Your browser is old and dusty. Try Google Chrome!

Details for sll0759

ORF sll0759
Accession NP_442060.1
Symbol
Category ABC transporter ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -119 -133 3.24451 0.166
NP_441418.1_6 Reverse -106 -125 -29.1065 0.216
NP_441418.1_6 Reverse -211 -230 -29.7948 0.238
NP_441418.1_6 Reverse -199 -218 -30.2865 0.267
NP_441453.1_4 Reverse -334 -342 3.85433 0.284
NP_442169.1_1 Reverse -164 -183 -2.85214 0.282
NP_442655.1_1 Reverse -156 -175 0.196116 0.24
NP_443002.1_5 Forward -117 -99 12.8014 0.212
NP_442752.1_4 Reverse -118 -125 9.18389 0.116
NP_443027.1_4 Reverse -332 -342 9.32148 0.166
NP_442975.1_10 Forward -347 -333 8.25877 0.103
NP_440784.1_7 Reverse -335 -342 8.59391 0.129
NP_442909.1_7 Forward -342 -328 9.34041 0.154
NP_440061.1_9 Forward -130 -116 7.57046 0.202
NP_439979.1_2 Reverse -108 -127 11.6025 0.192
NP_442062.1_8 Reverse -334 -344 6.07655 0.138
NP_440044.1_8 Forward -342 -323 12.4875 0.0427
NP_440044.1_8 Reverse -329 -348 4.42435 0.114
NP_441781.1_7 Forward -209 -190 -0.197208 0.256
NP_440908.1_2 Reverse -102 -115 18.0132 0.269
NP_441935.1_1 Reverse -109 -128 6.58763 0.27
NP_441594.1_6 Forward -136 -117 4.22769 0.222
NP_442742.1_9 Reverse -252 -271 -10.522 0.269
NP_442110.1_7 Reverse -71 -85 1.37622 0.23
NP_442110.1_7 Forward -349 -335 -0.393733 0.287
NP_440856.1_7 Reverse -316 -335 -9.63698 0.294
NP_441434.1_3 Forward -51 -32 2.26107 0.194
NP_440655.1_2 Forward -336 -317 1.17943 0.293
NP_442675.1_4 Reverse -326 -344 -3.91409 0.257
NP_441770.1_4 Reverse -215 -234 -12.7836 0.297
NP_441770.1_5 Reverse -320 -339 1.37609 0.238
NP_442570.1_3 Reverse -116 -135 -5.50708 0.244
NP_441025.1_5 Forward -111 -97 13.9626 0.282
NP_441163.1_1 Reverse -170 -187 9.47787 0.226
NP_440438.2_8 Reverse -6 -25 10.8159 0.0796
NP_440747.1_10 Forward -212 -200 -12.4491 0.282
NP_441854.1_8 Forward -237 -219 17.1287 0.279
NP_441486.1_1 Reverse -331 -345 8.25939 0.032
NP_441486.1_1 Forward -346 -332 -0.983719 0.166
NP_441014.1_10 Reverse -306 -325 2.85027 0.216
NP_442848.1_1 Reverse -328 -342 -2.06536 0.263
NP_442848.1_1 Forward -349 -335 -4.4253 0.291
NP_442848.1_9 Reverse -100 -119 -0.590531 0.278
NP_441012.1_4 Forward -196 -183 10.639 0.262
NP_441634.1_8 Forward -129 -115 6.19444 0.114
NP_441634.1_8 Forward -234 -220 -4.62196 0.295
NP_440376.1_1 Reverse -118 -127 0.0980582 0.285
NP_440066.1_5 Forward -124 -105 6.68515 0.272
NP_442485.1_3 Forward -234 -215 -3.24547 0.272
NP_442485.1_3 Reverse -323 -342 -4.6221 0.285
NP_442485.1_3 Reverse -104 -123 -5.99873 0.297
NP_441846.1_10 Reverse -107 -126 -15.3402 0.247
NP_441013.1_2 Forward -122 -104 0.21581 0.254
NP_441422.1_7 Forward -120 -103 5.54538 0.0992
NP_441422.1_7 Reverse -101 -118 -8.22096 0.266
NP_440360.1_10 Forward -332 -318 4.32615 0.227
NP_440360.1_10 Forward -227 -213 1.96621 0.277
NP_440141.1_4 Reverse -106 -125 -10.227 0.298
NP_440141.1_8 Reverse -100 -119 6.09597 0.271
NP_442782.1_2 Reverse -119 -133 1.96621 0.281
NP_440607.1_8 Reverse -212 -231 -0.197208 0.283
NP_441256.1_1 Forward -226 -207 -6.49039 0.239
NP_441165.1_10 Forward -112 -94 12.9988 0.212
NP_441127.1_1 Reverse -325 -339 12.291 0.215
NP_441127.1_1 Reverse -100 -114 8.55439 0.29
NP_442685.1_6 Forward -138 -119 25.4663 0.00987
NP_440203.1_5 Forward -331 -321 10.4026 0.225
NP_442876.1_7 Reverse -279 -297 14.3755 0.292
NP_441162.1_3 Reverse -102 -121 10.5209 0.211
NP_442376.1_2 Reverse -103 -122 -12.1936 0.286
NP_442911.1_2 Forward -125 -106 -8.65367 0.239
NP_441580.1_6 Reverse -107 -126 -0.590531 0.168
NP_440153.1_8 Forward -118 -105 -2.24233 0.235
NP_442236.1_1 Forward -124 -105 3.44104 0.207
NP_440993.1_3 Forward -125 -106 0.785326 0.247
NP_440827.1_3 Reverse -107 -126 11.6025 0.268
NP_441348.1_7 Reverse -114 -133 8.16093 0.289
NP_440411.1_10 Reverse -38 -57 14.8485 0.194
NP_441646.1_1 Forward -140 -121 10.6192 0.115
NP_441646.1_1 Reverse -34 -53 0.687771 0.245
NP_441646.1_1 Reverse -111 -130 -0.787193 0.272
NP_441646.1_1 Reverse -118 -137 -1.96717 0.298
NP_442438.1_10 Forward -348 -334 6.58777 0.113
NP_442438.1_10 Reverse -323 -337 1.08123 0.206
NP_442431.1_10 Reverse -208 -226 8.27895 0.151
NP_442431.1_10 Reverse -211 -229 5.13236 0.206
NP_442431.1_10 Reverse -103 -121 0.609134 0.269
NP_440206.1_9 Reverse -205 -224 7.27595 0.292
NP_441041.1_4 Reverse -103 -122 -3.14714 0.119
NP_442004.1_6 Reverse -328 -342 1.27789 0.294
NP_440703.1_9 Forward -49 -36 13.195 0.192
NP_440736.1_6 Forward -111 -92 12.5858 0.251
NP_442941.1_3 Forward -342 -332 0.668351 0.19
NP_440983.1_5 Forward -127 -108 -9.14533 0.3
NP_440260.1_8 Reverse -37 -55 0.21581 0.202
NP_440260.1_8 Reverse -90 -108 -2.83245 0.246
NP_440260.1_8 Reverse -115 -133 -5.78238 0.279
NP_441079.1_7 Forward -101 -82 -7.17944 0.288
NP_440437.1_1 Forward -349 -330 -4.03212 0.248
NP_442012.1_5 Reverse -102 -121 1.27776 0.275
NP_441087.1_6 Forward -341 -323 -2.63651 0.296
NP_440723.1_8 Reverse -105 -119 13.5693 0.178
NP_443030.1_1 Forward -26 -9 8.10198 0.261
NP_441644.1_6 Forward -343 -333 3.51951 0.277
NP_441644.1_8 Reverse -106 -125 14.3558 0.289
NP_442177.1_5 Reverse -211 -225 8.65272 0.276
NP_442029.1_10 Reverse -308 -327 8.35759 0.25
NP_441346.1_6 Reverse -317 -335 17.7187 0.22
NP_442933.1_10 Forward -343 -334 10.6195 0.0484
NP_442554.1_8 Forward -342 -332 5.28991 0.153
NP_441762.1_7 Reverse -105 -117 -5.07423 0.187
NP_442142.1_4 Reverse -331 -344 3.06699 0.268
NP_442142.1_4 Forward -226 -213 2.87033 0.273
NP_442292.1_1 Forward -342 -333 -0.68859 0.268
NP_442292.1_2 Reverse -11 -25 16.8098 0.248
NP_441525.1_1 Reverse -324 -337 14.8673 0.21
NP_442381.1_8 Reverse -106 -125 -14.2585 0.28
NP_443009.1_5 Reverse -333 -344 6.05637 0.177
NP_443009.1_5 Forward -128 -117 3.49977 0.292
NP_442301.1_2 Forward -230 -211 3.9319 0.284
NP_441715.1_3 Forward -278 -268 18.2696 0.214
NP_441715.1_4 Reverse -335 -345 5.19158 0.224
NP_440279.1_8 Forward -351 -332 14.8474 0.242
NP_441448.1_1 Forward -345 -326 5.60432 0.261
NP_440379.1_5 Reverse -109 -128 -4.13045 0.208
NP_441468.1_1 Forward -342 -335 4.26735 0.246
NP_441015.1_10 Reverse -107 -126 -2.16383 0.178
NP_441015.1_10 Reverse -209 -228 -9.53865 0.282
NP_441731.1_2 Forward -117 -98 16.0274 0.142
NP_441016.2_6 Forward -229 -210 6.39016 0.258
NP_442757.1_7 Reverse -216 -235 11.7008 0.254
NP_442253.1_5 Reverse -121 -138 -6.84433 0.298
NP_442253.1_5 Reverse -37 -54 -7.13932 0.298
NP_441826.1_2 Reverse -328 -342 -0.688726 0.22
NP_441764.1_4 Forward -25 -8 9.40874 0.286
NP_441251.1_5 Forward -174 -155 12.1925 0.289
NP_442227.1_2 Forward -335 -316 -0.787193 0.259
NP_442808.1_1 Forward -128 -118 1.5529 0.282
NP_440918.1_2 Reverse -38 -57 10.6192 0.259
NP_442820.1_5 Forward -259 -240 8.35759 0.228
NP_442113.1_10 Forward -227 -208 -0.000545616 0.205
NP_442050.1_1 Reverse -105 -124 9.83255 0.247
NP_440342.1_2 Reverse -100 -119 9.14423 0.261
NP_441114.1_3 Forward -132 -123 7.96454 0.231
NP_441114.1_3 Reverse -126 -135 7.57121 0.231
NP_440558.1_2 Forward -337 -318 3.44104 0.156
NP_440558.1_2 Forward -137 -118 0.392778 0.191
NP_440558.1_2 Reverse -37 -56 -5.60541 0.262
NP_440558.1_2 Reverse -174 -193 -6.98204 0.284
NP_440923.1_2 Forward -26 -7 16.1855 0.243
NP_441878.1_6 Forward -134 -124 -7.49312 0.231
NP_441557.1_5 Reverse -334 -343 -0.885252 0.26
NP_441445.1_1 Reverse -115 -134 1.67108 0.248
NP_441445.1_1 Forward -346 -327 -0.688862 0.3
NP_441590.1_4 Forward -125 -106 2.75194 0.293
NP_442066.2_4 Forward -115 -96 -0.885524 0.182
NP_442795.1_5 Reverse -119 -138 15.3391 0.0924
NP_441308.1_8 Reverse -116 -126 9.81313 0.226
NP_440101.1_3 Reverse -218 -237 14.1591 0.0682
NP_440101.1_3 Reverse -323 -342 2.45773 0.256
NP_441458.1_10 Forward -352 -333 5.40766 0.216
NP_442397.1_9 Forward -56 -37 2.26107 0.28
NP_440440.1_2 Forward -123 -104 16.1249 0.233
NP_442444.1_6 Reverse -320 -338 13.501 0.244
NP_441549.1_9 Reverse -120 -138 -2.53746 0.198
NP_441549.1_9 Reverse -115 -133 -9.22396 0.244
NP_441549.1_9 Reverse -330 -348 -9.81395 0.261
NP_441549.1_9 Reverse -36 -54 -10.0106 0.268
NP_442347.1_2 Reverse -201 -210 8.06287 0.116
NP_442347.1_2 Forward -342 -333 5.01461 0.244
NP_442645.1_2 Reverse -326 -345 -16.8151 0.242
NP_442645.1_2 Reverse -116 -135 -20.4534 0.288
NP_441633.1_3 Forward -234 -221 -2.53732 0.177
NP_442764.1_8 Reverse -314 -333 4.81767 0.241
NP_442590.1_10 Reverse -328 -347 8.35759 0.208
NP_442590.1_10 Reverse -112 -131 7.47261 0.226
NP_442998.1_5 Forward -51 -41 12.3697 0.174
NP_440299.1_1 Forward -116 -103 4.14862 0.217
NP_441799.1_1 Reverse -330 -344 13.8636 0.0293
NP_441799.1_1 Forward -341 -327 4.03056 0.269
NP_441799.1_4 Forward -336 -317 -3.73712 0.203
NP_440640.1_6 Reverse -100 -119 3.83436 0.213
NP_441007.1_10 Reverse -215 -228 7.88576 0.126
NP_441449.1_8 Forward -105 -86 12.8237 0.298
NP_440256.1_1 Reverse -331 -350 2.0644 0.0683
NP_440087.1_1 Reverse -325 -344 -4.81876 0.246
NP_441090.1_6 Reverse -268 -282 10.6193 0.226
NP_442007.1_8 Forward -230 -212 11.0314 0.258
NP_441559.1_8 Forward -338 -324 2.2612 0.147
NP_441559.1_8 Reverse -36 -50 1.17956 0.156
NP_441559.1_8 Forward -122 -108 -5.11362 0.248
NP_441559.1_8 Reverse -173 -187 -5.60527 0.267
NP_441559.1_8 Reverse -113 -127 -7.08024 0.283
NP_442860.1_7 Forward -255 -237 6.5807 0.294
NP_440915.1_6 Reverse -114 -128 1.27789 0.142
NP_440717.1_2 Forward -117 -98 -10.0303 0.245
NP_440164.1_2 Forward -27 -8 12.2908 0.102
NP_440306.1_9 Reverse -326 -345 16.9124 0.165
NP_440695.1_5 Forward -349 -330 -0.295539 0.284
NP_442993.1_1 Reverse -118 -134 -12.0362 0.265
NP_442386.1_9 Forward -344 -335 5.21086 0.262
NP_442386.1_9 Forward -56 -47 4.91586 0.276
NP_441340.1_9 Forward -20 -10 13.3648 0.204
NP_442327.1_8 Forward -262 -244 17.668 0.285
NP_441947.1_4 Forward -354 -335 10.4225 0.299
NP_442484.1_2 Reverse -308 -327 -0.688862 0.271
NP_442791.1_5 Reverse -160 -179 -0.983855 0.21
NP_440327.1_6 Reverse -88 -107 6.98095 0.228
NP_439976.1_4 Forward -121 -102 5.80018 0.278
NP_442240.1_1 Forward -123 -104 3.04693 0.295
NP_442240.1_2 Reverse -335 -354 -16.3235 0.244
NP_440161.1_3 Forward -308 -289 10.0292 0.235
NP_441160.1_5 Reverse -92 -111 0.982764 0.288
NP_440586.1_1 Reverse -99 -118 9.3409 0.182
NP_440586.1_1 Reverse -102 -121 -6.39206 0.299
NP_440586.1_8 Reverse -335 -342 9.28187 0.164
NP_440586.1_8 Forward -336 -329 7.51192 0.239
NP_442959.1_4 Reverse -319 -338 15.4374 0.161
NP_440027.1_3 Forward -127 -109 13.7847 0.122
NP_440027.1_3 Forward -118 -100 9.45814 0.184
NP_440027.1_3 Forward -133 -115 5.03327 0.249
NP_439937.1_8 Reverse -101 -120 5.40766 0.192
NP_439937.1_8 Reverse -104 -123 3.53937 0.204
NP_439937.1_9 Forward -188 -171 -4.2884 0.157
NP_439937.1_9 Forward -335 -318 -12.7448 0.276
NP_440408.1_10 Reverse -100 -119 8.45592 0.176
NP_442239.1_8 Reverse -207 -226 8.25926 0.249
NP_441789.1_7 Forward -126 -107 -4.72118 0.288
NP_441803.1_2 Forward -120 -101 11.1109 0.0764
NP_441803.1_2 Reverse -329 -348 2.55606 0.209
NP_441803.1_2 Forward -117 -98 1.17943 0.238
NP_441803.1_2 Forward -126 -107 0.491109 0.251
NP_441803.1_2 Forward -123 -104 -0.197208 0.269
NP_442384.1_10 Forward -343 -330 14.7689 0.0132
NP_442384.1_10 Reverse -328 -341 11.3273 0.0367
NP_442384.1_10 Reverse -67 -80 1.00259 0.271
NP_440364.1_6 Forward -118 -105 13.9817 0.275
NP_440364.1_10 Reverse -215 -234 17.994 0.211
NP_441018.1_7 Reverse -330 -349 12.0942 0.17
NP_440344.1_10 Reverse -111 -128 -13.8258 0.296
NP_440531.1_6 Forward -116 -97 7.27595 0.0998
NP_441060.1_1 Reverse -325 -344 11.4019 0.294
NP_441335.1_8 Reverse -219 -238 11.5042 0.204
NP_441965.1_10 Forward -346 -330 10.8749 0.107
NP_441965.1_10 Reverse -325 -341 2.61514 0.285
NP_442693.1_7 Reverse -151 -170 7.7676 0.282
NP_440297.1_9 Forward -342 -332 -0.806614 0.297
NP_443036.1_1 Forward -281 -262 11.7983 0.244
NP_442067.1_4 Forward -123 -104 5.89931 0.231
NP_442067.1_4 Forward -354 -335 4.12936 0.265
NP_440999.1_2 Forward -372 -353 11.7008 0.211
NP_440999.1_9 Forward -347 -333 4.03116 0.119
NP_440888.1_2 Forward -127 -113 12.0937 0.0516
NP_440600.1_1 Reverse -372 -391 15.135 0.206
NP_440237.1_5 Forward -159 -145 16.3219 0.155
NP_441949.1_5 Forward -25 -6 14.1506 0.182
NP_441543.1_2 Reverse -335 -344 10.1278 0.0788
NP_442845.1_2 Forward -133 -119 3.34284 0.294
NP_440380.1_1 Reverse -100 -119 -9.53865 0.261
NP_442710.1_7 Forward -395 -376 -5.97332 0.294
NP_441469.1_8 Reverse -177 -186 8.55452 0.227
NP_442315.1_1 Reverse -212 -230 12.9005 0.131
NP_441621.1_7 Reverse -104 -118 14.6509 0.0266
NP_441621.1_7 Forward -117 -103 -4.32697 0.219
NP_441929.1_3 Reverse -296 -315 7.7676 0.264
NP_441601.1_4 Forward -224 -205 0.491109 0.262
NP_441601.1_4 Reverse -101 -120 -4.81876 0.293
NP_441601.1_4 Forward -119 -100 -5.70374 0.294
NP_440519.1_8 Reverse -103 -119 6.15506 0.21
NP_442204.1_1 Reverse -207 -218 1.63197 0.267
NP_442204.1_5 Forward -353 -334 1.47442 0.235
NP_440454.1_2 Forward -26 -12 18.728 0.119
NP_442428.1_4 Reverse -117 -136 3.73603 0.24
NP_442428.1_5 Forward -342 -335 11.4455 0.062
NP_442428.1_7 Forward -272 -253 6.58763 0.275
NP_440603.1_5 Reverse -38 -57 9.73422 0.183
NP_440673.1_2 Reverse -324 -343 12.4382 0.149
NP_440673.1_2 Reverse -105 -124 9.12141 0.257
NP_440673.1_3 Forward -332 -325 6.72562 0.277
NP_441052.1_2 Forward -343 -333 6.07655 0.0943
NP_441052.1_2 Reverse -223 -233 1.94665 0.221
NP_442219.1_8 Reverse -219 -238 6.23444 0.3
NP_442219.1_9 Forward -342 -333 4.81794 0.196
NP_440436.1_4 Reverse -335 -344 4.42421 0.265
NP_441884.1_9 Forward -189 -170 -13.3736 0.138
NP_441884.1_9 Reverse -103 -122 -19.8634 0.161
NP_441884.1_9 Reverse -217 -236 -20.7484 0.205
NP_441893.1_10 Reverse -102 -121 22.2223 0.04
NP_440689.1_4 Reverse -215 -233 18.8004 0.141
NP_441086.1_3 Reverse -236 -255 8.34704 0.231
NP_441004.1_1 Reverse -103 -122 -14.8485 0.271
NP_441004.1_1 Reverse -100 -119 -15.0452 0.271
NP_441004.1_1 Reverse -319 -338 -17.6018 0.292
NP_441004.1_2 Reverse -314 -333 2.16274 0.216
NP_442139.1_7 Forward -354 -335 9.43923 0.248
NP_442873.1_3 Forward -230 -211 3.83357 0.279
NP_442206.1_4 Forward -242 -223 6.78429 0.259
NP_440463.1_8 Forward -119 -100 6.24133 0.271
NP_441046.1_2 Forward -348 -329 8.65258 0.221
NP_441046.1_2 Reverse -323 -342 7.07928 0.221
NP_442689.1_8 Reverse -11 -28 -3.99273 0.26
NP_442843.1_1 Forward -342 -323 -11.4069 0.291
NP_439960.1_10 Reverse -312 -330 -0.177514 0.218
NP_439960.1_10 Reverse -204 -222 -0.7675 0.237
NP_439960.1_10 Forward -118 -100 -3.6191 0.277
NP_442006.1_2 Reverse -205 -222 -14.2191 0.203
NP_441003.1_9 Forward -170 -151 8.35759 0.224
NP_441570.1_1 Forward -343 -325 -9.61729 0.142
NP_441432.1_8 Reverse -333 -342 5.89959 0.13
NP_441333.1_1 Reverse -390 -400 12.3526 0.237
NP_441732.1_2 Forward -347 -331 -15.6744 0.155
NP_440497.1_2 Reverse -92 -111 3.14605 0.3
NP_440290.1_1 Forward -103 -94 17.3727 0.21
NP_442797.1_1 Forward -230 -211 8.16093 0.137
NP_442797.1_1 Forward -125 -106 -1.47551 0.236
NP_442797.1_7 Forward -56 -38 -1.65248 0.299
NP_440199.1_10 Forward -340 -330 15.2213 0.0861
NP_440199.1_10 Reverse -331 -341 15.2213 0.0861
NP_440713.1_4 Reverse -108 -127 2.0644 0.273
NP_442489.1_7 Forward -343 -334 -1.6719 0.235
NP_441706.1_10 Reverse -96 -115 14.8474 0.132
NP_441800.1_7 Forward -228 -210 11.1305 0.113
NP_442346.1_5 Reverse -333 -343 11.6814 0.0606
NP_442346.1_5 Forward -338 -328 10.3048 0.101
NP_440459.1_2 Reverse -373 -390 9.57695 0.224
NP_441653.1_2 Reverse -107 -126 6.9118 0.225
NP_440010.1_4 Reverse -330 -349 0.490334 0.248
NP_440010.1_4 Forward -239 -220 -2.8529 0.291
NP_442311.1_8 Forward -325 -306 9.73422 0.278
NP_442060.1_5 Forward -350 -331 18.1907 0.235
NP_442060.1_5 Reverse -321 -340 14.7491 0.235
NP_441112.1_6 Reverse -254 -273 -4.03212 0.296
NP_440671.1_4 Forward -349 -335 5.01447 0.297
NP_442045.1_5 Forward -121 -102 -0.295539 0.269
NP_441813.1_2 Forward -115 -101 20.6491 0.177
NP_440590.1_4 Forward -114 -101 -5.09393 0.274
NP_440590.1_4 Reverse -109 -122 -5.48725 0.28
NP_440590.1_6 Reverse -152 -166 18.5841 0.287
NP_440567.1_4 Reverse -88 -107 0.786102 0.281
NP_441951.1_4 Forward -127 -108 2.3594 0.283
NP_440665.1_1 Reverse -307 -326 -9.53865 0.244
NP_441508.1_1 Reverse -8 -27 10.942 0.275
NP_442643.1_3 Forward -225 -206 4.42435 0.137
NP_440546.1_6 Reverse -318 -337 20.354 0.0493
NP_440546.1_6 Reverse -213 -232 10.3242 0.247
NP_440675.1_3 Reverse -304 -323 5.30933 0.287
NP_442479.1_9 Reverse -289 -308 -11.2103 0.273
NP_440036.1_1 Reverse -278 -297 9.3409 0.277
NP_441084.1_6 Forward -248 -234 10.4106 0.241
NP_441811.1_8 Reverse -322 -336 9.34103 0.227
NP_441811.1_8 Forward -349 -335 6.98109 0.259
NP_440825.1_6 Reverse -220 -239 13.1758 0.244
NP_441102.1_10 Reverse -316 -335 12.3892 0.137
NP_441252.1_6 Reverse -294 -301 14.1004 0.25
NP_440308.1_6 Reverse -97 -116 1.17943 0.296
NP_441408.2_7 Forward -375 -356 -0.590531 0.234
NP_440914.1_1 Forward -133 -123 9.68861 0.178
NP_440914.1_1 Reverse -118 -128 7.44401 0.237
NP_440914.1_1 Forward -246 -236 6.66328 0.269
NP_440914.1_4 Forward -336 -320 11.6609 0.271
NP_442533.1_6 Reverse -334 -343 12.8811 0.0253
NP_442533.1_6 Forward -127 -118 4.12963 0.191
NP_442533.1_6 Forward -337 -328 3.04799 0.228
NP_442541.1_10 Forward -128 -114 1.5723 0.283
NP_442232.1_3 Reverse -317 -336 -2.36049 0.163
NP_439944.1_9 Forward -342 -332 6.76487 0.168
NP_441028.1_6 Reverse -201 -211 3.51951 0.292
NP_440007.1_9 Forward -382 -368 0.589577 0.294
NP_441602.1_3 Reverse -113 -132 5.80098 0.141
NP_441602.1_3 Forward -132 -113 -2.26216 0.233
NP_441602.1_4 Forward -354 -335 9.93088 0.278
NP_441106.1_1 Forward -344 -335 4.32629 0.227
NP_441930.1_2 Forward -134 -124 17.9746 0.19
NP_441930.1_2 Reverse -124 -134 15.5163 0.19
NP_440886.1_7 Forward -116 -106 6.76441 0.114
NP_440886.1_7 Forward -221 -211 6.37109 0.13
NP_440886.1_7 Forward -224 -214 6.0761 0.147
NP_440828.1_1 Forward -116 -97 2.55527 0.231
NP_442382.1_9 Forward -165 -146 7.66846 0.29
NP_441463.1_2 Reverse -239 -257 -0.0137829 0.285
NP_441463.1_3 Forward -233 -214 -3.63879 0.181
NP_441463.1_6 Reverse -122 -136 5.83613 0.287
NP_442221.1_4 Reverse -102 -121 10.8159 0.282
NP_442365.1_7 Forward -341 -322 -6.29373 0.289
NP_440107.1_5 Forward -128 -109 0.196116 0.178
NP_442794.1_1 Reverse -336 -348 7.4138 0.138
NP_441962.1_4 Reverse -104 -123 -8.16202 0.196
NP_441962.1_4 Forward -114 -95 -14.5535 0.29
NP_440855.1_1 Reverse -97 -116 2.26107 0.209
NP_441431.1_3 Reverse -112 -131 6.98095 0.249
NP_441836.1_2 Reverse -322 -341 0.786102 0.197
NP_440634.1_10 Forward -340 -321 8.94676 0.221
NP_441993.1_1 Reverse -220 -239 2.43397 0.259
NP_440287.1_6 Reverse -20 -39 3.04771 0.226
NP_440293.1_10 Reverse -211 -230 -2.36049 0.273
NP_440293.1_10 Reverse -106 -125 -2.65548 0.274
NP_441237.1_9 Forward -133 -123 9.7148 0.272
NP_440457.1_1 Forward -137 -125 -0.452677 0.263
NP_441801.1_4 Reverse -202 -212 2.63497 0.29
NP_441436.1_2 Reverse -161 -180 -6.88371 0.296
NP_442509.1_1 Forward -124 -105 16.1257 0.228
NP_441440.1_8 Reverse -106 -119 13.7856 0.299
NP_440448.1_5 Forward -259 -240 8.45592 0.261
NP_440554.1_4 Reverse -335 -345 4.0116 0.205
NP_441428.1_8 Forward -140 -121 2.55606 0.268
NP_442703.1_9 Reverse -248 -266 5.32902 0.244
NP_442341.1_7 Forward -128 -114 10.9143 0.0591
NP_442341.1_7 Reverse -333 -347 8.35772 0.0881
NP_442341.1_9 Forward -136 -122 5.21053 0.277
NP_441756.1_5 Reverse -219 -238 -4.72043 0.295
NP_441173.1_9 Reverse -285 -293 10.6388 0.261
NP_440423.1_10 Reverse -375 -394 14.2574 0.172
NP_440423.1_10 Reverse -327 -346 12.1925 0.203
NP_443000.1_7 Reverse -332 -342 4.40493 0.199
NP_440507.2_3 Reverse -331 -350 11.5033 0.179
NP_442513.1_5 Reverse -206 -225 7.57013 0.282
NP_440091.1_1 Forward -310 -298 1.02229 0.218
NP_440091.1_1 Reverse -324 -336 0.432302 0.25
NP_441902.1_3 Forward -319 -309 11.6212 0.293
NP_439962.1_4 Reverse -104 -123 3.44104 0.189
NP_439962.1_4 Reverse -101 -120 2.55606 0.197
NP_439962.1_4 Forward -123 -104 -2.45882 0.23
NP_439962.1_4 Forward -117 -98 -5.31042 0.278
NP_439962.1_4 Forward -126 -107 -8.752 0.298
NP_439962.1_4 Forward -120 -101 -8.94866 0.298
NP_442495.1_4 Reverse -267 -277 11.8781 0.258
NP_440149.1_8 Forward -343 -324 7.47261 0.0628
NP_440149.1_8 Reverse -328 -347 5.50599 0.0746
NP_441105.1_3 Forward -354 -335 -5.21209 0.214
NP_442373.1_2 Reverse -100 -119 1.67108 0.162
NP_442015.1_10 Forward -347 -334 7.49244 0.0855
NP_442417.1_5 Forward -373 -359 4.81781 0.288
NP_440416.1_9 Forward -119 -100 -15.2418 0.187
NP_440416.1_9 Reverse -39 -58 -20.65 0.287
NP_443052.1_9 Forward -119 -100 14.6508 0.0495
NP_443052.1_9 Forward -224 -205 11.1109 0.0971
NP_443052.1_9 Forward -335 -316 3.04771 0.165
NP_443052.1_9 Forward -227 -208 -1.96717 0.231
NP_443052.1_9 Reverse -98 -117 -2.45882 0.238
NP_443052.1_9 Forward -122 -103 -3.63879 0.251
NP_443052.1_9 Forward -125 -106 -3.93378 0.253
NP_443052.1_9 Forward -233 -214 -7.27704 0.295
NP_440072.1_4 Reverse -104 -123 21.6323 0.141
NP_442154.1_1 Reverse -212 -230 -4.8974 0.125
NP_442154.1_1 Reverse -206 -224 -13.3539 0.217
NP_442154.1_1 Reverse -92 -110 -15.9105 0.228
NP_442226.1_8 Reverse -94 -104 14.1397 0.26
NP_441430.1_6 Reverse -107 -126 11.0125 0.252
NP_440988.1_2 Forward -224 -206 17.4237 0.116
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAACGAAAATCCATTTCCAATTGTGAAGCCAACTCTGAAGTCAATAATCTAGCGACAGTGATGGCCATCATTGCCCCCACTAGGGGAGTGAACAACAATTGCACAATTTGTAGAACTCTCTGGCCCAGCAACTTTTTTGAGCCAAACAATTCAAACAAAGACCAACTGGTCAACACCGCCACTACCACCTGGGGATTAACCCTCCAGAGTAGGGGCACTTCCGACCATAACTGACCTTGGATTAGACCAACTATTAACAACGGTAGGGCAATGCGCATCCCCGCCGCTGCCGCCGCTGACAAAATTGCGAGGATTCCAAGGAGGGTGCTCATTAAAGTTCAAACCGGGAGGGCAAAACCGACCATATCAGGGATAATGTTAAGAAAAGTTGCAGACTAA

CDS

ATGGGAAAGAGTTACCTCATGGGCGTTGCTGTTCAAGTCAAACAACTCCGAAAAAAGTACGGTGCTATCCCTGCGGTGAAGGACATTTCCTTTGCGGTGCCCAGGGGAGAGATATTTGGTTTACTTGGTCCCAACGGTGCCGGTAAGACCACCACTATCCGTTGCTTATGTACTCTAGCCAAACCAGACGGAGGGGAACTGTGGATTGATGGCGTAAACGTATTAAGCGATCCCCGCCAGGCCCGGCGCCGTTTAGGCTATGTGGCCCAGGAAGTTGCCATAGATAAAATCTTAACAGGTCGAGAATTGTTGCAACTACAAGCTTCCCTCTACCATCTTGATGCCATTAGCTCTCAAAAACGCATCGACCAACTTTTAGATATTTTGGGCTTAACAGCCTATGCAGATCAGAAAACTGGAACTTATTCCGGCGGGCTAAAAAAACGTTTGGACCTAGCAGCAGGTTTACTCCATCAACCAACGGTGTTGGTGTTGGATGAACCATCGGTGGGGCTAGACATTGAAAGTCGCTTTATTCTCTGGGAATTTTTGCGCCAATTGCGAGATGCAGGCACTACGGTAGTAATTACAAGCCATTACCTGGAGGAAATTGATGCCCTAGCCGATCGCCTAGCCATCATTGACCAGGGCACAGTTATCGCCACCGGCACCCCCACGGAACTAAAAGACCGGGTAGGGGGGGACAGGGTCACCCTCAGAATTAAGGAATTTACGGCAGACCAGGAAGCAGAAAAAGCTAGCCAAATTCTCCGCTCCCTAGCTTTCGTTCAGGAAGTGATTGTCAACCAAGCCCAAGGCAATTCCCTCAATCTGGTGGTGACGCCCCAGAGTAATCCCCTCAGTCAGATCGAAAAAGCCCTACTCGCTGACGGTTTACCGATTTTCAGCTTGGCCCAATCCCGACCTAGTTTGGATGATGTGTACCTAGCGGCCACCGGCAAAACCCTGATGGATGCGGACTTGGCCGCTGCTGCCCAACGGGATCTCAAAGCAGAAAAAAAACAAGCGATGAAAGCTAGTTAA

Protein

MGKSYLMGVAVQVKQLRKKYGAIPAVKDISFAVPRGEIFGLLGPNGAGKTTTIRCLCTLAKPDGGELWIDGVNVLSDPRQARRRLGYVAQEVAIDKILTGRELLQLQASLYHLDAISSQKRIDQLLDILGLTAYADQKTGTYSGGLKKRLDLAAGLLHQPTVLVLDEPSVGLDIESRFILWEFLRQLRDAGTTVVITSHYLEEIDALADRLAIIDQGTVIATGTPTELKDRVGGDRVTLRIKEFTADQEAEKASQILRSLAFVQEVIVNQAQGNSLNLVVTPQSNPLSQIEKALLADGLPIFSLAQSRPSLDDVYLAATGKTLMDADLAAAAQRDLKAEKKQAMKAS