Your browser is old and dusty. Try Google Chrome!

Details for sll0755

ORF sll0755
Accession NP_442066.2
Symbol tpx, ycf42
Category Detoxification
Definition thioredoxin peroxidase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -68 -82 15.4376 0.104
NP_441061.1_2 Forward -76 -62 3.93283 0.158
NP_441061.1_2 Reverse -329 -343 1.96621 0.179
NP_441061.1_2 Forward -241 -227 -0.688726 0.237
NP_440557.1_1 Reverse -69 -88 -0.4922 0.27
NP_440795.1_7 Forward -76 -69 14.6904 0.0123
NP_440795.1_7 Reverse -69 -76 14.6904 0.0123
NP_441418.1_6 Forward -77 -58 -21.3384 0.147
NP_442291.1_5 Reverse -67 -83 -1.21977 0.192
NP_441453.1_1 Reverse -61 -79 7.68819 0.211
NP_441453.1_4 Reverse -68 -76 16.539 0.00633
NP_441453.1_4 Forward -77 -69 16.539 0.00633
NP_442151.1_6 Forward -77 -63 20.1574 0.0045
NP_442151.1_6 Reverse -68 -82 10.4227 0.123
NP_440561.1_6 Reverse -63 -82 15.7324 0.284
NP_441818.1_1 Forward -76 -65 16.0861 0.0221
NP_440226.1_1 Forward -77 -58 11.5042 0.0529
NP_442655.1_1 Reverse -63 -82 -0.590531 0.252
NP_442655.1_10 Forward -80 -61 -11.0136 0.23
NP_442173.1_1 Forward -76 -68 15.4574 0.00633
NP_442173.1_1 Reverse -69 -77 15.4574 0.00633
NP_442752.1_4 Forward -77 -70 13.8055 0.0199
NP_442752.1_4 Reverse -68 -75 13.8055 0.0199
NP_442752.1_4 Reverse -246 -253 9.47889 0.109
NP_443027.1_4 Forward -79 -69 13.2547 0.0521
NP_443027.1_4 Reverse -66 -76 13.1564 0.0521
NP_442975.1_10 Reverse -64 -78 12.487 0.0477
NP_442975.1_10 Forward -81 -67 4.22722 0.245
NP_441225.1_4 Reverse -324 -343 -1.7705 0.237
NP_440784.1_7 Forward -76 -69 15.9687 0.0123
NP_440784.1_7 Reverse -69 -76 15.9687 0.0123
NP_440061.1_9 Forward -79 -65 11.9953 0.103
NP_440061.1_9 Forward -164 -150 9.34041 0.148
NP_440061.1_9 Reverse -29 -43 7.96378 0.185
NP_440110.1_4 Forward -253 -234 5.01433 0.176
NP_441054.1_2 Reverse -222 -241 16.4207 0.132
NP_440878.1_9 Reverse -58 -77 4.71934 0.174
NP_442062.1_8 Forward -77 -67 17.3846 0.00193
NP_442062.1_8 Reverse -68 -78 10.3048 0.0493
NP_442062.1_8 Reverse -153 -163 3.32329 0.275
NP_440761.1_4 Reverse -63 -82 5.60432 0.0718
NP_440761.1_4 Reverse -228 -247 -12.7836 0.257
NP_441859.1_3 Forward -78 -59 13.3716 0.0819
NP_440304.1_4 Forward -79 -69 10.8948 0.051
NP_440304.1_4 Reverse -66 -76 9.91146 0.051
NP_442242.1_4 Forward -76 -69 14.3954 0.0124
NP_442242.1_4 Reverse -69 -76 14.3954 0.0124
NP_440044.1_8 Reverse -163 -182 1.96607 0.161
NP_439918.1_2 Reverse -233 -252 3.83436 0.178
NP_439918.1_2 Reverse -227 -246 -2.26216 0.242
NP_440893.1_6 Reverse -70 -89 15.8299 0.223
NP_441208.1_9 Reverse -65 -79 13.6676 0.103
NP_441208.1_9 Reverse -230 -244 6.29277 0.252
NP_441208.1_9 Reverse -277 -291 5.70279 0.262
NP_442110.1_7 Reverse -68 -82 12.3893 0.0586
NP_442110.1_7 Forward -77 -63 8.65272 0.0851
NP_440856.1_4 Forward -84 -65 1.57275 0.157
NP_440856.1_7 Reverse -212 -231 -1.37718 0.182
NP_440856.1_7 Forward -338 -319 -8.55534 0.274
NP_441083.1_5 Forward -77 -67 20.3345 0.00053
NP_441083.1_5 Reverse -68 -78 11.2881 0.0159
NP_441083.1_5 Forward -162 -152 -0.904945 0.283
NP_442827.1_8 Reverse -60 -79 -1.67294 0.253
NP_441738.1_2 Forward -75 -68 15.28 0.0102
NP_441738.1_2 Reverse -70 -77 15.28 0.0102
NP_441558.1_5 Forward -79 -60 10.5209 0.0968
NP_440209.1_1 Reverse -68 -76 18.1123 0.00295
NP_440209.1_1 Forward -77 -69 18.1123 0.00295
NP_442889.1_8 Reverse -256 -270 6.39049 0.192
NP_440447.1_6 Reverse -60 -78 0.609134 0.284
NP_441713.1_1 Reverse -62 -81 2.0644 0.0651
NP_441989.1_5 Reverse -187 -206 17.1491 0.243
NP_442570.1_3 Forward -131 -112 -2.36049 0.212
NP_442570.1_3 Reverse -230 -249 -6.29373 0.257
NP_441716.1_1 Forward -77 -63 13.0776 0.0689
NP_442111.1_4 Reverse -67 -81 22.6157 0.000842
NP_442111.1_4 Forward -78 -64 2.2612 0.283
NP_440906.1_5 Forward -76 -69 15.8704 0.0124
NP_440906.1_5 Reverse -69 -76 15.8704 0.0124
NP_440012.1_6 Forward -331 -312 6.19431 0.299
NP_440747.1_10 Forward -80 -68 17.1486 0.000663
NP_440747.1_10 Reverse -65 -77 7.51213 0.00286
NP_440747.1_10 Reverse -150 -162 -11.9574 0.178
NP_440747.1_10 Reverse -280 -292 -12.1541 0.227
NP_441130.1_10 Forward -79 -65 8.06273 0.141
NP_441130.1_10 Reverse -66 -80 6.98109 0.173
NP_441130.1_10 Reverse -160 -174 5.1128 0.247
NP_441854.1_10 Reverse -66 -85 1.67108 0.282
NP_442973.1_5 Forward -86 -67 10.7175 0.27
NP_441486.1_1 Reverse -65 -79 -2.36035 0.175
NP_442634.1_4 Reverse -66 -80 6.58777 0.0489
NP_442634.1_4 Forward -79 -65 5.80112 0.051
NP_441265.1_3 Reverse -62 -76 3.14618 0.181
NP_440470.1_5 Forward -275 -256 13.0342 0.16
NP_441014.1_8 Reverse -324 -343 -9.83364 0.299
NP_441014.1_8 Reverse -180 -199 -9.83364 0.299
NP_442848.1_1 Reverse -62 -76 6.29277 0.0791
NP_441012.1_4 Reverse -28 -41 9.45906 0.272
NP_441012.1_4 Reverse -39 -52 5.91914 0.286
NP_443018.1_3 Forward -76 -69 14.8871 0.0123
NP_443018.1_3 Reverse -69 -76 14.8871 0.0123
NP_441316.1_7 Reverse -66 -81 -3.85501 0.296
NP_441634.1_8 Forward -79 -65 5.40779 0.114
NP_440376.1_1 Forward -77 -68 19.4693 0.000692
NP_440376.1_1 Reverse -68 -77 19.4693 0.000692
NP_440376.1_1 Reverse -153 -162 5.80125 0.119
NP_440376.1_1 Forward -332 -323 -0.786921 0.293
NP_441857.1_5 Reverse -61 -79 14.8671 0.123
NP_441588.1_4 Forward -75 -65 8.63316 0.14
NP_442730.1_8 Forward -251 -232 4.71854 0.273
NP_442687.1_7 Forward -78 -68 9.02648 0.0994
NP_442687.1_7 Reverse -67 -77 8.92815 0.0994
NP_442485.1_3 Forward -337 -318 -1.86883 0.261
NP_442485.1_3 Forward -194 -175 -5.60541 0.293
NP_440667.1_2 Reverse -227 -246 -8.45701 0.289
NP_440360.1_10 Forward -240 -226 4.42448 0.227
NP_442658.1_1 Forward -79 -69 14.2375 0.0237
NP_442658.1_1 Reverse -66 -76 9.616 0.147
NP_442658.1_1 Forward -333 -323 6.96107 0.214
NP_442658.1_1 Forward -164 -154 6.27276 0.234
NP_442782.1_2 Reverse -68 -82 8.16106 0.198
NP_442782.1_2 Reverse -227 -241 0.196253 0.293
NP_442205.1_9 Reverse -227 -243 -1.51476 0.264
NP_442544.1_6 Forward -84 -65 -9.24366 0.298
NP_441414.1_9 Reverse -68 -87 -6.49039 0.196
NP_442937.1_5 Reverse -10 -29 9.53756 0.187
NP_442937.1_5 Reverse -63 -82 7.86593 0.241
NP_441958.1_5 Forward -78 -68 21.2195 0.000805
NP_441958.1_5 Reverse -67 -77 12.2714 0.00183
NP_441127.1_5 Reverse -354 -373 14.1533 0.274
NP_441754.1_1 Forward -271 -252 29.2038 0.000788
NP_441754.1_2 Forward -292 -273 31.1704 0.0000749
NP_441754.1_3 Forward -325 -306 30.5804 0.000279
NP_441754.1_5 Forward -352 -333 22.3206 0.0318
NP_441754.1_7 Forward -187 -168 29.9904 0.00000279
NP_441754.1_8 Forward -133 -114 23.0089 0.0555
NP_441754.1_9 Forward -376 -357 21.7306 0.13
NP_439905.1_1 Forward -241 -228 8.9674 0.227
NP_440984.1_7 Forward -82 -68 10.0294 0.126
NP_441097.1_2 Reverse -223 -240 4.3654 0.28
NP_439990.1_5 Reverse -63 -76 21.2588 0.00296
NP_439990.1_5 Forward -82 -69 10.639 0.128
NP_442376.1_2 Reverse -63 -82 -12.5869 0.286
NP_442690.1_1 Forward -275 -256 -11.2103 0.225
NP_442911.1_2 Reverse -58 -77 5.30933 0.0341
NP_442911.1_2 Forward -87 -68 3.93269 0.0406
NP_440153.1_5 Reverse -69 -83 13.8643 0.0551
NP_441941.1_9 Reverse -222 -241 8.25926 0.219
NP_443055.1_6 Forward -91 -73 0.608397 0.241
NP_442236.1_1 Reverse -316 -335 2.85105 0.227
NP_440993.1_2 Forward -82 -66 13.4315 0.0656
NP_440993.1_2 Forward -247 -231 3.89344 0.256
NP_440993.1_3 Forward -87 -68 17.1082 0.0527
NP_440993.1_3 Reverse -58 -77 5.99684 0.148
NP_441348.1_3 Reverse -63 -82 6.98095 0.268
NP_441099.1_5 Reverse -58 -77 -2.85214 0.127
NP_441099.1_5 Reverse -301 -320 -3.3438 0.133
NP_440809.1_9 Reverse -97 -115 -5.48739 0.225
NP_440475.1_1 Reverse -59 -78 17.2956 0.0906
NP_441294.1_7 Reverse -64 -78 11.3624 0.147
NP_441646.1_1 Forward -84 -65 4.12936 0.199
NP_442438.1_10 Reverse -63 -77 7.47274 0.0933
NP_442438.1_10 Forward -82 -68 1.76955 0.188
NP_442885.1_5 Reverse -313 -332 13.8633 0.276
NP_440605.1_5 Reverse -231 -249 12.6055 0.183
NP_440147.1_4 Forward -79 -66 19.6855 0.00258
NP_440147.1_4 Reverse -66 -79 9.16406 0.0428
NP_441550.1_8 Reverse -66 -76 16.7941 0.00906
NP_441550.1_8 Forward -79 -69 15.8108 0.0132
NP_441916.1_7 Reverse -68 -78 18.9579 0.00144
NP_441916.1_7 Forward -77 -67 10.3048 0.0261
NP_441041.1_4 Reverse -221 -240 6.4893 0.0427
NP_441041.1_4 Reverse -334 -353 -11.8986 0.254
NP_441041.1_4 Reverse -227 -246 -12.4886 0.266
NP_441041.1_7 Forward -80 -68 13.3454 0.0485
NP_441041.1_7 Reverse -65 -77 12.4708 0.0611
NP_442396.1_5 Forward -166 -153 14.3756 0.0888
NP_442996.1_1 Reverse -256 -275 5.58586 0.246
NP_440703.1_9 Forward -242 -229 5.72191 0.291
NP_441725.1_4 Forward -82 -68 13.7653 0.0693
NP_441725.1_5 Forward -76 -66 9.02648 0.0553
NP_441725.1_5 Reverse -69 -79 1.94665 0.115
NP_439966.1_7 Reverse -66 -76 14.8275 0.0177
NP_439966.1_7 Forward -79 -69 14.3359 0.0203
NP_439966.1_7 Forward -210 -200 10.9926 0.0766
NP_439966.1_9 Reverse -66 -75 0.884706 0.253
NP_442941.1_3 Reverse -69 -79 19.2529 0.00262
NP_442941.1_3 Forward -76 -66 10.9931 0.0116
NP_440289.1_2 Reverse -65 -78 4.8375 0.0644
NP_440289.1_2 Forward -80 -67 3.16588 0.0811
NP_441514.1_6 Reverse -30 -37 12.7238 0.29
NP_442281.1_1 Forward -82 -68 16.5185 0.00772
NP_442281.1_1 Reverse -63 -77 6.78381 0.115
NP_441334.1_7 Reverse -66 -85 -19.9617 0.275
NP_441566.1_4 Forward -133 -114 6.39097 0.178
NP_442256.1_2 Reverse -66 -84 -1.94747 0.188
NP_440437.1_1 Forward -83 -64 11.6025 0.0397
NP_442982.1_5 Forward -87 -68 8.16093 0.12
NP_441644.1_6 Reverse -68 -78 19.0557 0.000803
NP_441644.1_6 Forward -77 -67 17.3841 0.00127
NP_441644.1_6 Reverse -334 -344 5.87944 0.174
NP_442215.1_2 Reverse -66 -82 6.15506 0.0738
NP_442215.1_2 Forward -43 -27 -0.236458 0.164
NP_442029.1_6 Reverse -63 -82 4.42435 0.268
NP_440253.1_2 Forward -77 -59 9.95058 0.0437
NP_440929.1_8 Forward -77 -68 19.2726 0.000701
NP_440929.1_8 Reverse -68 -77 19.2726 0.000701
NP_440929.1_8 Forward -162 -153 5.40793 0.138
NP_440566.1_2 Reverse -189 -208 6.19431 0.265
NP_442933.1_10 Forward -77 -68 17.601 0.00325
NP_442933.1_10 Reverse -68 -77 17.601 0.00325
NP_441751.2_8 Reverse -69 -83 7.57108 0.0339
NP_441751.2_8 Forward -76 -62 2.75286 0.0759
NP_441751.2_8 Reverse -107 -121 -6.49025 0.269
NP_442926.1_3 Reverse -222 -241 5.50599 0.226
NP_442554.1_8 Forward -76 -66 18.0729 0.00543
NP_442554.1_8 Reverse -69 -79 17.2863 0.00543
NP_441762.1_7 Forward -78 -66 2.79224 0.0676
NP_441762.1_7 Reverse -220 -232 -6.2542 0.284
NP_441762.1_7 Reverse -67 -79 -6.84419 0.284
NP_442142.1_4 Forward -233 -220 16.3416 0.0264
NP_442142.1_4 Forward -80 -67 12.9 0.0406
NP_442142.1_4 Reverse -65 -78 12.8017 0.0409
NP_442292.1_1 Forward -76 -67 18.486 0.00229
NP_442292.1_1 Reverse -69 -78 17.5026 0.00435
NP_442292.1_5 Reverse -64 -83 1.17943 0.257
NP_442292.1_5 Forward -306 -287 -1.47551 0.265
NP_441523.1_6 Forward -81 -62 7.86593 0.19
NP_443009.1_5 Reverse -67 -78 14.5128 0.02
NP_443009.1_5 Forward -78 -67 10.1862 0.0792
NP_442092.1_6 Forward -294 -275 14.3549 0.195
NP_440947.1_9 Forward -133 -114 8.35759 0.285
NP_441715.1_4 Reverse -69 -79 16.7946 0.0106
NP_441715.1_4 Forward -76 -66 7.84651 0.107
NP_441448.1_1 Reverse -222 -241 11.8975 0.178
NP_441468.1_1 Forward -76 -69 15.8704 0.0124
NP_441468.1_1 Reverse -69 -76 15.8704 0.0124
NP_441015.1_8 Reverse -25 -44 4.71934 0.258
NP_441015.1_10 Forward -192 -173 -0.295539 0.169
NP_441015.1_10 Reverse -63 -82 -0.885524 0.169
NP_441015.1_10 Reverse -228 -247 -1.96717 0.176
NP_441673.1_1 Forward -77 -68 20.8459 0.000698
NP_441673.1_1 Reverse -68 -77 20.8459 0.000698
NP_441673.1_1 Reverse -153 -162 -7.86675 0.187
NP_441673.1_1 Forward -162 -153 -7.96508 0.206
NP_441731.1_3 Forward -85 -66 -5.50708 0.284
NP_441826.1_2 Forward -83 -69 7.66941 0.085
NP_441826.1_2 Reverse -62 -76 6.29277 0.0944
NP_441826.1_5 Reverse -76 -95 5.89931 0.23
NP_441330.1_1 Forward -82 -63 -12.2919 0.183
NP_441764.1_8 Forward -351 -341 11.3107 0.284
NP_442868.1_6 Reverse -66 -76 17.4829 0.012
NP_442868.1_6 Forward -79 -69 10.4031 0.038
NP_442677.1_5 Forward -77 -58 14.2574 0.251
NP_441612.1_2 Forward -77 -67 8.54929 0.21
NP_441612.1_2 Reverse -31 -41 7.96841 0.239
NP_442427.1_8 Reverse -85 -104 9.14423 0.189
NP_442808.1_1 Forward -78 -68 8.73102 0.0481
NP_442808.1_1 Reverse -67 -77 8.63269 0.0481
NP_442808.1_1 Forward -163 -153 5.09279 0.173
NP_440145.1_3 Reverse -58 -77 -2.65548 0.176
NP_442050.1_5 Forward -79 -69 15.9091 0.0091
NP_442050.1_5 Reverse -66 -76 15.6142 0.01
NP_440038.1_4 Forward -85 -66 1.37609 0.275
NP_440558.1_2 Forward -245 -226 1.67108 0.177
NP_440558.1_2 Forward -86 -67 0.196116 0.194
NP_440558.1_2 Reverse -313 -332 -0.39387 0.203
NP_440558.1_2 Reverse -319 -338 -5.11376 0.253
NP_441878.1_6 Forward -78 -68 10.5014 0.0176
NP_441878.1_6 Reverse -67 -77 10.4031 0.0176
NP_441878.1_6 Forward -332 -322 -7.78811 0.266
NP_441036.1_8 Forward -78 -68 15.713 0.00724
NP_441036.1_8 Reverse -198 -208 11.6814 0.111
NP_441036.1_8 Reverse -67 -77 8.33817 0.174
NP_441036.1_8 Reverse -122 -132 7.55152 0.195
NP_441557.1_5 Forward -77 -68 19.9609 0.000699
NP_441557.1_5 Reverse -68 -77 19.9609 0.000699
NP_441557.1_8 Forward -87 -77 14.6309 0.183
NP_441445.1_1 Reverse -59 -78 -0.0988766 0.286
NP_442066.2_2 Forward -321 -302 18.9773 0.228
NP_442066.2_4 Reverse -68 -87 -7.96535 0.293
NP_442066.2_9 Forward -296 -283 16.1456 0.0575
NP_442066.2_9 Reverse -90 -103 12.0157 0.154
NP_442066.2_9 Reverse -64 -77 8.08242 0.193
NP_442183.1_1 Forward -77 -63 8.55439 0.113
NP_442135.1_3 Forward -89 -70 6.58763 0.26
NP_442135.1_9 Reverse -170 -189 16.8132 0.136
NP_441574.1_1 Forward -180 -161 -4.81876 0.254
NP_441574.1_1 Reverse -227 -246 -5.01543 0.259
NP_441549.1_9 Reverse -64 -82 -6.1757 0.198
NP_440861.1_3 Reverse -216 -234 13.9821 0.186
NP_442347.1_2 Forward -76 -67 12.4878 0.056
NP_442347.1_2 Reverse -69 -78 3.34298 0.284
NP_442645.1_2 Forward -79 -60 -21.4367 0.29
NP_442645.1_2 Forward -64 -45 -21.6334 0.29
NP_441037.1_4 Reverse -66 -76 9.55921 0.21
NP_441037.1_4 Forward -79 -69 7.22024 0.237
NP_441633.1_3 Forward -79 -66 6.01747 0.0481
NP_441633.1_3 Reverse -66 -79 -6.07724 0.236
NP_441633.1_3 Reverse -324 -337 -6.66722 0.265
NP_440136.1_2 Forward -76 -69 15.9687 0.0123
NP_440136.1_2 Reverse -69 -76 15.9687 0.0123
NP_442590.1_10 Forward -343 -324 3.6377 0.289
NP_442998.1_10 Forward -75 -68 15.5754 0.0102
NP_442998.1_10 Reverse -70 -77 15.5754 0.0102
NP_440899.1_1 Reverse -227 -246 6.16283 0.287
NP_440299.1_1 Reverse -64 -77 13.5883 0.0298
NP_440299.1_1 Forward -81 -68 11.1301 0.0518
NP_441799.1_1 Forward -81 -67 7.76712 0.133
NP_441799.1_1 Reverse -64 -78 4.71887 0.238
NP_441007.1_10 Reverse -63 -76 3.16588 0.182
NP_441007.1_10 Reverse -228 -241 2.87088 0.183
NP_441007.1_10 Forward -82 -69 1.29759 0.203
NP_442333.2_5 Forward -252 -233 -9.73531 0.246
NP_440256.1_1 Forward -80 -61 3.14605 0.056
NP_440256.1_1 Reverse -65 -84 0.196116 0.0858
NP_440256.1_1 Reverse -196 -215 -7.4737 0.238
NP_441559.1_8 Forward -82 -68 10.9143 0.0574
NP_441559.1_8 Reverse -288 -302 -4.03198 0.215
NP_441559.1_8 Reverse -63 -77 -5.9986 0.271
NP_441559.1_8 Reverse -167 -181 -6.98191 0.281
NP_440915.1_6 Reverse -64 -78 23.1074 0.00162
NP_440915.1_6 Forward -81 -67 10.6193 0.0301
NP_442158.1_4 Forward -271 -261 11.8781 0.264
NP_441179.1_9 Forward -232 -222 9.616 0.28
NP_441704.1_8 Reverse -57 -76 8.4551 0.208
NP_440748.1_5 Forward -239 -220 -2.26216 0.273
NP_440702.1_8 Reverse -61 -80 10.5209 0.29
NP_441939.1_3 Reverse -69 -88 22.7139 0.00342
NP_441494.1_6 Forward -82 -69 6.01747 0.289
NP_442386.1_9 Reverse -67 -76 13.8639 0.0289
NP_442386.1_9 Forward -78 -69 6.39082 0.219
NP_442386.1_9 Forward -231 -222 4.52254 0.297
NP_441340.1_5 Forward -76 -69 15.6737 0.0124
NP_441340.1_5 Reverse -69 -76 15.6737 0.0124
NP_442327.1_3 Reverse -255 -274 16.3764 0.156
NP_440168.1_9 Reverse -151 -170 -1.47551 0.273
NP_442240.1_1 Forward -85 -66 7.27514 0.253
NP_442240.1_2 Reverse -69 -88 -10.522 0.137
NP_440586.1_1 Reverse -78 -97 -6.29373 0.299
NP_440586.1_8 Forward -76 -69 13.2151 0.026
NP_440586.1_8 Reverse -69 -76 13.2151 0.026
NP_440586.1_8 Reverse -222 -229 5.8403 0.283
NP_442251.1_6 Forward -76 -69 15.2804 0.0124
NP_442251.1_6 Reverse -69 -76 15.2804 0.0124
NP_440684.1_3 Forward -64 -45 21.6323 0.0351
NP_441262.1_3 Reverse -68 -75 14.7888 0.0223
NP_441262.1_3 Forward -77 -70 14.7888 0.0223
NP_440027.1_8 Reverse -65 -84 12.1917 0.209
NP_443051.1_1 Forward -78 -69 19.5676 0.00335
NP_443051.1_1 Reverse -67 -76 10.4228 0.00754
NP_439996.1_6 Reverse -273 -292 5.87257 0.3
NP_439937.1_9 Forward -78 -61 -6.55 0.157
NP_440408.1_7 Reverse -193 -212 9.93088 0.253
NP_440408.1_7 Forward -242 -223 8.75091 0.269
NP_440408.1_7 Reverse -68 -87 8.65258 0.272
NP_440439.1_1 Forward -80 -67 10.934 0.0339
NP_440439.1_1 Reverse -196 -209 4.54251 0.101
NP_440439.1_1 Reverse -65 -78 1.10092 0.162
NP_439943.1_7 Reverse -63 -82 2.85105 0.292
NP_440372.1_2 Forward -76 -69 16.3621 0.0124
NP_440372.1_2 Reverse -69 -76 16.3621 0.0124
NP_441803.1_2 Forward -82 -63 14.5524 0.0425
NP_439977.1_5 Reverse -62 -81 8.75091 0.102
NP_439977.1_5 Forward -83 -64 3.04771 0.163
NP_440139.1_1 Reverse -215 -234 0.981987 0.275
NP_441572.1_7 Reverse -6 -25 -1.08219 0.186
NP_441572.1_7 Forward -83 -64 -1.86883 0.19
NP_441572.1_7 Reverse -62 -81 -2.45882 0.196
NP_440267.1_2 Forward -82 -68 11.5037 0.125
NP_442887.1_5 Forward -54 -35 -14.3569 0.294
NP_442384.1_10 Reverse -68 -81 18.8988 0.00338
NP_442384.1_10 Forward -162 -149 4.44418 0.157
NP_442384.1_10 Forward -77 -64 3.95252 0.172
NP_441877.1_3 Forward -133 -115 14.7688 0.213
NP_441018.1_7 Reverse -64 -83 7.7676 0.265
NP_442790.1_4 Reverse -59 -78 -0.39387 0.0942
NP_442790.1_4 Forward -86 -67 -15.4385 0.294
NP_442262.1_10 Forward -76 -69 14.1988 0.0123
NP_442262.1_10 Reverse -69 -76 14.1988 0.0123
NP_442262.1_10 Reverse -95 -102 7.6106 0.274
NP_441689.1_5 Forward -79 -69 8.3377 0.132
NP_441689.1_5 Reverse -197 -207 5.87944 0.197
NP_441689.1_5 Reverse -66 -76 5.87944 0.197
NP_440163.1_10 Forward -329 -319 11.0914 0.174
NP_440344.1_10 Reverse -61 -78 9.28195 0.00838
NP_440282.1_10 Reverse -223 -242 -6.58872 0.25
NP_442910.1_1 Reverse -61 -80 -6.98204 0.254
NP_441965.1_10 Reverse -65 -81 8.61333 0.123
NP_441965.1_10 Forward -43 -27 5.56507 0.203
NP_442556.1_10 Reverse -272 -291 8.16237 0.299
NP_440297.1_9 Forward -76 -66 -0.216628 0.282
NP_440297.1_9 Reverse -69 -79 -0.216628 0.282
NP_441592.1_4 Forward -292 -273 -3.54046 0.283
NP_441896.1_3 Reverse -59 -78 5.99764 0.11
NP_441896.1_3 Reverse -274 -293 3.04771 0.179
NP_440894.1_10 Reverse -63 -82 3.24438 0.276
NP_443036.1_8 Forward -336 -317 17.994 0.202
NP_441894.1_1 Forward -359 -340 -5.40875 0.263
NP_440999.1_9 Reverse -64 -78 11.3077 0.0455
NP_440999.1_9 Forward -81 -67 10.226 0.0548
NP_440999.1_9 Reverse -289 -303 -2.95034 0.281
NP_440999.1_9 Forward -296 -282 -3.44199 0.293
NP_440888.1_2 Forward -77 -63 20.1568 0.000881
NP_440888.1_2 Reverse -68 -82 15.9285 0.00837
NP_440888.1_2 Forward -215 -201 8.06211 0.172
NP_440888.1_2 Reverse -153 -167 7.3738 0.198
NP_440600.1_4 Forward -85 -67 -0.964162 0.16
NP_440491.1_1 Reverse -65 -84 15.6882 0.0804
NP_439969.1_3 Reverse -63 -82 2.26107 0.247
NP_441787.1_2 Forward -253 -234 20.1573 0.182
NP_442277.1_4 Reverse -59 -78 4.71854 0.187
NP_442277.1_4 Forward -86 -67 3.24359 0.228
NP_442277.1_4 Forward -251 -232 2.85027 0.237
NP_442033.1_10 Forward -79 -60 -8.16202 0.191
NP_441543.1_2 Forward -76 -67 16.9127 0.00359
NP_441543.1_2 Reverse -69 -78 15.9293 0.00518
NP_442845.1_2 Reverse -62 -76 10.7177 0.143
NP_442845.1_2 Reverse -193 -207 6.88276 0.201
NP_442845.1_2 Forward -83 -69 6.48943 0.209
NP_441834.1_7 Reverse -56 -75 14.9458 0.249
NP_441178.1_5 Reverse -56 -75 8.94757 0.295
NP_441319.1_5 Forward -170 -151 8.16093 0.289
NP_441469.1_8 Forward -78 -69 6.5879 0.227
NP_441469.1_8 Reverse -67 -76 6.48957 0.227
NP_443064.1_6 Forward -77 -67 12.5669 0.0796
NP_443064.1_6 Reverse -68 -78 10.8217 0.13
NP_443064.1_6 Forward -162 -152 8.39772 0.292
NP_442578.1_7 Forward -76 -69 14.5921 0.026
NP_442578.1_7 Reverse -69 -76 14.5921 0.026
NP_442578.1_7 Forward -114 -107 9.38056 0.138
NP_440998.1_6 Reverse -312 -331 13.47 0.295
NP_440220.1_4 Reverse -261 -280 0.588665 0.247
NP_440220.1_4 Forward -243 -224 -0.984623 0.262
NP_441462.1_2 Reverse -68 -78 20.2362 0.000805
NP_441462.1_2 Forward -77 -67 11.5831 0.00406
NP_441621.1_7 Reverse -66 -80 4.62115 0.0934
NP_443062.1_1 Reverse -68 -86 17.1266 0.0265
NP_443062.1_6 Reverse -60 -79 0.687771 0.291
NP_442204.1_1 Forward -81 -70 21.1015 0.0035
NP_442204.1_2 Forward -87 -68 5.99764 0.292
NP_440516.1_8 Forward -77 -68 16.9127 0.00442
NP_440516.1_8 Reverse -68 -77 16.9127 0.00442
NP_441785.1_1 Forward -77 -63 13.611 0.205
NP_442428.1_5 Forward -76 -69 15.8704 0.0124
NP_442428.1_5 Reverse -69 -76 15.8704 0.0124
NP_442120.1_10 Reverse -293 -312 -13.8652 0.288
NP_442120.1_10 Reverse -287 -306 -15.9302 0.296
NP_442120.1_10 Forward -180 -161 -16.0285 0.296
NP_440673.1_3 Forward -75 -68 12.4288 0.0426
NP_440673.1_3 Reverse -70 -77 12.4288 0.0426
NP_440673.1_3 Reverse -173 -180 6.23397 0.283
NP_441714.1_2 Forward -69 -51 12.9988 0.234
NP_440865.1_9 Reverse -62 -81 -7.37537 0.244
NP_441052.1_2 Forward -77 -67 19.9412 0.00106
NP_441052.1_2 Reverse -68 -78 10.4031 0.0285
NP_442219.1_9 Forward -76 -67 17.7976 0.00718
NP_442219.1_9 Reverse -69 -78 8.25953 0.0681
NP_440436.1_4 Forward -76 -67 17.2072 0.00233
NP_440436.1_4 Reverse -69 -78 9.24241 0.0871
NP_441884.1_8 Reverse -67 -86 -9.73531 0.268
NP_441884.1_9 Forward -80 -61 -22.0267 0.275
NP_441884.1_9 Reverse -65 -84 -22.6167 0.281
NP_441884.1_9 Forward -242 -223 -23.1083 0.284
NP_441893.1_5 Forward -92 -78 16.6169 0.225
NP_441336.1_3 Forward -84 -70 13.9626 0.298
NP_441719.1_4 Forward -76 -69 16.3621 0.0124
NP_441719.1_4 Reverse -69 -76 16.3621 0.0124
NP_441733.1_10 Reverse -65 -78 10.2457 0.106
NP_441004.1_1 Forward -320 -301 -0.590531 0.124
NP_441004.1_1 Forward -186 -167 -5.11376 0.175
NP_441004.1_4 Forward -183 -173 18.7612 0.057
NP_442366.1_3 Reverse -67 -85 6.50899 0.0776
NP_441115.1_4 Reverse -67 -85 9.94979 0.194
NP_441115.1_4 Forward -78 -60 8.17984 0.257
NP_442854.1_4 Forward -82 -63 12.1917 0.243
NP_440328.1_4 Forward -83 -64 1.37609 0.225
NP_443054.1_2 Forward -79 -65 10.3243 0.0761
NP_443054.1_2 Reverse -30 -44 -0.0987402 0.284
NP_442430.1_10 Forward -87 -68 11.7 0.245
NP_442308.1_4 Reverse -208 -227 -0.0988766 0.282
NP_441851.1_10 Reverse -67 -77 15.8113 0.00552
NP_441851.1_10 Forward -78 -68 8.53483 0.114
NP_442208.1_5 Reverse -66 -85 11.8975 0.129
NP_442622.1_6 Reverse -229 -248 6.98095 0.195
NP_442011.1_1 Reverse -67 -86 -2.95047 0.285
NP_442856.1_7 Forward -86 -67 7.47261 0.113
NP_441668.1_4 Forward -87 -68 -0.885524 0.263
NP_442515.1_1 Forward -116 -102 -3.04867 0.285
NP_442515.1_1 Forward -78 -64 -4.32697 0.298
NP_442515.1_1 Reverse -67 -81 -4.62196 0.298
NP_440593.1_3 Reverse -63 -82 -6.09707 0.27
NP_440463.1_6 Forward -80 -61 17.5024 0.0474
NP_440165.1_3 Forward -104 -90 19.8618 0.116
NP_440165.1_5 Reverse -142 -161 -6.09707 0.231
NP_441349.1_4 Reverse -178 -197 5.60432 0.138
NP_441349.1_10 Forward -87 -68 7.17762 0.0326
NP_441409.1_6 Reverse -62 -81 0.884433 0.0648
NP_441409.1_6 Forward -83 -64 -10.3253 0.203
NP_440432.1_9 Forward -76 -61 -1.39674 0.167
NP_442843.1_1 Forward -179 -160 -9.047 0.264
NP_442843.1_1 Reverse -222 -241 -11.9969 0.296
NP_439960.1_10 Forward -84 -66 4.6407 0.161
NP_440431.1_3 Forward -78 -59 -10.6203 0.276
NP_440588.1_2 Forward -86 -67 16.5191 0.0108
NP_440954.1_1 Reverse -227 -246 -4.72043 0.289
NP_442006.1_2 Reverse -194 -211 -6.84433 0.169
NP_441003.1_9 Forward -86 -67 4.916 0.274
NP_442243.1_1 Forward -83 -65 2.18168 0.204
NP_441570.1_1 Reverse -68 -86 -8.83064 0.122
NP_441570.1_1 Forward -77 -59 -16.5988 0.249
NP_441078.1_4 Forward -77 -68 19.6659 0.0007
NP_441078.1_4 Reverse -68 -77 19.6659 0.0007
NP_441078.1_4 Forward -162 -153 -1.86856 0.272
NP_442729.1_8 Forward -166 -153 10.344 0.125
NP_442729.1_8 Reverse -64 -77 8.77074 0.125
NP_440539.1_9 Forward -228 -209 -6.29373 0.286
NP_441663.1_8 Forward -83 -64 7.27595 0.106
NP_440707.1_6 Forward -85 -66 12.3883 0.217
NP_442443.1_1 Forward -196 -177 -2.95047 0.264
NP_440526.1_3 Forward -76 -65 20.0193 0.0113
NP_441432.1_8 Reverse -67 -76 16.8143 0.00595
NP_441432.1_8 Forward -78 -69 16.8143 0.00595
NP_441432.1_8 Reverse -232 -241 10.0295 0.0681
NP_442320.1_8 Reverse -62 -76 15.7325 0.0102
NP_441732.1_2 Forward -81 -65 12.6449 0.00384
NP_440760.1_1 Reverse -68 -87 -3.73712 0.0357
NP_440760.1_1 Forward -77 -58 -8.55534 0.0785
NP_440199.1_10 Reverse -65 -75 7.35486 0.231
NP_441805.1_2 Forward -88 -69 -4.42544 0.275
NP_441057.1_4 Forward -50 -32 -4.20908 0.299
NP_440913.1_1 Forward -79 -61 4.24738 0.276
NP_441023.1_1 Forward -255 -237 10.3439 0.278
NP_440713.1_4 Reverse -189 -208 10.7175 0.123
NP_440713.1_4 Forward -87 -68 5.89931 0.2
NP_440713.1_4 Reverse -58 -77 3.24438 0.248
NP_442489.1_7 Forward -77 -68 20.1576 0.000695
NP_442489.1_7 Reverse -68 -77 20.1576 0.000695
NP_442489.1_7 Reverse -283 -292 -1.86856 0.259
NP_440559.1_1 Forward -76 -67 17.4043 0.00658
NP_440559.1_1 Reverse -69 -78 8.65285 0.0586
NP_441659.2_8 Reverse -68 -78 20.9245 0.000805
NP_441659.2_8 Forward -77 -67 18.1713 0.00133
NP_440426.1_7 Reverse -327 -346 6.29264 0.207
NP_442913.1_10 Forward -86 -67 7.96426 0.0505
NP_441040.1_2 Forward -85 -66 -13.6686 0.284
NP_439956.1_7 Forward -46 -27 0.687771 0.298
NP_442008.1_2 Reverse -65 -84 6.09597 0.223
NP_440708.1_6 Reverse -313 -332 -8.94866 0.259
NP_441800.1_10 Reverse -31 -50 2.16274 0.255
NP_440779.1_5 Forward -77 -60 -14.2191 0.243
NP_442346.1_5 Reverse -67 -77 16.6963 0.00248
NP_442346.1_5 Forward -78 -68 16.303 0.00248
NP_440545.1_3 Reverse -64 -81 15.1818 0.0136
NP_440545.1_3 Forward -81 -64 1.02215 0.127
NP_440545.1_3 Forward -246 -229 -5.86102 0.262
NP_440831.1_9 Reverse -84 -103 14.7491 0.243
NP_440459.1_2 Forward -340 -323 11.7402 0.166
NP_441653.1_2 Forward -88 -69 4.49595 0.257
NP_442603.1_7 Forward -77 -63 12.192 0.102
NP_442603.1_7 Reverse -68 -82 10.5204 0.125
NP_441585.1_6 Reverse -329 -348 19.0748 0.147
NP_441888.1_7 Forward -82 -68 3.8345 0.225
NP_441888.1_7 Forward -213 -199 0.88457 0.276
NP_440449.1_6 Forward -250 -232 5.4352 0.276
NP_441833.1_4 Forward -76 -69 15.9687 0.0124
NP_441833.1_4 Reverse -69 -76 15.9687 0.0124
NP_442162.1_9 Forward -76 -69 16.2637 0.0124
NP_442162.1_9 Reverse -69 -76 16.2637 0.0124
NP_440671.1_2 Reverse -71 -85 16.3225 0.155
NP_440671.1_4 Forward -83 -69 10.0294 0.165
NP_440671.1_4 Reverse -62 -76 6.6861 0.239
NP_441973.1_1 Forward -37 -22 0.27489 0.235
NP_442140.1_3 Forward -76 -66 13.5497 0.0542
NP_442140.1_3 Reverse -222 -232 11.6814 0.0738
NP_442140.1_3 Reverse -69 -79 4.69992 0.238
NP_441609.1_1 Reverse -268 -287 5.11266 0.189
NP_440875.1_9 Reverse -70 -80 16.5483 0.0145
NP_440875.1_9 Forward -75 -65 8.66404 0.233
NP_441813.1_5 Forward -79 -69 18.1713 0.00743
NP_441813.1_5 Reverse -66 -76 8.73149 0.0367
NP_441259.1_3 Forward -194 -175 5.80098 0.277
NP_440590.1_4 Forward -76 -63 23.0287 0.00377
NP_440590.1_4 Reverse -69 -82 4.44418 0.0601
NP_440590.1_4 Reverse -200 -213 1.9859 0.105
NP_440567.1_1 Forward -76 -62 9.63603 0.0422
NP_440567.1_1 Reverse -69 -83 5.80112 0.0959
NP_442497.1_10 Reverse -69 -78 17.601 0.00813
NP_442497.1_10 Forward -76 -67 10.4228 0.0087
NP_440821.1_4 Reverse -66 -76 17.9746 0.00497
NP_440821.1_4 Forward -79 -69 2.24165 0.131
NP_441239.1_9 Forward -79 -67 13.0187 0.0389
NP_441239.1_9 Reverse -66 -78 7.11881 0.169
NP_441727.1_3 Reverse -61 -80 3.24438 0.291
NP_440624.1_5 Reverse -93 -111 6.70333 0.298
NP_441892.1_1 Forward -86 -69 -0.649475 0.188
NP_441892.1_1 Reverse -59 -76 -2.3211 0.22
NP_440665.1_1 Forward -320 -301 -15.9302 0.275
NP_440604.1_6 Reverse -68 -87 -2.85214 0.225
NP_442044.1_1 Forward -82 -63 -12.2919 0.271
NP_442193.1_8 Reverse -65 -84 12.29 0.234
NP_442643.1_1 Reverse -62 -81 -11.2103 0.231
NP_441874.1_1 Forward -125 -111 13.8643 0.208
NP_441874.1_1 Reverse -343 -357 11.6026 0.24
NP_443012.1_9 Forward -327 -308 13.3725 0.28
NP_441936.1_1 Reverse -78 -97 21.6323 0.0655
NP_440354.1_5 Reverse -65 -84 8.35759 0.174
NP_442052.1_8 Forward -333 -323 12.7631 0.253
NP_440546.1_4 Reverse -68 -78 13.5365 0.0459
NP_440546.1_4 Forward -77 -67 10.046 0.109
NP_440546.1_4 Reverse -221 -231 9.56122 0.131
NP_442041.1_5 Forward -241 -222 -1.27885 0.278
NP_440462.1_6 Forward -79 -69 18.7612 0.00454
NP_440462.1_6 Reverse -66 -76 10.3048 0.0396
NP_442611.1_1 Reverse -68 -87 4.62101 0.194
NP_440868.1_4 Forward -81 -69 8.00379 0.0602
NP_440868.1_4 Reverse -64 -76 0.432302 0.212
NP_440868.1_4 Reverse -279 -291 -1.14099 0.296
NP_442402.1_4 Reverse -98 -117 -8.94939 0.285
NP_441084.1_6 Forward -79 -65 13.3194 0.135
NP_441084.1_6 Reverse -29 -43 9.92586 0.257
NP_442460.1_3 Reverse -142 -161 12.6841 0.233
NP_440843.1_8 Reverse -227 -246 17.2074 0.233
NP_442039.1_4 Forward -76 -69 15.1821 0.0124
NP_442039.1_4 Reverse -69 -76 15.1821 0.0124
NP_440825.1_6 Reverse -92 -111 11.5042 0.277
NP_442837.1_3 Forward -76 -69 15.7721 0.0124
NP_442837.1_3 Reverse -69 -76 15.7721 0.0124
NP_440160.1_2 Forward -242 -223 -6.39206 0.281
NP_440160.1_2 Reverse -31 -50 -7.37537 0.286
NP_439994.1_3 Forward -78 -59 23.9493 0.00991
NP_442053.1_1 Forward -77 -68 18.3876 0.0007
NP_442053.1_1 Reverse -68 -77 18.3876 0.0007
NP_442053.1_1 Reverse -153 -162 10.6195 0.0506
NP_440505.1_3 Forward -79 -69 17.188 0.00332
NP_440505.1_3 Reverse -66 -76 16.598 0.00683
NP_441701.1_3 Reverse -223 -240 18.1317 0.126
NP_441252.1_6 Reverse -78 -85 11.9372 0.25
NP_441252.1_6 Forward -183 -176 11.9372 0.25
NP_442971.1_9 Reverse -309 -327 5.23069 0.283
NP_441203.1_1 Reverse -69 -88 -12.6852 0.144
NP_441408.2_7 Reverse -66 -85 -5.60541 0.297
NP_440914.1_1 Forward -77 -67 17.5935 0.000537
NP_440914.1_1 Reverse -68 -78 16.3248 0.00196
NP_441011.1_8 Reverse -69 -78 16.6177 0.00602
NP_441011.1_8 Forward -76 -67 8.25953 0.144
NP_442533.1_6 Forward -77 -68 17.2076 0.00137
NP_442533.1_6 Reverse -68 -77 17.2076 0.00137
NP_442533.1_6 Forward -40 -31 6.48957 0.109
NP_442533.1_6 Forward -208 -199 2.16301 0.27
NP_442541.1_10 Reverse -322 -336 3.53891 0.254
NP_441482.1_7 Forward -83 -69 6.98109 0.0257
NP_439944.1_9 Forward -76 -66 19.1546 0.00329
NP_439944.1_9 Reverse -69 -79 9.12481 0.1
NP_439944.1_9 Reverse -234 -244 8.4365 0.108
NP_442202.1_10 Forward -243 -229 4.71948 0.255
NP_440115.1_6 Forward -80 -70 14.0414 0.0615
NP_440115.1_6 Reverse -65 -75 9.81313 0.115
NP_440115.1_6 Forward -118 -108 6.66654 0.172
NP_440007.1_9 Forward -81 -67 10.226 0.163
NP_440007.1_9 Reverse -64 -78 1.76955 0.285
NP_441059.1_2 Reverse -69 -88 -8.26035 0.299
NP_441602.1_3 Reverse -228 -247 2.94938 0.187
NP_441602.1_3 Reverse -63 -82 -2.95047 0.239
NP_441972.1_5 Forward -76 -57 -1.86883 0.178
NP_441106.1_1 Forward -78 -69 18.486 0.0028
NP_441106.1_1 Reverse -67 -76 9.63616 0.0311
NP_441106.1_1 Forward -137 -128 2.65466 0.269
NP_439903.1_6 Forward -239 -220 3.63691 0.207
NP_441286.1_1 Forward -78 -66 12.232 0.00999
NP_441286.1_1 Reverse -67 -79 5.93884 0.0258
NP_440670.1_8 Forward -77 -68 18.3876 0.000699
NP_440670.1_8 Reverse -68 -77 18.3876 0.000699
NP_441479.1_1 Reverse -65 -84 12.8808 0.144
NP_440886.1_7 Forward -78 -68 8.04271 0.0805
NP_440886.1_7 Reverse -67 -77 7.94438 0.0805
NP_440886.1_7 Forward -293 -283 5.28945 0.188
NP_440886.1_7 Forward -22 -12 4.7978 0.218
NP_442072.1_9 Reverse -67 -85 -12.8622 0.0926
NP_442072.1_9 Forward -78 -60 -21.3187 0.207
NP_440028.1_6 Reverse -222 -240 15.0638 0.218
NP_440907.2_8 Forward -76 -66 10.8943 0.0969
NP_440907.2_8 Reverse -69 -79 9.616 0.103
NP_441463.1_3 Reverse -96 -115 -2.65548 0.158
NP_441626.1_2 Forward -76 -69 15.7721 0.0124
NP_441626.1_2 Reverse -69 -76 15.7721 0.0124
NP_442794.1_1 Forward -81 -69 10.5604 0.0721
NP_442794.1_1 Reverse -64 -76 3.48056 0.286
NP_442615.1_1 Forward -86 -68 0.21581 0.106
NP_442615.1_1 Reverse -59 -77 -5.68405 0.22
NP_441962.1_4 Forward -76 -57 -10.4236 0.228
NP_441962.1_4 Reverse -63 -82 -10.4236 0.228
NP_441962.1_4 Forward -82 -63 -13.1769 0.271
NP_441962.1_4 Forward -185 -166 -13.2752 0.271
NP_440387.1_1 Reverse -68 -84 -0.334789 0.137
NP_440855.1_1 Forward -192 -173 0.0977854 0.244
NP_441431.1_2 Forward -80 -66 12.487 0.116
NP_441488.1_8 Forward -82 -68 9.73373 0.146
NP_441836.1_2 Reverse -62 -81 -5.21209 0.275
NP_441836.1_2 Reverse -227 -246 -5.50708 0.283
NP_441836.1_2 Reverse -277 -296 -5.9004 0.288
NP_441993.1_1 Reverse -62 -81 14.8111 0.0768
NP_441993.1_1 Reverse -68 -87 3.60346 0.231
NP_441993.1_1 Reverse -75 -94 3.01872 0.244
NP_442805.1_5 Forward -101 -82 -4.22953 0.266
NP_442323.1_7 Forward -82 -63 15.7316 0.0594
NP_441552.1_3 Reverse -61 -80 17.9932 0.123
NP_441272.1_4 Reverse -320 -339 14.0608 0.103
NP_440293.1_3 Reverse -204 -223 -4.91709 0.268
NP_440293.1_3 Reverse -225 -244 -5.9004 0.285
NP_440293.1_9 Forward -40 -26 10.7645 0.261
NP_440766.1_4 Reverse -64 -78 8.06273 0.0871
NP_440766.1_4 Forward -194 -180 0.687908 0.271
NP_439988.1_3 Reverse -69 -83 6.19444 0.278
NP_440422.1_10 Reverse -103 -122 8.2744 0.212
NP_441237.1_9 Forward -76 -66 14.9263 0.0242
NP_442743.1_1 Forward -240 -221 9.7334 0.262
NP_442743.1_4 Reverse -69 -88 -2.16383 0.208
NP_439910.1_2 Reverse -60 -77 -22.2823 0.22
NP_440457.1_1 Forward -81 -69 7.70879 0.101
NP_440457.1_1 Reverse -64 -76 5.34885 0.141
NP_440798.1_6 Reverse -69 -82 2.08423 0.186
NP_442680.1_5 Forward -117 -98 5.83596 0.216
NP_442297.1_4 Forward -81 -62 14.9613 0.181
NP_441436.1_2 Reverse -214 -233 -5.80207 0.294
NP_441436.1_8 Reverse -67 -86 7.37428 0.293
NP_442509.1_9 Forward -77 -67 8.14104 0.192
NP_442509.1_9 Reverse -68 -78 8.04271 0.192
NP_441765.1_4 Forward -71 -52 16.1257 0.138
NP_442514.1_5 Forward -90 -71 -7.57277 0.276
NP_440554.1_4 Reverse -69 -79 17.9746 0.0131
NP_440554.1_4 Forward -76 -66 6.37155 0.123
NP_441885.1_5 Forward -77 -67 20.9245 0.000538
NP_441885.1_5 Reverse -68 -78 11.3864 0.00668
NP_441885.1_5 Forward -162 -152 -0.314959 0.195
NP_441466.1_9 Forward -64 -45 19.9233 0.0915
NP_442341.1_7 Forward -78 -64 11.8976 0.0502
NP_442341.1_7 Reverse -67 -81 1.67122 0.282
NP_442341.1_9 Forward -79 -65 11.4053 0.127
NP_441756.1_5 Reverse -64 -83 5.60432 0.183
NP_440119.1_1 Forward -239 -223 11.1699 0.0993
NP_442395.2_4 Reverse -67 -86 13.0766 0.0711
NP_440409.1_10 Reverse -226 -245 10.3242 0.29
NP_443000.1_7 Forward -79 -69 20.3345 0.00223
NP_443000.1_7 Reverse -66 -76 10.4031 0.0345
NP_441842.1_10 Reverse -87 -101 12.8809 0.0895
NP_440275.1_3 Reverse -66 -76 17.6796 0.0102
NP_440275.1_3 Forward -79 -69 16.1063 0.0155
NP_440091.1_1 Reverse -64 -76 10.7571 0.0429
NP_443060.1_5 Reverse -60 -79 5.80018 0.254
NP_442451.1_2 Forward -85 -66 -9.83364 0.26
NP_442495.1_4 Reverse -72 -82 16.303 0.0771
NP_442495.1_9 Forward -103 -84 17.3048 0.19
NP_440149.1_10 Reverse -233 -252 -4.03212 0.251
NP_441105.1_3 Forward -88 -69 17.6007 0.0113
NP_441105.1_3 Reverse -57 -76 2.0644 0.107
NP_440216.1_1 Reverse -68 -82 17.1092 0.00188
NP_440216.1_1 Forward -77 -63 -9.63684 0.145
NP_440216.1_9 Reverse -28 -37 6.78456 0.289
NP_440172.1_1 Reverse -68 -78 17.5813 0.00421
NP_440172.1_1 Forward -77 -67 15.0247 0.00945
NP_442015.1_10 Forward -81 -68 13.4906 0.0354
NP_442015.1_10 Reverse -64 -77 3.65753 0.178
NP_441226.1_7 Forward -76 -69 14.4934 0.0123
NP_441226.1_7 Reverse -69 -76 14.4934 0.0123
NP_441111.1_7 Forward -76 -68 18.7023 0.00294
NP_441111.1_7 Reverse -69 -77 18.7023 0.00294
NP_441766.1_2 Forward -77 -68 17.5026 0.00297
NP_441766.1_2 Reverse -68 -77 17.5026 0.00297
NP_442417.1_5 Reverse -68 -82 14.3559 0.0633
NP_440416.1_9 Forward -84 -65 -14.7502 0.18
NP_440416.1_9 Forward -223 -204 -15.7335 0.198
NP_443052.1_9 Forward -213 -194 -4.72043 0.26
NP_443052.1_10 Reverse -216 -235 18.5113 0.219
NP_442552.1_1 Reverse -174 -193 3.73603 0.203
NP_442116.1_6 Forward -100 -83 7.69149 0.254
NP_441940.1_4 Reverse -320 -339 8.65258 0.266
NP_442154.1_1 Reverse -222 -240 -8.14232 0.157
NP_442154.1_1 Forward -325 -307 -11.4856 0.215
NP_442154.1_1 Reverse -275 -293 -15.7138 0.224
NP_440261.1_5 Reverse -69 -82 6.70579 0.0318
NP_440261.1_5 Forward -76 -63 -2.93064 0.0983
NP_440261.1_7 Reverse -73 -92 -4.91709 0.217
NP_440988.1_10 Reverse -321 -335 8.86815 0.205
NP_440988.1_10 Reverse -66 -80 5.67333 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGGTGTCGTCCCTAATTAAGCGGGAGGTCAGTCAAATGCTTCTCCACGAAATCAAAGATGACCGGGTGGGCACAGGCATGGTTAGCGTCACGGAAGTGGAAGTTTCCGGCGACCTACAGCACGCCAAAATTTTCGTTAGCATTTACGGCTCCCCTGAAGCCAAAGCCTCCACCATGGCTGGACTGCACTCCGCCGCTCCCTTTGTCCGTCGAGAACTGGGGCAACGGATGCGTTTACGGCGCACCCCAGAAGTTTCCTTTTTAGAAGACCGCTCTTTGGAACGGGGCGATAAAATTCTCAATCTCCTCAACAACTTGCCCCAGGCGATCGCCACTGAAGATTTGGAAGACGACGATTCTGGCCTTGCCCTGGATTGACTCCGACCACGGTTAGACTGAC

CDS

TTGGGTACAGGGTACGACAAATTACCAACCATCCCATCAAGCAAGTTTTTCCAGTTATTTCAATACTCACCAAGTTTTAAGCAAACAGCAATGACAGAGGTATTAAGGGTAGGACAGCCGGCACCGGATTTCACCGCCACGGCGATCGTCGATCAAAGCTTCCAGACCGTCAAATTAAGCACCTACCGTGGTAAGTACCTGGTGCTGTTTTTCTATCCCCTAGATTTCACCTTTGTCTGTCCCACGGAAATCATTGCCTTTAGCGATCGCCATAGCGAATTTACTGCCCTAGATACGGAAGTTGTGGGCATCTCCGTAGACAGCGAATTTTCACACCTGGCCTGGATTCAGACCGAACGGAAAATGGGGGGCATCGGCAACATTAACTATCCCCTAGTGTCAGATCTCAAAAAAGAAATTAGCCAAGCCTATAATGTCCTCGAACCCGATGCAGGCATTGCCCTGCGGGGACTATTCATTATTGACCGGGAAGGCATCTTACAATACGCCACCGTCAACAATCTCTCCTTTGGCCGGAGTGTGGACGAAACTCTGAGGGTACTAAAAGCCATTCGCCATGTGCAATCTCACCCCAACGAAGTTTGCCCAGTGGATTGGCAGGAAGGAGACAAAACCATGATCCCCGACCCGGAAAAGGCTAAGACCTACTTCGAGACAGTGGCGGAACCTTAG

Protein

MGTGYDKLPTIPSSKFFQLFQYSPSFKQTAMTEVLRVGQPAPDFTATAIVDQSFQTVKLSTYRGKYLVLFFYPLDFTFVCPTEIIAFSDRHSEFTALDTEVVGISVDSEFSHLAWIQTERKMGGIGNINYPLVSDLKKEISQAYNVLEPDAGIALRGLFIIDREGILQYATVNNLSFGRSVDETLRVLKAIRHVQSHPNEVCPVDWQEGDKTMIPDPEKAKTYFETVAEP