Your browser is old and dusty. Try Google Chrome!

Details for sll0756

ORF sll0756
Accession NP_442065.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Reverse -153 -160 12.1338 0.295
NP_442173.1_1 Reverse -177 -185 7.8859 0.134
NP_442752.1_4 Reverse -372 -379 5.54565 0.194
NP_442752.1_4 Reverse -121 -128 5.54565 0.194
NP_442752.1_4 Forward -397 -390 5.25066 0.256
NP_443027.1_4 Forward -276 -266 7.35486 0.24
NP_442975.1_10 Forward -134 -120 6.39049 0.178
NP_442975.1_10 Forward -385 -371 5.60385 0.216
NP_440061.1_9 Reverse -386 -400 16.7152 0.0226
NP_440878.1_4 Reverse -50 -68 13.2938 0.266
NP_442062.1_8 Forward -313 -303 6.8632 0.116
NP_440304.1_4 Reverse -302 -312 5.48657 0.206
NP_442242.1_4 Reverse -177 -184 10.7572 0.153
NP_442110.1_7 Reverse -307 -321 0.589577 0.256
NP_441083.1_5 Reverse -388 -398 6.07655 0.092
NP_441083.1_5 Forward -198 -188 -0.216628 0.261
NP_441738.1_2 Forward -196 -189 10.2652 0.101
NP_441558.1_7 Reverse -156 -175 13.5691 0.17
NP_442570.1_3 Forward -315 -296 3.14605 0.174
NP_441163.1_1 Reverse -380 -397 7.90458 0.235
NP_441215.1_1 Reverse -175 -194 7.27595 0.204
NP_440747.1_10 Reverse -186 -198 -11.7607 0.142
NP_440747.1_10 Reverse -144 -156 -12.5474 0.297
NP_441130.1_10 Forward -281 -267 5.50613 0.227
NP_441695.1_4 Reverse -305 -323 18.6037 0.112
NP_440376.1_1 Forward -397 -388 3.34298 0.206
NP_440376.1_1 Reverse -189 -198 3.04799 0.21
NP_440376.1_1 Forward -156 -147 -0.0986038 0.285
NP_442687.1_7 Forward -398 -388 5.68323 0.189
NP_442687.1_7 Reverse -158 -168 4.69992 0.238
NP_442191.1_4 Forward -311 -297 13.1262 0.164
NP_441077.1_6 Forward -115 -99 3.38031 0.271
NP_441013.1_2 Reverse -89 -107 -4.79907 0.299
NP_441013.1_3 Reverse -49 -68 7.7676 0.263
NP_440533.1_6 Reverse -155 -174 12.0942 0.238
NP_440667.1_2 Forward -91 -72 -9.24366 0.299
NP_442658.1_1 Reverse -302 -312 8.14104 0.199
NP_441958.1_5 Forward -398 -388 -1.29827 0.236
NP_440203.1_5 Forward -310 -300 12.1726 0.164
NP_440984.1_7 Reverse -383 -397 6.58777 0.209
NP_440153.1_8 Reverse -387 -400 -3.71729 0.299
NP_440858.1_1 Reverse -270 -289 -3.73712 0.27
NP_443055.1_3 Forward -321 -302 15.9926 0.084
NP_443055.1_6 Forward -138 -120 1.5917 0.227
NP_442002.1_9 Reverse -158 -165 12.2322 0.185
NP_442002.1_9 Reverse -65 -72 12.2322 0.185
NP_442431.1_10 Reverse -238 -256 -0.669169 0.293
NP_440484.1_1 Forward -374 -355 12.1917 0.194
NP_440147.1_4 Forward -251 -238 2.87088 0.202
NP_441175.1_2 Forward -79 -60 7.47261 0.226
NP_441550.1_8 Forward -399 -389 5.97777 0.22
NP_440465.1_10 Forward -400 -381 -0.787193 0.29
NP_441725.1_5 Forward -312 -302 7.15819 0.103
NP_441725.1_5 Reverse -177 -187 -0.806614 0.271
NP_442281.1_1 Forward -190 -176 6.29216 0.13
NP_441556.1_7 Reverse -293 -312 1.57197 0.287
NP_441644.1_6 Reverse -388 -398 4.10949 0.249
NP_443049.1_6 Reverse -317 -327 11.4458 0.257
NP_442215.1_2 Reverse -174 -190 1.14018 0.14
NP_442215.1_2 Forward -315 -299 0.255197 0.154
NP_442215.1_2 Reverse -181 -197 -3.8747 0.223
NP_442029.1_6 Forward -318 -299 5.40766 0.25
NP_440253.1_2 Reverse -121 -139 -3.42244 0.294
NP_442648.1_4 Forward -163 -144 5.70265 0.18
NP_442926.1_3 Reverse -72 -91 2.75272 0.295
NP_442554.1_8 Forward -396 -386 2.43831 0.272
NP_440122.1_2 Reverse -52 -71 2.16274 0.237
NP_443009.1_2 Forward -257 -238 1.67108 0.216
NP_443009.1_5 Reverse -303 -314 7.53132 0.126
NP_440807.1_7 Reverse -142 -161 -1.37718 0.221
NP_442408.2_1 Forward -312 -293 2.94938 0.16
NP_442741.1_7 Reverse -159 -178 12.0942 0.24
NP_440357.1_3 Forward -399 -380 7.57094 0.215
NP_441448.1_1 Forward -102 -83 6.19431 0.251
NP_441198.1_8 Reverse -302 -312 10.9275 0.232
NP_441198.1_8 Forward -399 -389 10.5368 0.265
NP_440379.1_5 Forward -316 -297 -6.98204 0.24
NP_442253.1_5 Forward -400 -383 -6.84433 0.298
NP_442808.1_1 Forward -131 -121 5.38779 0.155
NP_442808.1_1 Forward -328 -318 4.01116 0.212
NP_442113.1_10 Reverse -75 -94 -3.04881 0.214
NP_442050.1_5 Forward -200 -190 9.41933 0.193
NP_441114.1_3 Forward -311 -302 7.57121 0.231
NP_441878.1_6 Forward -398 -388 -0.216628 0.169
NP_441878.1_6 Reverse -303 -313 -7.59145 0.245
NP_441036.1_6 Forward -400 -382 7.98396 0.292
NP_441433.1_8 Forward -312 -293 -0.295539 0.244
NP_441433.1_8 Reverse -147 -166 -2.55715 0.27
NP_441433.1_8 Reverse -227 -246 -2.75381 0.27
NP_440738.1_5 Forward -71 -52 17.699 0.0524
NP_441381.1_6 Reverse -373 -392 10.6192 0.231
NP_442830.1_5 Forward -314 -300 5.99717 0.22
NP_442397.1_9 Forward -319 -300 2.55606 0.273
NP_442347.1_2 Forward -129 -120 8.06287 0.116
NP_442594.1_8 Reverse -238 -257 9.14423 0.199
NP_441633.1_3 Forward -187 -174 -5.19226 0.229
NP_440136.1_2 Reverse -177 -184 3.97235 0.288
NP_440899.1_1 Reverse -325 -344 7.7243 0.254
NP_440256.1_1 Reverse -186 -205 -9.047 0.273
NP_441229.1_3 Reverse -231 -243 18.3285 0.248
NP_441559.1_8 Forward -317 -303 3.8345 0.141
NP_442785.1_9 Forward -175 -156 16.1249 0.261
NP_442866.1_1 Forward -318 -299 -2.0655 0.207
NP_441464.1_8 Forward -185 -171 8.75105 0.194
NP_442993.1_1 Reverse -189 -205 -11.1512 0.235
NP_442386.1_9 Forward -280 -271 11.9957 0.0754
NP_442386.1_9 Forward -346 -337 6.48915 0.219
NP_442386.1_9 Reverse -387 -396 5.21086 0.262
NP_440570.1_5 Forward -101 -82 -3.44213 0.289
NP_442714.1_7 Forward -258 -239 -1.86883 0.292
NP_441160.1_5 Reverse -239 -258 1.57275 0.288
NP_442251.1_6 Reverse -177 -184 9.67555 0.174
NP_440027.1_3 Forward -133 -115 2.37835 0.29
NP_439937.1_9 Forward -186 -169 -6.94332 0.157
NP_439937.1_9 Forward -233 -216 -14.9081 0.287
NP_439943.1_1 Reverse -337 -356 -6.09707 0.237
NP_439943.1_4 Forward -167 -148 14.4541 0.133
NP_440819.1_5 Forward -117 -109 6.41093 0.285
NP_440316.1_10 Forward -92 -82 10.8948 0.218
NP_441803.1_2 Reverse -271 -290 4.12936 0.181
NP_439977.1_5 Reverse -140 -159 -2.16383 0.272
NP_442384.1_10 Forward -130 -117 0.904263 0.275
NP_442262.1_10 Reverse -177 -184 8.8889 0.219
NP_440344.1_10 Forward -137 -120 -12.9408 0.269
NP_442123.1_10 Reverse -108 -127 4.03102 0.288
NP_441060.1_4 Forward -362 -344 2.57575 0.252
NP_441965.1_10 Forward -400 -384 5.76173 0.197
NP_442065.1_1 Forward -213 -194 27.0405 0.00143
NP_442065.1_2 Forward -385 -372 15.26 0.293
NP_442065.1_5 Forward -239 -220 29.7937 0.000161
NP_442065.1_7 Forward -132 -114 24.6019 0.00629
NP_442556.1_10 Forward -237 -218 10.1677 0.273
NP_440297.1_9 Forward -312 -302 7.05986 0.15
NP_440297.1_9 Reverse -147 -157 4.10993 0.245
NP_442280.1_10 Forward -78 -60 7.79204 0.268
NP_442280.1_10 Forward -316 -298 4.96742 0.291
NP_441896.1_3 Reverse -313 -332 -2.45882 0.284
NP_442277.1_2 Forward -242 -228 10.3243 0.287
NP_441469.1_8 Reverse -303 -312 9.4395 0.227
NP_442315.1_5 Forward -282 -272 17.3846 0.277
NP_440998.1_3 Forward -324 -305 8.35759 0.133
NP_441462.1_2 Reverse -189 -199 -0.41329 0.225
NP_441462.1_5 Reverse -252 -271 0.687771 0.296
NP_442204.1_1 Forward -160 -149 1.63197 0.267
NP_442204.1_6 Reverse -108 -127 6.39097 0.255
NP_440783.1_3 Forward -258 -239 2.26107 0.266
NP_441443.1_2 Reverse -74 -93 -2.36049 0.26
NP_441443.1_10 Forward -311 -293 8.57317 0.193
NP_440648.1_1 Reverse -82 -101 3.44104 0.249
NP_441086.1_6 Forward -344 -334 17.2858 0.141
NP_442366.1_3 Reverse -188 -206 -1.65248 0.216
NP_442366.1_5 Reverse -118 -128 11.6809 0.168
NP_442694.1_4 Reverse -52 -61 13.3727 0.225
NP_443054.1_2 Reverse -302 -316 2.75286 0.241
NP_441851.1_10 Reverse -303 -313 5.5849 0.207
NP_441851.1_10 Reverse -175 -185 4.79825 0.247
NP_441668.1_4 Reverse -378 -397 3.04771 0.188
NP_441668.1_4 Forward -170 -151 -1.57384 0.277
NP_442515.1_1 Forward -397 -383 -1.77037 0.263
NP_441046.1_2 Reverse -239 -258 5.80098 0.221
NP_441349.1_10 Reverse -179 -198 -9.047 0.281
NP_440432.1_9 Forward -248 -233 3.91314 0.0797
NP_442843.1_1 Reverse -232 -251 -8.85033 0.264
NP_440943.1_4 Reverse -151 -163 17.3452 0.0959
NP_442006.1_2 Reverse -231 -248 -9.49926 0.197
NP_441570.1_1 Reverse -100 -118 -11.4856 0.197
NP_441078.1_4 Reverse -388 -397 5.01461 0.122
NP_442348.1_2 Reverse -51 -60 13.2744 0.198
NP_441432.1_8 Forward -199 -190 5.21127 0.185
NP_441432.1_8 Forward -313 -304 2.65466 0.292
NP_440313.1_5 Reverse -295 -313 10.9331 0.294
NP_442489.1_7 Reverse -388 -397 -1.57357 0.213
NP_442489.1_7 Reverse -189 -198 -1.57357 0.213
NP_441659.2_8 Forward -259 -249 0.275027 0.27
NP_442913.1_10 Forward -268 -249 -5.70374 0.276
NP_439956.1_7 Reverse -307 -326 2.55606 0.273
NP_440779.1_5 Forward -249 -232 -14.1208 0.243
NP_442346.1_2 Forward -186 -167 4.81767 0.289
NP_442346.1_5 Forward -260 -250 6.07655 0.216
NP_442346.1_5 Reverse -303 -313 4.3066 0.291
NP_440352.1_5 Reverse -178 -197 10.0276 0.287
NP_440459.1_2 Forward -243 -226 8.69197 0.253
NP_442027.1_1 Reverse -42 -60 13.4416 0.246
NP_442551.1_4 Forward -399 -384 -0.511758 0.245
NP_441585.1_5 Forward -177 -158 -0.0996487 0.291
NP_441888.1_9 Reverse -336 -355 14.3605 0.278
NP_441948.1_4 Reverse -297 -315 -3.32411 0.19
NP_440751.1_3 Reverse -73 -92 10.1267 0.264
NP_440671.1_4 Reverse -183 -197 8.55439 0.195
NP_440017.1_4 Forward -153 -135 23.9136 0.0146
NP_442073.1_2 Reverse -224 -243 17.7282 0.291
NP_441671.1_10 Reverse -297 -316 -0.197208 0.29
NP_441813.1_7 Forward -259 -245 21.5334 0.0477
NP_440594.1_8 Forward -184 -171 9.36014 0.186
NP_440821.1_4 Reverse -174 -184 -0.41329 0.257
NP_441239.1_9 Forward -315 -303 5.74217 0.21
NP_441727.1_3 Reverse -380 -399 6.09597 0.246
NP_442044.1_1 Forward -161 -142 -14.4552 0.291
NP_442193.1_1 Reverse -159 -177 7.09898 0.298
NP_440900.1_4 Forward -306 -287 15.944 0.271
NP_440868.1_4 Forward -331 -319 0.727295 0.201
NP_442039.1_4 Reverse -177 -184 10.5605 0.121
NP_442039.1_7 Forward -89 -79 6.76487 0.299
NP_441926.1_3 Reverse -189 -205 3.50012 0.219
NP_440825.1_7 Reverse -177 -187 11.0554 0.278
NP_440505.1_3 Reverse -370 -380 4.50326 0.284
NP_441701.1_3 Reverse -369 -386 5.9387 0.295
NP_442844.1_5 Reverse -4 -23 0.883656 0.297
NP_442533.1_6 Reverse -388 -397 12.5861 0.0277
NP_442533.1_6 Reverse -304 -313 4.91628 0.165
NP_441028.1_6 Forward -379 -369 3.51951 0.292
NP_442492.1_2 Reverse -250 -269 0.884433 0.24
NP_441869.1_2 Reverse -110 -129 8.16093 0.295
NP_001035870.1_3 Forward -172 -153 2.3594 0.163
NP_441286.1_1 Reverse -387 -399 -5.17256 0.192
NP_440670.1_8 Reverse -189 -198 5.40793 0.158
NP_441930.1_2 Forward -313 -303 12.5664 0.258
NP_442072.1_1 Forward -255 -237 2.37909 0.299
NP_442213.1_5 Reverse -380 -399 -1.67217 0.293
NP_440907.2_8 Reverse -389 -399 6.96107 0.138
NP_440176.1_3 Reverse -140 -154 23.3033 0.0186
NP_441901.1_1 Forward -201 -182 3.34271 0.218
NP_442365.1_5 Forward -184 -165 11.3075 0.166
NP_440114.1_10 Reverse -190 -204 6.48943 0.269
NP_441858.1_2 Reverse -65 -84 9.35557 0.293
NP_442323.1_7 Reverse -298 -317 5.01354 0.21
NP_441510.2_7 Reverse -183 -197 11.1104 0.28
NP_441237.1_9 Forward -396 -386 11.0914 0.2
NP_442743.1_1 Reverse -210 -229 8.84842 0.263
NP_442930.1_1 Reverse -30 -40 10.501 0.276
NP_442867.1_8 Reverse -311 -330 4.22769 0.287
NP_440054.1_4 Forward -360 -341 14.6508 0.135
NP_442509.1_9 Forward -130 -120 11.5826 0.124
NP_443037.1_7 Reverse -331 -350 -3.93378 0.276
NP_442514.1_5 Forward -76 -57 -4.42619 0.241
NP_441885.1_5 Forward -397 -387 -0.314959 0.195
NP_442341.1_7 Forward -398 -384 6.3911 0.127
NP_441842.1_10 Reverse -233 -247 7.9644 0.238
NP_442451.1_2 Forward -257 -238 -5.99873 0.228
NP_442451.1_2 Forward -193 -174 -10.817 0.28
NP_441105.1_3 Forward -167 -148 -8.06369 0.265
NP_441226.1_7 Forward -54 -47 5.64364 0.286
NP_442154.1_1 Reverse -242 -260 -15.8121 0.225
NP_442226.1_8 Reverse -55 -65 17.3846 0.164
NP_440261.1_7 Forward -242 -223 1.27776 0.19
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGGGGCATCGGCAACATTAACTATCCCCTAGTGTCAGATCTCAAAAAAGAAATTAGCCAAGCCTATAATGTCCTCGAACCCGATGCAGGCATTGCCCTGCGGGGACTATTCATTATTGACCGGGAAGGCATCTTACAATACGCCACCGTCAACAATCTCTCCTTTGGCCGGAGTGTGGACGAAACTCTGAGGGTACTAAAAGCCATTCGCCATGTGCAATCTCACCCCAACGAAGTTTGCCCAGTGGATTGGCAGGAAGGAGACAAAACCATGATCCCCGACCCGGAAAAGGCTAAGACCTACTTCGAGACAGTGGCGGAACCTTAGGTTTGCCCAGCCAAAAATGCCGACCCTAAATGGATAATTTTGACTACTAGGCTGACTGGTGAGAGATAAGTC

CDS

GTGGGTGAGCTAGCCGTTTTGCCAACATCACTAAGTGTTGCCTATATCCGCCAATATTCACTAATTTTCAGACCAACTCTTCTGATGATTAATTACCCTTTCCCCTGGCTAACTTCGATGTCTCCCCTAACTAGGCCCCTAACCCTGGCCATGGCCGGCATTGCTCTGTCACTGGGTCTGGCCACTCCTGGCCACGGCGAAACCTGTGTGCCCATCCCTTTGGTGGGAGGTCAAGGTAATAGTGTGACTAAAACCGTCGCTGTTCCGACTATTCCCGCAGGGCCTCTAGGCATGTTGGGAATTAACATAACTCGTAATAATTGGAATACCGATTGGGCCGTACCAGGGGGAACAGTTTTTAAAAAATTCGTGATGACGGTAACCTCTGCCGAATCTACCCCCTTTGATATTCGAATGTTTTTAAAATATAGCGACCAGACTGCGTCAGAAATTTTTAATCAACAAGCTTTTGTCTTTAAACCTAATACTCCCTTGGAAATTGTCGGTAATGCTACCCCAGAAGAACAACCCTATCAGGTAAATCTTTTTGTTAACGGGCTAGACTCATTGGGCAAAACTTACACGGCCACCCTAGTGGGTTGTCGCTAA

Protein

MGELAVLPTSLSVAYIRQYSLIFRPTLLMINYPFPWLTSMSPLTRPLTLAMAGIALSLGLATPGHGETCVPIPLVGGQGNSVTKTVAVPTIPAGPLGMLGINITRNNWNTDWAVPGGTVFKKFVMTVTSAESTPFDIRMFLKYSDQTASEIFNQQAFVFKPNTPLEIVGNATPEEQPYQVNLFVNGLDSLGKTYTATLVGCR