Your browser is old and dusty. Try Google Chrome!

Details for sll0757

ORF sll0757
Accession NP_442062.1
Symbol purF
Category Purine ribonucleotide biosynthesis
Definition amidophosphoribosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -164 -178 1.27789 0.192
NP_440557.1_1 Reverse -328 -347 0.294447 0.265
NP_440795.1_7 Forward -335 -328 14.6904 0.0123
NP_440795.1_7 Reverse -328 -335 14.6904 0.0123
NP_441418.1_6 Reverse -300 -319 -21.4367 0.149
NP_442291.1_5 Reverse -326 -342 0.0585348 0.174
NP_440897.1_6 Reverse -14 -33 -3.83621 0.257
NP_441453.1_4 Forward -336 -328 16.539 0.00633
NP_441453.1_4 Reverse -327 -335 7.8859 0.0536
NP_442151.1_6 Forward -336 -322 12.3893 0.0749
NP_442151.1_6 Reverse -327 -341 9.83269 0.139
NP_442151.1_6 Reverse -94 -108 5.50613 0.274
NP_441818.1_1 Reverse -328 -339 9.59626 0.232
NP_441721.1_1 Reverse -340 -359 6.88262 0.181
NP_442173.1_1 Reverse -328 -336 15.4574 0.00633
NP_442173.1_1 Forward -335 -327 14.1791 0.0165
NP_442752.1_4 Forward -336 -329 13.8055 0.0199
NP_443027.1_4 Forward -338 -328 16.2046 0.0437
NP_443027.1_4 Reverse -325 -335 6.07655 0.294
NP_441812.1_3 Reverse -326 -340 11.701 0.21
NP_442975.1_10 Forward -340 -326 9.83206 0.0626
NP_442975.1_10 Forward -224 -210 4.32555 0.245
NP_440784.1_7 Forward -335 -328 15.9687 0.0123
NP_440784.1_7 Reverse -328 -335 15.9687 0.0123
NP_440061.1_9 Reverse -339 -353 7.57046 0.202
NP_440110.1_4 Forward -347 -328 15.2408 0.0777
NP_440110.1_8 Reverse -325 -344 -2.26216 0.265
NP_442062.1_3 Reverse -251 -270 -2.0655 0.265
NP_442062.1_4 Forward -314 -295 20.354 0.0687
NP_442062.1_8 Forward -336 -326 16.6963 0.00399
NP_442062.1_10 Forward -228 -209 21.2389 0.0316
NP_441900.1_2 Forward -307 -289 -0.571569 0.27
NP_440304.1_4 Forward -338 -328 19.9412 0.00364
NP_440304.1_4 Reverse -92 -102 6.56821 0.15
NP_442242.1_4 Forward -335 -328 14.3954 0.0124
NP_442242.1_4 Reverse -328 -335 14.3954 0.0124
NP_440044.1_5 Forward -100 -81 18.1907 0.13
NP_440044.1_8 Reverse -328 -347 18.7807 0.0159
NP_441208.1_9 Reverse -324 -338 6.3911 0.246
NP_441208.1_9 Forward -16 -2 6.09611 0.253
NP_441594.1_6 Forward -312 -293 5.60432 0.209
NP_442110.1_7 Reverse -327 -341 3.24451 0.213
NP_441925.1_5 Reverse -382 -396 17.1092 0.109
NP_440014.1_6 Forward -89 -70 9.73422 0.254
NP_441083.1_5 Forward -336 -326 10.5998 0.0192
NP_441083.1_5 Reverse -327 -337 1.94665 0.197
NP_441434.1_1 Reverse -359 -373 15.9588 0.186
NP_441434.1_1 Forward -263 -249 7.07802 0.288
NP_441738.1_2 Reverse -329 -336 15.28 0.0102
NP_441738.1_2 Forward -334 -327 11.5435 0.084
NP_441738.1_2 Forward -225 -218 6.72528 0.236
NP_440209.1_1 Forward -336 -328 18.1123 0.00295
NP_440209.1_1 Reverse -327 -335 8.47588 0.0457
NP_442889.1_1 Reverse -294 -313 -3.3438 0.145
NP_442889.1_8 Forward -339 -325 19.2718 0.0084
NP_440447.1_1 Forward -341 -323 8.57394 0.194
NP_441713.1_1 Reverse -321 -340 5.40766 0.0568
NP_441713.1_1 Forward -361 -342 -15.0452 0.26
NP_441770.1_1 Forward -316 -297 10.7167 0.279
NP_442570.1_3 Reverse -298 -317 -7.37537 0.27
NP_441716.1_1 Reverse -294 -308 5.89945 0.211
NP_441716.1_1 Reverse -306 -320 5.50613 0.227
NP_442111.1_4 Reverse -326 -340 9.34103 0.0609
NP_441387.1_8 Forward -264 -245 17.9043 0.175
NP_440343.1_3 Reverse -334 -352 3.8533 0.266
NP_440906.1_5 Forward -335 -328 15.8704 0.0124
NP_440906.1_5 Reverse -328 -335 15.8704 0.0124
NP_440438.2_8 Reverse -251 -270 0.687771 0.289
NP_440747.1_10 Reverse -324 -336 14.887 0.00223
NP_440747.1_10 Forward -339 -327 -11.6624 0.131
NP_440747.1_10 Reverse -297 -309 -12.4491 0.282
NP_441486.1_1 Forward -339 -325 6.58777 0.0344
NP_441486.1_1 Reverse -324 -338 1.96621 0.0939
NP_442634.1_4 Forward -338 -324 -1.77037 0.149
NP_441014.1_10 Reverse -299 -318 -2.36125 0.274
NP_441014.1_10 Reverse -305 -324 -3.04956 0.292
NP_442848.1_1 Forward -342 -328 -4.22864 0.282
NP_442848.1_4 Reverse -180 -194 20.2558 0.0858
NP_441012.1_4 Forward -313 -300 12.0157 0.249
NP_441012.1_4 Forward -307 -294 10.639 0.262
NP_443018.1_3 Forward -335 -328 14.8871 0.0123
NP_443018.1_3 Reverse -328 -335 14.8871 0.0123
NP_441316.1_7 Forward -338 -323 12.8613 0.0486
NP_440376.1_1 Forward -336 -327 9.73449 0.0365
NP_440376.1_1 Reverse -327 -336 9.63616 0.0385
NP_440376.1_1 Reverse -211 -220 -0.68859 0.291
NP_441857.1_5 Reverse -320 -338 3.26407 0.246
NP_441588.1_4 Reverse -329 -339 6.66654 0.185
NP_442730.1_8 Reverse -298 -317 4.32522 0.273
NP_442730.1_8 Reverse -319 -338 4.12856 0.273
NP_442687.1_7 Forward -310 -300 5.87989 0.183
NP_442687.1_7 Reverse -3 -13 4.50326 0.245
NP_442191.1_4 Reverse -328 -342 11.5748 0.252
NP_442485.1_3 Forward -320 -301 -1.08219 0.255
NP_440642.1_10 Forward -224 -210 2.06395 0.284
NP_441422.1_2 Forward -230 -211 11.5033 0.173
NP_442658.1_1 Forward -338 -328 13.0576 0.04
NP_442658.1_1 Reverse -325 -335 4.89613 0.292
NP_440656.1_8 Forward -347 -328 1.86774 0.123
NP_441414.1_9 Forward -336 -317 14.0608 0.013
NP_441478.1_10 Forward -38 -20 3.06666 0.289
NP_441256.1_1 Forward -318 -299 -6.49039 0.239
NP_441958.1_5 Forward -337 -327 12.0747 0.00222
NP_441958.1_5 Reverse -326 -336 2.43831 0.0422
NP_442605.1_4 Reverse -17 -36 11.9958 0.268
NP_440203.1_5 Forward -100 -90 10.4026 0.225
NP_440203.1_5 Reverse -343 -353 9.321 0.263
NP_439905.1_1 Forward -308 -295 16.7355 0.0578
NP_440995.1_8 Reverse -317 -336 3.83436 0.264
NP_440984.1_7 Reverse -295 -309 5.89945 0.235
NP_440984.1_7 Reverse -336 -350 5.21113 0.265
NP_439990.1_5 Reverse -322 -335 15.5556 0.0534
NP_442690.1_1 Reverse -273 -292 -12.5869 0.245
NP_442690.1_1 Reverse -245 -264 -15.7335 0.28
NP_442911.1_2 Reverse -317 -336 -0.39387 0.0747
NP_440153.1_5 Reverse -328 -342 2.94952 0.219
NP_442064.1_1 Reverse -322 -341 35.4969 0.00000451
NP_442064.1_2 Reverse -271 -290 34.8086 0.0000106
NP_442064.1_3 Reverse -343 -362 31.1704 0.0000137
NP_442064.1_4 Reverse -296 -315 22.713 0.021
NP_442064.1_4 Reverse -290 -309 7.86512 0.237
NP_442064.1_4 Reverse -323 -342 5.30853 0.271
NP_442064.1_10 Reverse -245 -264 21.8289 0.047
NP_440169.1_5 Forward -83 -64 17.2074 0.223
NP_442002.1_9 Reverse -3 -10 9.08556 0.289
NP_441294.1_7 Forward -340 -326 14.242 0.0448
NP_442438.1_10 Forward -341 -327 0.392915 0.229
NP_442431.1_7 Reverse -368 -387 5.89931 0.273
NP_441000.1_6 Reverse -326 -340 -3.83532 0.225
NP_440484.1_3 Forward -338 -324 10.7177 0.242
NP_440147.1_4 Reverse -325 -338 1.29759 0.233
NP_441550.1_8 Forward -338 -328 13.0576 0.0273
NP_441550.1_8 Reverse -325 -335 11.3859 0.0503
NP_441916.1_7 Reverse -327 -337 10.6981 0.0261
NP_441916.1_7 Forward -336 -326 0.963343 0.297
NP_440465.1_4 Reverse -326 -345 15.4374 0.184
NP_441041.1_4 Forward -336 -317 1.57275 0.0804
NP_441041.1_7 Reverse -324 -336 6.73736 0.195
NP_442996.1_1 Forward -265 -246 9.97848 0.21
NP_441547.1_2 Forward -347 -329 4.34571 0.249
NP_442004.1_6 Reverse -340 -354 11.8976 0.115
NP_441725.1_5 Reverse -328 -338 11.1898 0.0247
NP_441725.1_5 Forward -335 -325 0.766681 0.149
NP_441725.1_5 Reverse -301 -311 -0.511621 0.26
NP_439966.1_7 Forward -338 -328 14.8275 0.0177
NP_439966.1_7 Reverse -325 -335 4.69947 0.263
NP_442941.1_3 Reverse -328 -338 19.9412 0.00262
NP_442941.1_3 Forward -335 -325 1.65166 0.147
NP_440289.1_1 Forward -396 -379 17.7671 0.229
NP_440289.1_2 Forward -339 -326 4.14919 0.0706
NP_440260.1_8 Reverse -173 -191 1.69077 0.183
NP_441514.1_6 Reverse -217 -224 12.8221 0.252
NP_442281.1_1 Forward -341 -327 6.98048 0.111
NP_442281.1_1 Forward -314 -300 3.73557 0.221
NP_441334.1_7 Reverse -325 -344 -12.2919 0.146
NP_441079.1_7 Forward -265 -246 15.3382 0.0554
NP_440437.1_1 Forward -342 -323 0.0977854 0.172
NP_442012.1_1 Forward -86 -67 6.39097 0.13
NP_441556.1_4 Forward -318 -299 17.2356 0.113
NP_441556.1_4 Reverse -85 -104 13.8614 0.185
NP_441556.1_10 Reverse -322 -336 15.3807 0.145
NP_441644.1_6 Forward -336 -326 14.9258 0.00847
NP_441644.1_6 Reverse -327 -337 9.71433 0.0705
NP_441644.1_6 Forward -309 -299 9.616 0.0728
NP_441644.1_6 Reverse -300 -310 3.42118 0.282
NP_442215.1_2 Reverse -325 -341 10.8749 0.0448
NP_442215.1_2 Forward -75 -59 -6.52964 0.273
NP_440929.1_8 Forward -336 -327 17.4043 0.00289
NP_440929.1_8 Reverse -327 -336 17.4043 0.00289
NP_442933.1_10 Forward -336 -327 9.04618 0.063
NP_442933.1_10 Reverse -327 -336 8.94785 0.0643
NP_441751.2_8 Reverse -328 -342 6.3911 0.0354
NP_441751.2_8 Forward -335 -321 -4.91696 0.187
NP_442554.1_8 Reverse -328 -338 16.9913 0.0065
NP_442554.1_8 Forward -335 -325 11.9764 0.0312
NP_442554.1_8 Forward -308 -298 4.50326 0.184
NP_442554.1_8 Reverse -301 -311 2.92996 0.249
NP_441762.1_7 Forward -337 -325 -6.84419 0.284
NP_442142.1_4 Reverse -324 -337 5.82024 0.182
NP_442142.1_4 Forward -16 -3 4.73861 0.212
NP_442142.1_4 Forward -339 -326 4.44361 0.222
NP_442142.1_4 Forward -312 -299 2.67367 0.281
NP_442292.1_1 Forward -335 -326 17.896 0.00435
NP_442292.1_1 Reverse -328 -337 17.5026 0.00435
NP_442476.1_6 Reverse -72 -86 3.14618 0.161
NP_442476.1_6 Forward -335 -321 2.85119 0.171
NP_442476.1_6 Reverse -341 -355 0.589577 0.252
NP_440895.1_6 Reverse -321 -334 11.9173 0.202
NP_443009.1_5 Forward -337 -326 9.10461 0.0965
NP_443009.1_5 Reverse -326 -337 4.77807 0.23
NP_443009.1_5 Forward -14 -3 4.38475 0.249
NP_443009.1_5 Forward -351 -340 3.8931 0.274
NP_443009.1_5 Reverse -70 -81 3.69644 0.282
NP_441715.1_4 Reverse -328 -338 14.238 0.0295
NP_440279.1_2 Reverse -295 -314 4.52268 0.298
NP_441448.1_1 Reverse -289 -308 4.52268 0.278
NP_441198.1_8 Forward -338 -328 13.2713 0.108
NP_441468.1_1 Forward -335 -328 15.8704 0.0124
NP_441468.1_1 Reverse -328 -335 15.8704 0.0124
NP_441618.1_7 Reverse -328 -347 14.7658 0.295
NP_441015.1_10 Reverse -89 -108 -9.63698 0.282
NP_441015.1_10 Forward -354 -335 -10.0303 0.282
NP_441673.1_1 Forward -336 -327 11.1111 0.0121
NP_441673.1_1 Reverse -327 -336 11.0128 0.018
NP_441826.1_2 Reverse -300 -314 9.34103 0.0612
NP_441826.1_2 Forward -342 -328 5.30946 0.0977
NP_441826.1_2 Forward -109 -95 -1.08205 0.234
NP_442490.1_9 Forward -348 -329 -7.08038 0.275
NP_442868.1_6 Forward -338 -328 1.06167 0.205
NP_442868.1_6 Reverse -325 -335 0.865012 0.205
NP_442361.1_3 Forward -342 -329 9.85238 0.272
NP_441911.1_10 Reverse -355 -374 8.75181 0.25
NP_442808.1_1 Reverse -339 -349 2.63453 0.26
NP_441101.1_10 Reverse -302 -321 -5.99873 0.287
NP_442542.1_9 Forward -343 -329 10.1271 0.121
NP_442050.1_1 Reverse -81 -100 15.4374 0.187
NP_442050.1_5 Forward -338 -328 18.0724 0.00365
NP_442050.1_5 Reverse -325 -335 7.0594 0.27
NP_442903.1_2 Forward -270 -251 15.899 0.093
NP_441114.1_3 Reverse -159 -168 8.65285 0.231
NP_441114.1_3 Forward -71 -62 7.27622 0.247
NP_440558.1_2 Forward -106 -87 0.884433 0.185
NP_440558.1_2 Reverse -297 -316 -0.4922 0.203
NP_441518.1_3 Forward -346 -327 -10.4236 0.244
NP_441878.1_6 Forward -310 -300 10.4031 0.0176
NP_441878.1_6 Forward -337 -327 0.766681 0.134
NP_441878.1_6 Reverse -299 -309 0.668351 0.139
NP_441878.1_6 Reverse -326 -336 0.57002 0.14
NP_441878.1_6 Forward -14 -4 -7.49312 0.231
NP_441036.1_8 Reverse -326 -336 7.35486 0.201
NP_441036.1_8 Forward -337 -327 6.07655 0.242
NP_442650.1_2 Forward -336 -322 8.06273 0.13
NP_441557.1_5 Reverse -327 -336 17.4043 0.0023
NP_441557.1_5 Forward -336 -327 10.8161 0.00464
NP_441445.1_1 Forward -318 -299 2.3594 0.235
NP_441433.1_8 Reverse -207 -226 5.30933 0.178
NP_441308.1_8 Forward -338 -328 13.353 0.218
NP_441458.1_10 Forward -106 -87 2.16274 0.273
NP_441549.1_9 Reverse -323 -341 -4.70074 0.198
NP_441549.1_9 Reverse -296 -314 -6.27403 0.198
NP_441638.1_1 Forward -357 -338 9.83255 0.232
NP_442347.1_2 Forward -335 -326 10.1278 0.0622
NP_442347.1_2 Reverse -328 -337 3.34298 0.284
NP_442645.1_2 Forward -351 -332 -15.5368 0.203
NP_441037.1_4 Forward -338 -328 7.31769 0.237
NP_441037.1_4 Reverse -325 -335 6.92787 0.237
NP_442594.1_8 Reverse -55 -74 9.83255 0.186
NP_442594.1_8 Reverse -211 -230 6.09597 0.236
NP_440151.1_5 Reverse -170 -189 4.81767 0.262
NP_441633.1_3 Reverse -325 -338 2.77255 0.0865
NP_441633.1_3 Reverse -339 -352 -6.76555 0.271
NP_440136.1_2 Forward -335 -328 15.9687 0.0123
NP_440136.1_2 Reverse -328 -335 15.9687 0.0123
NP_442590.1_10 Reverse -294 -313 6.78429 0.237
NP_442998.1_10 Reverse -329 -336 15.5754 0.0102
NP_442998.1_10 Forward -11 -4 9.28223 0.117
NP_442998.1_10 Forward -334 -327 5.84064 0.235
NP_440899.1_2 Forward -347 -328 9.53674 0.176
NP_440299.1_1 Reverse -323 -336 11.1301 0.0518
NP_441799.1_1 Forward -340 -326 10.422 0.0747
NP_441799.1_1 Reverse -323 -337 9.6354 0.0879
NP_441007.1_10 Forward -341 -328 2.77255 0.183
NP_441007.1_10 Reverse -322 -335 0.707601 0.219
NP_441007.1_10 Forward -114 -101 -0.964025 0.296
NP_440256.1_1 Reverse -324 -343 15.6341 0.00669
NP_440256.1_1 Reverse -303 -322 -6.88371 0.223
NP_440256.1_1 Forward -106 -87 -8.16202 0.253
NP_441090.1_4 Forward -266 -248 17.5743 0.151
NP_441512.1_4 Reverse -90 -109 12.7825 0.212
NP_441559.1_8 Forward -355 -341 -6.49025 0.279
NP_440717.1_1 Reverse -72 -91 6.09597 0.265
NP_442069.1_6 Forward -315 -296 3.83436 0.3
NP_440537.1_7 Reverse -240 -259 11.0289 0.263
NP_441939.1_3 Reverse -328 -347 5.80098 0.263
NP_442386.1_9 Reverse -326 -335 12.5856 0.058
NP_442386.1_9 Reverse -87 -96 11.0124 0.107
NP_442386.1_9 Reverse -339 -348 9.43907 0.161
NP_442386.1_9 Forward -337 -328 6.39082 0.219
NP_441750.1_4 Reverse -323 -342 8.25926 0.159
NP_441340.1_5 Forward -335 -328 15.6737 0.0124
NP_441340.1_5 Reverse -328 -335 15.6737 0.0124
NP_442327.1_3 Forward -266 -247 9.97848 0.203
NP_440586.1_8 Forward -335 -328 13.2151 0.026
NP_440586.1_8 Reverse -328 -335 13.2151 0.026
NP_440586.1_8 Forward -308 -301 5.8403 0.283
NP_442874.1_5 Forward -307 -288 9.53756 0.292
NP_442251.1_6 Forward -335 -328 15.2804 0.0124
NP_442251.1_6 Reverse -328 -335 15.2804 0.0124
NP_442251.1_6 Forward -12 -5 6.43063 0.298
NP_442959.1_5 Reverse -244 -263 10.2259 0.224
NP_441262.1_3 Reverse -327 -334 14.8871 0.0223
NP_441262.1_3 Forward -336 -329 14.7888 0.0223
NP_443051.1_1 Forward -337 -328 19.5676 0.00335
NP_443051.1_1 Reverse -326 -335 8.35786 0.0371
NP_441595.1_5 Reverse -64 -82 7.00065 0.222
NP_440408.1_7 Reverse -88 -107 15.8307 0.138
NP_440408.1_7 Forward -321 -302 12.6841 0.205
NP_440372.1_2 Forward -335 -328 16.3621 0.0124
NP_440372.1_2 Reverse -328 -335 16.3621 0.0124
NP_441789.1_7 Forward -214 -195 -5.50783 0.298
NP_440819.1_5 Forward -391 -383 7.98423 0.228
NP_440316.1_10 Reverse -93 -103 5.48657 0.295
NP_439977.1_5 Reverse -321 -340 1.17943 0.195
NP_440139.1_1 Forward -342 -323 6.1935 0.143
NP_441572.1_7 Forward -342 -323 0.982764 0.157
NP_440267.1_2 Forward -341 -327 7.07881 0.21
NP_442666.1_4 Forward -308 -289 16.7939 0.275
NP_442384.1_10 Forward -336 -323 5.82081 0.118
NP_442384.1_10 Reverse -294 -307 2.77255 0.213
NP_441018.1_7 Reverse -296 -315 10.6192 0.201
NP_441018.1_7 Reverse -290 -309 8.06259 0.256
NP_441018.1_7 Reverse -323 -342 7.47261 0.269
NP_442262.1_10 Forward -335 -328 14.1988 0.0123
NP_442262.1_10 Reverse -328 -335 14.1988 0.0123
NP_441689.1_5 Forward -338 -328 17.8758 0.0158
NP_440344.1_10 Forward -316 -299 -3.50107 0.0833
NP_440344.1_10 Forward -343 -326 -9.49926 0.147
NP_440344.1_10 Forward -356 -339 -13.9242 0.298
NP_440282.1_10 Forward -319 -300 -0.0988766 0.205
NP_440531.1_6 Forward -344 -325 2.85105 0.15
NP_442917.1_1 Forward -270 -251 18.1898 0.03
NP_440487.1_7 Reverse -335 -354 11.5042 0.141
NP_441965.1_3 Forward -359 -340 -1.86883 0.297
NP_441965.1_10 Forward -339 -323 11.5633 0.107
NP_440297.1_9 Reverse -301 -311 9.32148 0.0917
NP_440297.1_9 Reverse -328 -338 9.22315 0.0917
NP_440297.1_9 Forward -335 -325 0.176696 0.282
NP_441592.1_4 Forward -309 -290 5.30933 0.135
NP_440999.1_9 Reverse -323 -337 -3.63866 0.299
NP_440888.1_2 Forward -103 -89 8.94708 0.142
NP_440888.1_2 Reverse -327 -341 8.94708 0.142
NP_440600.1_4 Reverse -319 -337 -1.06249 0.162
NP_441543.1_2 Reverse -328 -337 15.9293 0.00518
NP_441543.1_2 Forward -335 -326 7.37455 0.127
NP_442845.1_2 Forward -342 -328 5.99778 0.219
NP_442845.1_2 Reverse -321 -335 4.71948 0.254
NP_441551.1_5 Reverse -323 -339 6.35103 0.273
NP_441918.1_7 Reverse -305 -324 -2.55715 0.297
NP_440982.1_1 Forward -220 -201 4.03023 0.294
NP_442710.1_7 Forward -264 -245 2.86879 0.147
NP_441469.1_8 Reverse -326 -335 6.8829 0.227
NP_441469.1_8 Forward -337 -328 6.5879 0.227
NP_442578.1_7 Forward -335 -328 14.5921 0.026
NP_442578.1_7 Reverse -328 -335 14.5921 0.026
NP_440710.1_1 Forward -344 -326 -1.25915 0.179
NP_440071.1_6 Reverse -208 -222 15.841 0.235
NP_441462.1_2 Reverse -327 -337 10.4031 0.011
NP_441462.1_2 Forward -336 -326 2.7333 0.0792
NP_443062.1_1 Forward -336 -318 13.9088 0.0553
NP_442204.1_1 Forward -340 -329 0.157002 0.283
NP_441560.1_8 Reverse -322 -341 13.0709 0.232
NP_440516.1_2 Reverse -321 -339 -1.16082 0.276
NP_440516.1_8 Forward -336 -327 9.53783 0.0136
NP_440516.1_8 Reverse -327 -336 7.07956 0.0867
NP_440516.1_8 Reverse -100 -109 0.0980582 0.143
NP_442428.1_5 Forward -335 -328 15.8704 0.0124
NP_442428.1_5 Reverse -328 -335 15.8704 0.0124
NP_441443.1_10 Reverse -302 -320 1.78836 0.275
NP_440673.1_2 Forward -319 -300 17.0231 0.0543
NP_440673.1_3 Reverse -329 -336 12.4288 0.0426
NP_440673.1_3 Forward -101 -94 6.72562 0.277
NP_440673.1_3 Forward -334 -327 5.34899 0.298
NP_440077.1_4 Reverse -2 -21 17.994 0.125
NP_441052.1_2 Forward -336 -326 10.2065 0.0295
NP_441052.1_2 Forward -309 -299 4.10993 0.166
NP_441052.1_2 Forward -303 -293 2.14332 0.216
NP_441052.1_2 Reverse -294 -304 1.94665 0.221
NP_441052.1_2 Reverse -327 -337 1.84832 0.225
NP_442219.1_9 Forward -335 -326 10.2261 0.0547
NP_442219.1_9 Reverse -328 -337 8.25953 0.0681
NP_442219.1_9 Forward -348 -339 2.94966 0.21
NP_440436.1_4 Reverse -328 -337 9.24241 0.0871
NP_440436.1_4 Forward -335 -326 8.06244 0.118
NP_442907.1_7 Reverse -182 -201 16.5191 0.192
NP_441719.1_4 Forward -335 -328 16.3621 0.0124
NP_441719.1_4 Reverse -328 -335 16.3621 0.0124
NP_442813.1_4 Reverse -325 -344 -1.37718 0.239
NP_442813.1_4 Forward -98 -79 -8.06369 0.299
NP_442139.1_7 Reverse -289 -308 10.1275 0.22
NP_440296.1_10 Forward -353 -334 -13.7669 0.269
NP_441115.1_4 Forward -337 -319 11.4247 0.14
NP_442694.1_4 Reverse -378 -387 11.4061 0.277
NP_442206.1_10 Forward -336 -321 13.1562 0.0799
NP_442854.1_6 Forward -315 -296 2.65439 0.272
NP_441851.1_10 Reverse -326 -336 14.238 0.0196
NP_441851.1_10 Forward -337 -327 8.33817 0.118
NP_441396.1_5 Forward -359 -350 7.37455 0.279
NP_440593.1_3 Reverse -335 -354 -4.81876 0.253
NP_440593.1_9 Reverse -303 -317 7.9644 0.267
NP_440593.1_10 Reverse -64 -83 8.06259 0.279
NP_442709.1_4 Reverse -245 -264 8.26883 0.161
NP_441046.1_2 Reverse -83 -102 -1.67217 0.292
NP_441349.1_10 Reverse -317 -336 0.491109 0.0886
NP_441349.1_10 Forward -346 -327 -1.57384 0.105
NP_441409.1_6 Reverse -321 -340 3.24438 0.0501
NP_440432.1_9 Reverse -328 -343 7.25639 0.0427
NP_440474.1_8 Reverse -328 -342 13.7653 0.0695
NP_440431.1_3 Forward -337 -318 -3.54046 0.178
NP_442450.1_5 Forward -338 -328 9.41981 0.115
NP_442168.1_5 Forward -335 -316 -2.26216 0.264
NP_442168.1_6 Forward -100 -81 7.7676 0.23
NP_440588.1_2 Reverse -180 -199 -5.50708 0.252
NP_440588.1_2 Reverse -291 -310 -5.9004 0.264
NP_440588.1_2 Reverse -318 -337 -6.58872 0.285
NP_440943.1_5 Forward -105 -91 10.521 0.292
NP_443047.1_7 Reverse -328 -347 18.4857 0.0485
NP_441570.1_1 Reverse -327 -345 -0.275845 0.0447
NP_441570.1_1 Forward -103 -85 -11.5839 0.198
NP_441570.1_1 Forward -336 -318 -14.8288 0.227
NP_440078.1_10 Forward -336 -317 1.76941 0.297
NP_441078.1_4 Forward -336 -327 9.93116 0.0203
NP_441078.1_4 Reverse -327 -336 9.83282 0.0226
NP_441078.1_4 Reverse -300 -309 -1.6719 0.266
NP_441078.1_4 Forward -309 -300 -1.77023 0.266
NP_442729.1_5 Forward -310 -300 8.4365 0.248
NP_440539.1_9 Reverse -142 -161 -7.27704 0.298
NP_442348.1_2 Reverse -63 -72 13.0777 0.21
NP_442348.1_2 Reverse -377 -386 12.2911 0.218
NP_440707.1_7 Reverse -56 -75 2.85105 0.298
NP_440526.1_3 Forward -335 -324 6.44969 0.201
NP_440526.1_3 Reverse -328 -339 1.82816 0.267
NP_441432.1_8 Forward -337 -328 16.8143 0.00595
NP_441432.1_8 Reverse -93 -102 11.9961 0.0519
NP_441432.1_8 Reverse -326 -335 6.98123 0.112
NP_441432.1_9 Forward -372 -359 8.11358 0.294
NP_442320.1_8 Forward -342 -328 -4.4253 0.168
NP_441732.1_2 Forward -17 -1 -6.7263 0.0495
NP_441732.1_2 Forward -340 -324 -16.6577 0.186
NP_442003.1_4 Forward -335 -316 9.53756 0.3
NP_440199.1_10 Forward -339 -329 14.238 0.0861
NP_440199.1_10 Forward -312 -302 6.56821 0.296
NP_440913.1_1 Reverse -298 -316 13.8838 0.131
NP_440713.1_4 Reverse -84 -103 5.99764 0.198
NP_442489.1_7 Forward -336 -327 10.4228 0.0151
NP_442489.1_7 Reverse -327 -336 10.3245 0.0193
NP_442489.1_7 Reverse -300 -309 -1.47524 0.203
NP_442489.1_7 Forward -13 -4 -1.6719 0.235
NP_442489.1_7 Forward -309 -300 -1.77023 0.247
NP_440757.1_7 Forward -357 -339 1.78911 0.269
NP_442079.1_7 Forward -335 -316 5.80098 0.168
NP_440559.1_1 Forward -335 -326 16.5193 0.00851
NP_440559.1_1 Reverse -328 -337 8.65285 0.0586
NP_441659.2_8 Forward -336 -326 14.828 0.00801
NP_441659.2_8 Reverse -327 -337 11.3864 0.0184
NP_441659.2_8 Forward -309 -299 3.02829 0.177
NP_442913.1_10 Forward -112 -93 -5.99873 0.287
NP_440779.1_5 Reverse -327 -344 -5.86102 0.152
NP_442346.1_5 Forward -337 -327 15.0247 0.00889
NP_442346.1_5 Forward -310 -300 14.6313 0.0115
NP_442346.1_5 Reverse -326 -336 7.25653 0.176
NP_442346.1_5 Reverse -299 -309 4.99491 0.267
NP_440545.1_3 Reverse -323 -340 -0.944468 0.161
NP_441856.1_3 Forward -339 -320 -0.197208 0.216
NP_440486.1_6 Forward -349 -330 7.66927 0.261
NP_440459.1_2 Forward -318 -301 7.41366 0.291
NP_441943.1_8 Forward -397 -378 -6.29373 0.261
NP_442551.1_4 Reverse -155 -170 -2.38005 0.259
NP_440847.1_8 Reverse -58 -77 12.8808 0.273
NP_441833.1_4 Forward -335 -328 15.9687 0.0124
NP_441833.1_4 Reverse -328 -335 15.9687 0.0124
NP_442436.1_6 Reverse -282 -301 13.1758 0.0356
NP_441112.1_6 Forward -346 -327 -2.95047 0.296
NP_442162.1_9 Forward -335 -328 16.2637 0.0124
NP_442162.1_9 Reverse -328 -335 16.2637 0.0124
NP_440671.1_4 Forward -342 -328 5.80112 0.271
NP_440224.1_1 Forward -347 -328 0.982764 0.132
NP_442943.1_1 Forward -262 -247 8.27363 0.194
NP_442140.1_3 Forward -335 -325 13.2547 0.0609
NP_442140.1_3 Forward -308 -298 4.0116 0.265
NP_440875.1_9 Reverse -329 -339 7.59334 0.255
NP_441813.1_5 Forward -338 -328 15.9097 0.01
NP_441813.1_5 Reverse -325 -335 7.84651 0.0573
NP_440590.1_4 Reverse -328 -341 -5.78224 0.289
NP_440567.1_1 Reverse -328 -342 15.8309 0.0166
NP_442497.1_10 Reverse -328 -337 17.601 0.00813
NP_442497.1_10 Forward -335 -326 8.55452 0.0294
NP_440821.1_4 Forward -338 -328 11.0914 0.0146
NP_440821.1_4 Reverse -325 -335 8.82982 0.0395
NP_440227.1_6 Forward -264 -250 16.8182 0.212
NP_441239.1_9 Forward -338 -326 8.00379 0.145
NP_441239.1_9 Reverse -325 -337 3.38223 0.285
NP_441009.1_4 Forward -336 -317 12.9791 0.219
NP_441727.1_3 Reverse -320 -339 2.65439 0.299
NP_441892.1_1 Forward -318 -301 2.98877 0.133
NP_440604.1_6 Reverse -327 -346 -5.80207 0.287
NP_442193.1_1 Forward -369 -351 9.85225 0.233
NP_441017.1_6 Forward -313 -299 15.5352 0.102
NP_440833.1_6 Forward -284 -270 6.88214 0.296
NP_440949.1_7 Forward -323 -304 18.7798 0.108
NP_442041.1_2 Reverse -182 -200 8.96727 0.283
NP_440462.1_6 Forward -338 -328 16.893 0.00853
NP_440868.1_4 Reverse -323 -335 7.11881 0.0756
NP_440868.1_4 Forward -340 -328 6.23383 0.0878
NP_441497.1_3 Reverse -350 -369 -11.5053 0.294
NP_442479.1_5 Reverse -248 -267 9.21106 0.222
NP_441084.1_6 Forward -311 -297 9.53803 0.278
NP_439942.1_2 Reverse -354 -373 14.3465 0.228
NP_440696.1_6 Reverse -295 -314 5.50599 0.275
NP_442023.1_2 Forward -317 -298 5.99764 0.279
NP_442039.1_4 Forward -335 -328 15.1821 0.0124
NP_442039.1_4 Reverse -328 -335 15.1821 0.0124
NP_440825.1_7 Forward -335 -325 16.1302 0.152
NP_442837.1_3 Forward -335 -328 15.7721 0.0124
NP_442837.1_3 Reverse -328 -335 15.7721 0.0124
NP_442053.1_1 Forward -336 -327 9.34117 0.0666
NP_442053.1_1 Reverse -327 -336 8.84951 0.072
NP_440505.1_3 Forward -338 -328 15.123 0.014
NP_440505.1_3 Reverse -61 -71 9.22315 0.122
NP_441203.1_1 Reverse -328 -347 -2.95047 0.0655
NP_441203.1_2 Reverse -206 -225 -3.83545 0.209
NP_442844.1_5 Forward -35 -16 11.995 0.175
NP_440914.1_1 Forward -336 -326 15.3489 0.00527
NP_440914.1_1 Reverse -94 -104 11.3477 0.097
NP_440914.1_1 Reverse -327 -337 7.24882 0.242
NP_440914.1_1 Reverse -100 -110 6.17532 0.293
NP_441011.1_8 Reverse -328 -337 16.6177 0.00602
NP_442533.1_6 Forward -336 -327 7.86621 0.0862
NP_442533.1_6 Reverse -327 -336 7.37455 0.0898
NP_442533.1_6 Reverse -300 -309 6.98123 0.0992
NP_442533.1_6 Forward -309 -300 6.68623 0.105
NP_442533.1_6 Forward -303 -294 2.458 0.255
NP_442541.1_10 Forward -309 -295 4.52221 0.252
NP_440263.1_5 Reverse -384 -398 7.57108 0.294
NP_441482.1_7 Forward -19 -5 -9.34185 0.198
NP_441482.1_7 Forward -342 -328 -10.9151 0.222
NP_439944.1_9 Reverse -328 -338 17.6796 0.00347
NP_439944.1_9 Forward -335 -325 8.23984 0.114
NP_439944.1_9 Forward -108 -98 4.79825 0.296
NP_441697.1_5 Reverse -246 -265 -9.02441 0.268
NP_441527.1_4 Reverse -30 -49 6.92274 0.0961
NP_441527.1_4 Reverse -32 -51 -10.4568 0.27
NP_441527.1_4 Forward -399 -380 -12.2711 0.285
NP_441527.1_5 Forward -338 -319 12.0176 0.297
NP_440007.1_9 Forward -340 -326 18.4858 0.15
NP_441602.1_3 Reverse -295 -314 0.196116 0.219
NP_441106.1_1 Forward -337 -328 18.486 0.0028
NP_440429.1_4 Forward -343 -324 10.4225 0.299
NP_439903.1_6 Forward -112 -93 2.85027 0.219
NP_441286.1_1 Reverse -326 -338 13.117 0.00815
NP_441286.1_1 Reverse -299 -311 -5.36923 0.197
NP_441286.1_1 Forward -337 -325 -5.66422 0.213
NP_442674.1_3 Reverse -298 -317 5.60352 0.264
NP_440670.1_8 Forward -336 -327 16.3227 0.00291
NP_440670.1_8 Reverse -327 -336 15.1427 0.00768
NP_440670.1_8 Forward -13 -4 3.53964 0.257
NP_442881.1_1 Forward -268 -249 12.29 0.198
NP_442908.1_1 Reverse -322 -341 0.884433 0.277
NP_442463.1_3 Reverse -294 -313 15.8307 0.194
NP_440886.1_7 Reverse -3 -13 9.41933 0.0805
NP_440886.1_7 Forward -221 -211 3.8145 0.265
NP_442614.1_2 Forward -336 -322 19.6658 0.0419
NP_442614.1_2 Forward -309 -295 6.09611 0.293
NP_442382.1_9 Forward -379 -360 8.16011 0.286
NP_442072.1_9 Reverse -326 -344 -21.5153 0.209
NP_442401.1_2 Reverse -333 -352 6.78348 0.282
NP_440907.2_8 Reverse -328 -338 9.51767 0.103
NP_440907.2_8 Reverse -341 -351 6.0761 0.179
NP_440907.2_8 Forward -335 -325 5.78111 0.188
NP_442264.1_2 Reverse -296 -313 13.5102 0.144
NP_440326.1_5 Reverse -325 -338 13.9823 0.229
NP_440666.1_3 Forward -227 -208 14.2574 0.107
NP_441463.1_3 Reverse -317 -336 -1.27885 0.138
NP_441626.1_2 Forward -335 -328 15.7721 0.0124
NP_441626.1_2 Reverse -328 -335 15.7721 0.0124
NP_442365.1_7 Reverse -302 -321 -2.26216 0.199
NP_442794.1_1 Reverse -323 -335 10.8554 0.0721
NP_442615.1_1 Forward -345 -327 -2.14413 0.139
NP_442615.1_1 Reverse -318 -336 -3.81576 0.17
NP_441962.1_4 Forward -172 -153 -12.1936 0.253
NP_441836.1_2 Reverse -294 -313 -3.24547 0.236
NP_440114.1_10 Reverse -327 -341 9.63603 0.168
NP_441237.1_9 Forward -335 -325 14.3364 0.0399
NP_442743.1_4 Reverse -328 -347 9.53756 0.0547
NP_442743.1_5 Reverse -328 -347 2.65439 0.293
NP_442867.1_8 Forward -96 -77 6.78429 0.253
NP_440457.1_1 Forward -340 -328 9.67541 0.092
NP_440798.1_6 Reverse -328 -341 3.46087 0.151
NP_441984.1_3 Reverse -296 -314 8.86894 0.218
NP_441332.1_4 Forward -266 -247 7.66927 0.234
NP_442509.1_9 Reverse -340 -350 10.9926 0.15
NP_442582.1_6 Forward -270 -251 20.4416 0.0365
NP_441496.1_1 Reverse -252 -266 14.5264 0.265
NP_442514.1_10 Reverse -294 -313 7.47261 0.258
NP_440185.1_9 Forward -361 -344 19.705 0.0855
NP_440554.1_4 Reverse -328 -338 16.1063 0.0189
NP_442737.1_5 Reverse -299 -318 11.4246 0.289
NP_441885.1_5 Forward -336 -326 11.7798 0.00668
NP_441885.1_5 Reverse -327 -337 1.55333 0.109
NP_442341.1_7 Reverse -3 -17 1.67122 0.282
NP_442341.1_9 Forward -338 -324 10.1271 0.137
NP_442341.1_9 Reverse -325 -339 4.71887 0.294
NP_442395.2_4 Reverse -3 -22 4.03023 0.188
NP_443000.1_7 Forward -338 -328 17.4829 0.00719
NP_443000.1_7 Reverse -325 -335 1.25834 0.26
NP_440507.2_3 Reverse -297 -316 9.93006 0.213
NP_440507.2_3 Forward -22 -3 6.78348 0.299
NP_441842.1_1 Reverse -73 -86 14.08 0.119
NP_441842.1_10 Forward -343 -329 14.8476 0.0511
NP_440275.1_3 Forward -338 -328 9.12481 0.055
NP_440275.1_3 Reverse -325 -335 8.1415 0.0602
NP_440091.1_1 Forward -340 -328 10.8554 0.0429
NP_443060.1_5 Forward -147 -128 8.94676 0.197
NP_442638.1_3 Reverse -242 -261 10.8379 0.298
NP_441122.1_1 Forward -143 -128 6.86307 0.28
NP_441122.1_1 Reverse -178 -193 2.92983 0.29
NP_440175.1_7 Reverse -296 -314 14.6331 0.144
NP_440175.1_7 Reverse -311 -329 13.1692 0.193
NP_441105.1_3 Reverse -295 -314 -0.295539 0.134
NP_441105.1_3 Reverse -289 -308 -0.787193 0.142
NP_441105.1_3 Forward -320 -301 -9.44032 0.289
NP_440216.1_1 Reverse -327 -341 7.27608 0.00942
NP_440216.1_9 Reverse -353 -362 10.4228 0.286
NP_440172.1_1 Forward -336 -326 8.4365 0.0621
NP_440172.1_1 Reverse -327 -337 7.74818 0.0738
NP_440172.1_1 Reverse -94 -104 7.15819 0.0897
NP_442015.1_10 Reverse -323 -336 12.3107 0.0372
NP_441226.1_7 Forward -335 -328 14.4934 0.0123
NP_441226.1_7 Reverse -328 -335 14.4934 0.0123
NP_441111.1_7 Reverse -328 -336 18.7023 0.00294
NP_441111.1_7 Forward -335 -327 8.96754 0.0463
NP_442379.1_10 Forward -343 -326 -3.8944 0.272
NP_440244.1_1 Reverse -203 -222 -7.76869 0.287
NP_440244.1_1 Reverse -204 -223 -8.85033 0.287
NP_441766.1_2 Reverse -327 -336 16.2243 0.0047
NP_441766.1_2 Forward -336 -327 9.14451 0.0337
NP_440416.1_9 Forward -104 -85 -0.787193 0.0621
NP_440416.1_9 Reverse -305 -324 -17.4051 0.239
NP_440072.1_5 Forward -358 -340 -4.20908 0.296
NP_442403.1_9 Reverse -315 -334 8.35759 0.191
NP_442403.1_9 Reverse -294 -313 4.32602 0.24
NP_441019.1_9 Reverse -106 -125 18.3865 0.181
NP_442154.1_1 Forward -174 -156 -16.3038 0.238
NP_440261.1_5 Forward -335 -322 -3.12731 0.115
NP_440261.1_5 Reverse -328 -341 -10.6988 0.203
NP_440988.1_10 Forward -338 -324 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAAAACACCTGGAAAAAAGACCCTTTAATTGGACTATTTTTCGATGCGGGGGGGTTCCCGAAAGGCGATCGCAAAGAAAAGGACCGCAAGGGCCATGGTCAGCACCAGAATGTAAGCAACACTTTCCATAATCTAAAAAATTCCTAAAAGTTTATCCTTACACACTAATCTATACATTCCCCTGTCCCCTGACAACTAGACCGACTTGGCCAAGAACCAAACACTGCGGTGTGGGCACTGCTTCTTTGCTAGTATGGGTTAACGATTAACAATTGATTAAGGGGTCTAGACCCGTTCGTCATTGCCTTCCCTGTCTGGCGGGAATCCACCAATTCCCATAGTCTAAGATTTAGTTTCTGTACCCGTTTTTCTCTACCCTGATCCAGGAAGATTGCCGCC

CDS

ATGTTTCCCCCCTCCAGTGATTTGACTGAGTTGAATGATGGTCAGCCTTTGTCTGGCCACCATGCCGATAAACCAGAAGAAGCATGTGGGGTGTTTGGCATTTACGCCCCTGAAGAAGCGGTGGCCAAATTGACCTATTTTGGACTTTATGCCCTGCAACATCGGGGTCAGGAGTCGGCGGGTATTGCCACTTTTGCCGGGACAACGGTTCACTGCCACAAGGATATGGGGCTAGTGTCCCAGGTTTTTCAAGAATCTAAACTGAATGAAATGGTGGGTACTCTGGCTGTGGGCCACACCCGCTACTCCACCACGGGATCCAGCCATCGGGTCAATGCTCAACCGGCAGTGCTCCCTACCCGTTTGGGTCCCCTGGCCCTGGCCCACAATGGCAATTTGGTTAACACTAACCAGTTGCGAGAAGCTTTAGCGGAAAGGGGCTGTGAGGACTTTGTCACCACCACCGATTCGGAAATGATTGCAGTGGCGATCGCCAATGAGGTGGATAAAGGCAAAGACTGGGTGGAAGGCACCATTGCGGCCCTGACCCTTTGTGCGGGAGCCTATAGCTTAGTGATCGGCACACCGGAGGGAATCATTGGAGTCAGGGATCCCCATGGCATTCGCCCCCTGGTGATCGGTGTGTTAGAAGAAGAAACTCCCCGCTATGTATTGGCATCGGAAACCTGTGCCCTGGACATCATCGGTGCCACCTATGTGCGCACGGTGGAAGCCGGAGAATTGGTCCATATCACCGAATCTGGCCTAGTTTCCCATCGATTAGCCGAAAGCGCTGACCGTAAACTCTGTGTGTTCGAGATGATTTATTTTTCTCGCCCGGATAGCGTGGTTAACGATGAAAGCCTCTACACCTATCGCATGCGCATTGGCAAACATTTAGCCAAAGAATCCCCTGTGGATGCTGATCTCGTGATGGGGGTACCCGATTCCGGTATTCCAGCGGCGATCGGCTTTTCCCAAGCTTCCGGTATTCCCTATGCCGAAGGTTTAATCAAAAATCGTTACGTGGGGCGTACCTTTATCCAACCCACCCAACATATGCGAGAGCACGGCATCCGCATGAAACTCAATCCTCTCAAAGACGTATTGGCCGGTAAACGGATCATTATCGTCGATGACTCTATTGTGCGGGGCACCACTAGTCGCAAAATTGTCCGAGCGTTACGGGAAGCTGGAGCAACAGAGGTACATATGCGGATTTCTTCTCCGCCAGTGACCCATCCTTGCTTCTATGGCATTGATACCGACAGTCAAGATCAACTAATTGCGGCCAGACTGACAGTGGCGGAGATTGCTGAGCAAATTGAAGTGGACTCCCTCGCTTATCTTTCCCAGGAAGGCATGTTGTTGTGCACCGGCGAAGATATTTCCCATTTTTGTTCTGCCTGCTTCAATGGAAGATACCCCATCACTGTGCCAGATGCGGTCAGGCGCTCTAAATTAATGCTGGAGAATATTACTGCTTGA

Protein

MFPPSSDLTELNDGQPLSGHHADKPEEACGVFGIYAPEEAVAKLTYFGLYALQHRGQESAGIATFAGTTVHCHKDMGLVSQVFQESKLNEMVGTLAVGHTRYSTTGSSHRVNAQPAVLPTRLGPLALAHNGNLVNTNQLREALAERGCEDFVTTTDSEMIAVAIANEVDKGKDWVEGTIAALTLCAGAYSLVIGTPEGIIGVRDPHGIRPLVIGVLEEETPRYVLASETCALDIIGATYVRTVEAGELVHITESGLVSHRLAESADRKLCVFEMIYFSRPDSVVNDESLYTYRMRIGKHLAKESPVDADLVMGVPDSGIPAAIGFSQASGIPYAEGLIKNRYVGRTFIQPTQHMREHGIRMKLNPLKDVLAGKRIIIVDDSIVRGTTSRKIVRALREAGATEVHMRISSPPVTHPCFYGIDTDSQDQLIAARLTVAEIAEQIEVDSLAYLSQEGMLLCTGEDISHFCSACFNGRYPITVPDAVRRSKLMLENITA