235 -254 1.08032 0.234
NP_443018.1_3 Forward -272 -265 11.3472 0.0846
NP_443018.1_3 Reverse -265 -272 4.16902 0.278
NP_442485.1_3 Forward -353 -334 -2.45882 0.262
NP_442530.1_2 Reverse -36 -46 10.9931 0.284
NP_442658.1_1 Reverse -262 -272 5.28945 0.274
NP_442658.1_1 Reverse -331 -341 4.99446 0.288
NP_442690.1_1 Forward -384 -365 -2.45882 0.137
NP_442690.1_1 Reverse -362 -381 -11.3086 0.228
NP_442690.1_1 Forward -148 -129 -14.7502 0.273
NP_440809.1_8 Forward -158 -139 4.81767 0.295
NP_442440.1_9 Forward -188 -169 16.8132 0.184
NP_440147.1_4 Reverse -292 -305 0.904263 0.244
NP_440206.1_4 Reverse -226 -245 -1.37794 0.29
NP_440569.1_6 Forward -185 -166 1.47442 0.288
NP_441725.1_5 Forward -272 -262 5.19158 0.115
NP_442281.1_1 Reverse -328 -342 2.8506 0.253
NP_442500.1_8 Reverse -92 -106 10.6604 0.272
NP_441087.1_6 Forward -342 -324 3.16499 0.258
NP_442982.1_5 Reverse -192 -211 6.98095 0.135
NP_441644.1_6 Reverse -294 -304 4.50281 0.235
NP_441644.1_6 Forward -303 -293 3.22451 0.293
NP_442933.1_1 Forward -97 -78 9.40553 0.253
NP_442933.1_3 Forward -381 -362 14.8486 0.269
NP_442554.1_8 Forward -272 -262 3.12662 0.239
NP_442554.1_8 Reverse -265 -275 2.14332 0.281
NP_442142.1_4 Forward -354 -341 6.90188 0.153
NP_442016.1_2 Reverse -5 -24 17.1082 0.278
NP_440405.1_6 Reverse -260 -278 3.65739 0.26
NP_442301.1_2 Reverse -152 -171 3.44025 0.294
NP_441448.1_7 Reverse -326 -345 7.57094 0.26
NP_441468.1_1 Reverse -265 -272 3.97235 0.277
NP_441015.1_8 Reverse -318 -337 5.11266 0.258
NP_441015.1_10 Reverse -343 -362 -11.7019 0.3
NP_441637.1_9 Forward -379 -361 6.50899 0.245
NP_441637.1_9 Forward -31 -13 -4.50408 0.298
NP_441764.1_4 Reverse -366 -383 16.3796 0.0852
NP_442868.1_6 Reverse -292 -302 0.668351 0.213
NP_442719.1_2 Forward -126 -108 -9.91296 0.268
NP_442719.1_2 Reverse -366 -384 -11.8796 0.297
NP_442113.1_5 Forward -271 -252 6.68515 0.294
NP_440334.1_1 Forward -382 -363 14.2756 0.298
NP_440601.1_8 Forward -113 -94 17.9537 0.132
NP_441114.1_3 Forward -125 -116 6.5879 0.262
NP_441878.1_6 Forward -304 -294 -7.19813 0.21
NP_441445.1_8 Forward -340 -321 -11.9969 0.277
NP_442183.1_9 Forward -174 -164 9.81313 0.296
NP_441819.1_5 Reverse -362 -381 8.73709 0.293
NP_440547.1_1 Reverse -163 -182 16.4199 0.109
NP_441037.1_4 Reverse -262 -272 6.83041 0.239
NP_442764.1_8 Forward -362 -343 2.45773 0.281
NP_441728.2_4 Reverse -365 -384 11.6973 0.287
NP_441007.1_10 Reverse -259 -272 6.70579 0.16
NP_441559.1_8 Forward -352 -338 3.53951 0.143
NP_441559.1_8 Forward -308 -294 -0.393733 0.175
NP_441296.1_5 Forward -365 -346 14.0608 0.244
NP_442993.1_1 Reverse -294 -310 -12.9212 0.282
NP_441340.1_5 Forward -272 -265 4.07068 0.239
NP_441271.1_8 Forward -203 -193 13.8447 0.272
NP_442484.1_2 Forward -362 -343 -0.885524 0.277
NP_440168.1_8 Reverse -336 -355 4.52268 0.222
NP_440161.1_3 Forward -49 -30 8.35759 0.273
NP_441134.1_10 Forward -344 -326 13.6872 0.221
NP_440586.1_8 Forward -272 -265 12.8218 0.0395
NP_440586.1_8 Reverse -316 -323 7.02027 0.279
NP_440451.1_10 Reverse -163 -182 8.55343 0.264
NP_440398.1_6 Reverse -162 -181 12.3892 0.203
NP_441789.1_7 Reverse -299 -318 9.53674 0.193
NP_441789.1_7 Forward -356 -337 0.0970122 0.251
NP_441572.1_1 Forward -241 -222 -5.80207 0.269
NP_442114.1_8 Reverse -93 -107 7.47213 0.234
NP_441018.1_3 Forward -98 -79 10.2251 0.286
NP_442790.1_4 Reverse -255 -274 -9.34199 0.183
NP_442262.1_10 Forward -272 -265 10.3639 0.153
NP_440282.1_3 Forward -284 -265 1.37609 0.281
NP_440297.1_9 Forward -272 -262 0.373358 0.282
NP_440888.1_2 Forward -357 -343 6.78381 0.22
NP_441771.1_4 Reverse -89 -108 -1.96717 0.292
NP_441771.1_4 Reverse -370 -389 -4.42544 0.292
NP_442948.1_2 Reverse -203 -222 2.75272 0.3
NP_442277.1_7 Reverse -363 -379 -1.52107 0.278
NP_442337.1_8 Forward -250 -231 4.71934 0.21
NP_441462.1_2 Reverse -294 -304 -0.806614 0.254
NP_443062.1_1 Reverse -264 -282 3.96308 0.279
NP_442204.1_1 Forward -181 -170 0.94365 0.281
NP_442428.1_5 Reverse -265 -272 4.36568 0.271
NP_440673.1_3 Forward -391 -384 8.20058 0.234
NP_441052.1_2 Forward -303 -293 5.09324 0.132
NP_440436.1_4 Forward -341 -332 5.80084 0.182
NP_442414.1_2 Forward -109 -90 8.06259 0.29
NP_441004.1_1 Reverse -258 -277 -16.7168 0.287
NP_441004.1_4 Forward -319 -309 13.5497 0.216
NP_442430.1_4 Reverse -166 -185 17.5024 0.137
NP_441851.1_10 Reverse -263 -273 4.40493 0.271
NP_442515.1_1 Reverse -293 -307 0.88457 0.178
NP_441046.1_2 Reverse -361 -380 -1.37718 0.288
NP_442689.1_8 Forward -380 -363 1.41547 0.191
NP_442689.1_8 Forward -144 -127 -7.72931 0.292
NP_441349.1_10 Reverse -284 -303 -2.65548 0.124
NP_440432.1_9 Forward -341 -326 4.1098 0.0764
NP_442843.1_1 Reverse -265 -284 -11.7019 0.291
NP_440474.1_8 Reverse -334 -348 4.8172 0.266
NP_441124.1_5 Reverse -371 -381 12.1487 0.23
NP_440588.1_2 Forward -312 -293 -3.54046 0.189
NP_442006.1_2 Reverse -195 -212 -16.8741 0.265
NP_442006.1_2 Reverse -324 -341 -18.939 0.296
NP_441078.1_4 Forward -303 -294 -1.86856 0.272
NP_440526.1_3 Forward -272 -261 0.64819 0.273
NP_440629.1_4 Reverse -169 -188 15.6341 0.161
NP_442489.1_7 Forward -303 -294 -1.37691 0.195
NP_441659.2_8 Reverse -294 -304 6.17489 0.084
NP_441659.2_8 Forward -80 -70 1.25834 0.245
NP_440860.1_8 Forward -395 -376 20.2556 0.063
NP_441022.1_1 Reverse -24 -33 11.1625 0.284
NP_442849.1_2 Reverse -364 -381 25.3099 0.00493
NP_440779.1_5 Forward -342 -325 -5.1727 0.137
NP_442346.1_5 Reverse -293 -303 8.33817 0.14
NP_442346.1_10 Forward -344 -325 5.11266 0.168
NP_442346.1_10 Forward -353 -334 -1.86883 0.294
NP_440545.1_3 Forward -277 -260 -0.649475 0.157
NP_441050.1_1 Reverse -337 -356 11.6025 0.144
NP_441329.1_6 Reverse -362 -381 -1.28956 0.292
NP_442546.1_2 Forward -111 -92 4.12856 0.2
NP_441671.1_1 Forward -353 -334 -1.57384 0.291
NP_441813.1_7 Reverse -294 -308 11.4053 0.223
NP_440590.1_4 Reverse -72 -85 -0.177378 0.179
NP_440821.1_4 Reverse -262 -272 -0.609952 0.279
NP_441239.1_9 Forward -344 -332 3.2839 0.289
NP_441892.1_1 Forward -282 -265 -2.51776 0.223
NP_442643.1_3 Reverse -163 -182 1.0811 0.203
NP_440863.1_1 Reverse -116 -130 14.096 0.248
NP_441617.1_8 Reverse -169 -188 12.7816 0.215
NP_442052.1_8 Reverse -331 -341 12.1731 0.285
NP_442052.1_8 Reverse -116 -126 12.1731 0.285
NP_440401.1_8 Reverse -336 -355 3.44104 0.29
NP_442479.1_9 Reverse -110 -129 -7.86702 0.266
NP_441848.1_4 Reverse -16 -32 8.12362 0.288
NP_440696.1_6 Forward -92 -73 7.66927 0.249
NP_442533.1_6 Reverse -294 -303 5.60459 0.137
NP_442533.1_6 Forward -303 -294 3.7363 0.204
NP_440263.1_3 Forward -238 -219 1.27776 0.295
NP_442322.1_4 Reverse -165 -182 -1.63347 0.226
NP_441482.1_9 Forward -129 -116 16.2433 0.278
NP_441028.1_6 Forward -366 -356 5.38779 0.255
NP_441527.1_4 Reverse -144 -163 -7.11457 0.23
NP_441527.1_4 Reverse -326 -345 -13.0351 0.298
NP_440007.1_9 Forward -84 -70 0.491246 0.297
NP_440480.1_10 Reverse -374 -388 14.8469 0.269
NP_442306.1_10 Forward -308 -289 -20.65 0.219
NP_442058.1_1 Forward -296 -277 27.8262 0.00182
NP_442058.1_2 Forward -350 -331 37.2669 0.00000544
NP_442058.1_3 Forward -274 -256 32.4684 0.0000634
NP_442058.1_4 Forward -155 -136 29.4793 0.000247
NP_442058.1_5 Forward -324 -305 21.4356 0.0637
NP_442058.1_6 Forward -380 -361 34.5136 0.0000171
NP_442058.1_7 Forward -131 -112 22.2214 0.059
NP_442058.1_8 Forward -250 -231 20.8646 0.268
NP_442058.1_9 Forward -399 -385 22.6157 0.0204
NP_440670.1_8 Reverse -71 -80 3.44131 0.267
NP_440886.1_7 Reverse -293 -303 6.0761 0.147
NP_442382.1_2 Forward -292 -273 8.06259 0.289
NP_442213.1_5 Forward -358 -339 -1.96717 0.293
NP_440907.2_8 Forward -272 -262 4.69947 0.25
NP_441463.1_3 Forward -352 -333 -5.9004 0.235
NP_441836.1_2 Forward -309 -290 2.45773 0.172
NP_441836.1_10 Reverse -339 -358 8.25926 0.197
NP_440634.1_6 Reverse -293 -307 16.4209 0.2
NP_440737.1_1 Reverse -332 -351 7.66927 0.251
NP_440311.1_3 Reverse -303 -322 14.3558 0.236
NP_440766.1_5 Reverse -369 -381 15.7726 0.18
NP_441237.1_9 Forward -272 -262 14.4347 0.0376
NP_440213.1_4 Forward -243 -224 15.2531 0.251
NP_442940.1_4 Forward -185 -166 17.8957 0.231
NP_441984.1_3 Reverse -304 -322 7.88563 0.239
NP_441436.1_2 Reverse -345 -364 -3.93378 0.28
NP_440473.1_9 Reverse -253 -272 -5.80207 0.22
NP_441173.1_9 Forward -186 -178 10.2454 0.261
NP_442395.2_4 Reverse -168 -187 0.293673 0.274
NP_441122.1_1 Reverse -74 -89 6.86307 0.28
NP_442015.1_3 Reverse -292 -311 9.83173 0.296
NP_441766.1_9 Forward -341 -322 -2.95047 0.29
NP_443052.1_8 Reverse -194 -213 -3.73712 0.106
NP_442116.1_6 Forward -381 -364 15.9038 0.129
NP_442116.1_6 Reverse -364 -381 7.78699 0.254
NP_442154.1_1 Forward -179 -161 -18.0738 0.276
NP_442154.1_1 Forward -170 -152 -18.7621 0.285
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACATTGAATTGATTGCGGTAATTTTTGTCACTAATTTACCCCTACTCTTCGCCAGTACTGCCCTTGCTCCTTTGGACTTCATGGCCCATTGGTTGCAGGTGGTGGCCAGTTTAAATCCATTAACCTATGCCATCGAACCAATCCGTTACATTTACCTGAATGGCAACTGGGGTTTGGATAGTACGGTTTTGACTGCCCCTTGGTTCAGTTTGAATTTCGCCCAGGTATTGGGGGTGTTAGTTTTGTTTGATGGTTTAGTATTGTTATTAATCCAACCTTTGCTCAAACGTCGCTTTTTGTGATTTTGTCTGTTGATCATAGCTGATCGTATTTGTTCAACAACCGTATCTCGGCAACATTGAGCTGTAAAGTTTTAGACCAATTAACCACTTGGAGCCTG

CDS

ATGACCATGAAGACAGCCCAAATAACCCGCTGTTTAGCCCTCAGTGCCCTCACCACTGGCCTGTTCAGTTTCGCCCCCGTTCAGGGTCAATCCACCGGCACTGTCCCTGGAGAAGATCCCTTTGTTTCCAACAACGTTGACCCCAGTAAGCAGGGTTTGGGAGGGGGATTCGATCCCATGTCGTTGATTCACAATGCCAATTTGAGTCGCACCCGTAATGGGTCAGACTTTGCTGAGGATACCCAGAGAAATATCAATAAAGCCGCAGACCAGTTCAAGCAACTGCAACAGCAACGACTAATGGAAATGCAGCAACAGCAGACTGAACCGGCGATAGCCCCAGCCCCCGGATCGCCCTAG

Protein

MTMKTAQITRCLALSALTTGLFSFAPVQGQSTGTVPGEDPFVSNNVDPSKQGLGGGFDPMSLIHNANLSRTRNGSDFAEDTQRNINKAADQFKQLQQQRLMEMQQQQTEPAIAPAPGSP