Your browser is old and dusty. Try Google Chrome!

Details for sll0753

ORF sll0753
Accession NP_442069.1
Symbol folD
Category Folic acid
Definition FolD bifunctional protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -86 -100 11.111 0.253
NP_441418.1_6 Forward -397 -378 -28.9099 0.213
NP_441418.1_6 Reverse -376 -395 -29.2048 0.219
NP_442291.1_7 Reverse -133 -147 22.8124 0.0413
NP_441453.1_4 Forward -397 -389 14.7691 0.0119
NP_441453.1_4 Reverse -388 -396 6.80426 0.121
NP_440226.1_1 Forward -397 -378 3.44104 0.225
NP_442744.1_8 Forward -146 -127 -0.590531 0.254
NP_442173.1_1 Forward -396 -388 12.0158 0.0316
NP_442173.1_1 Reverse -389 -397 12.0158 0.0316
NP_442752.1_4 Reverse -388 -395 13.8055 0.0199
NP_442752.1_4 Reverse -376 -383 5.54565 0.194
NP_440784.1_7 Reverse -389 -396 6.23397 0.241
NP_440784.1_7 Forward -396 -389 6.13563 0.241
NP_440061.1_9 Forward -399 -385 9.24208 0.149
NP_440061.1_9 Reverse -135 -149 7.27547 0.213
NP_442062.1_8 Reverse -388 -398 7.94484 0.0848
NP_442062.1_8 Reverse -30 -40 3.22496 0.279
NP_442974.1_6 Forward -146 -127 17.7965 0.293
NP_441859.1_3 Forward -398 -379 1.08032 0.296
NP_441859.1_4 Reverse -143 -162 25.1722 0.0155
NP_439918.1_3 Reverse -373 -392 4.52268 0.264
NP_441935.1_1 Forward -155 -136 13.4708 0.159
NP_441208.1_9 Forward -400 -386 9.34103 0.215
NP_442276.1_2 Forward -151 -132 3.04771 0.299
NP_441082.1_10 Reverse -92 -105 12.409 0.236
NP_442726.1_7 Forward -342 -324 2.18243 0.226
NP_440856.1_7 Reverse -323 -342 0.196116 0.167
NP_441083.1_5 Reverse -388 -398 17.7779 0.00336
NP_441083.1_5 Forward -397 -387 10.0098 0.0214
NP_439957.1_5 Forward -171 -152 15.6341 0.189
NP_440109.1_6 Reverse -121 -140 8.75091 0.268
NP_441738.1_2 Forward -395 -388 15.28 0.0102
NP_441558.1_5 Forward -148 -129 5.40766 0.251
NP_440209.1_1 Reverse -388 -396 8.57422 0.0425
NP_440209.1_1 Forward -397 -389 8.47588 0.0457
NP_442136.1_4 Forward -395 -376 11.7983 0.236
NP_442889.1_1 Forward -152 -133 -11.5053 0.218
NP_442889.1_1 Reverse -130 -149 -12.8819 0.24
NP_442889.1_1 Reverse -178 -197 -14.7502 0.283
NP_442889.1_8 Reverse -258 -272 17.6002 0.0162
NP_442889.1_8 Reverse -385 -399 9.93039 0.0933
NP_441792.1_5 Forward -328 -312 7.92501 0.29
NP_442111.1_4 Forward -398 -384 11.3077 0.0514
NP_440906.1_5 Reverse -389 -396 6.23397 0.234
NP_440906.1_5 Forward -396 -389 6.13563 0.241
NP_440747.1_10 Forward -400 -388 5.05386 0.019
NP_440747.1_10 Reverse -385 -397 -2.4193 0.0434
NP_441854.1_10 Forward -154 -135 10.8159 0.139
NP_441854.1_10 Reverse -138 -157 4.62101 0.282
NP_441486.1_1 Forward -149 -135 -6.29359 0.288
NP_442634.1_4 Reverse -28 -42 -3.44199 0.161
NP_440470.1_5 Reverse -164 -183 6.92274 0.279
NP_440842.1_10 Forward -149 -135 4.52282 0.254
NP_442848.1_1 Forward -135 -121 -1.77037 0.263
NP_443018.1_3 Forward -396 -389 11.7405 0.0655
NP_443018.1_3 Reverse -389 -396 5.44732 0.193
NP_441634.1_8 Forward -157 -143 -3.93365 0.295
NP_441634.1_8 Reverse -141 -155 -4.62196 0.295
NP_440376.1_1 Reverse -388 -397 15.7327 0.00625
NP_440376.1_1 Forward -397 -388 9.63616 0.0385
NP_440376.1_1 Reverse -97 -106 8.06287 0.0463
NP_441857.1_6 Reverse -318 -328 14.7297 0.229
NP_441588.1_4 Reverse -51 -61 15.9097 0.0369
NP_441588.1_4 Reverse -390 -400 6.17489 0.206
NP_442687.1_6 Reverse -377 -395 22.6353 0.00605
NP_442687.1_7 Reverse -387 -397 6.76487 0.154
NP_442485.1_3 Reverse -141 -160 8.35759 0.13
NP_442485.1_3 Forward -151 -132 -2.16383 0.262
NP_441682.1_2 Reverse -138 -157 3.6377 0.241
NP_441682.1_2 Reverse -262 -281 1.67108 0.241
NP_441422.1_7 Forward -137 -120 -4.18939 0.238
NP_440741.1_1 Forward -355 -336 12.9783 0.11
NP_440533.1_9 Reverse -30 -49 4.32602 0.229
NP_441950.1_7 Reverse -372 -391 -8.752 0.287
NP_442296.1_5 Reverse -128 -147 9.0459 0.206
NP_442198.1_7 Forward -149 -130 8.16011 0.298
NP_442782.1_2 Reverse -72 -86 0.687908 0.286
NP_441414.1_9 Forward -397 -378 -8.94866 0.249
NP_440184.1_1 Reverse -8 -27 2.68475 0.255
NP_442937.1_5 Forward -160 -141 7.66927 0.244
NP_441958.1_5 Reverse -387 -397 18.9579 0.00183
NP_441958.1_5 Forward -398 -388 2.43831 0.0422
NP_440203.1_5 Reverse -292 -302 9.51767 0.254
NP_439905.1_1 Reverse -138 -151 15.3589 0.0955
NP_439905.1_1 Forward -154 -141 11.6223 0.204
NP_439905.1_1 Forward -396 -383 7.39411 0.262
NP_439905.1_2 Reverse -132 -146 11.111 0.208
NP_440984.1_7 Forward -151 -137 9.5377 0.127
NP_442911.1_2 Reverse -378 -397 -9.83364 0.264
NP_440153.1_8 Reverse -137 -150 -3.71729 0.299
NP_440200.1_7 Forward -326 -307 7.0881 0.204
NP_443055.1_6 Forward -163 -145 4.63995 0.181
NP_440993.1_4 Reverse -261 -278 2.00546 0.3
NP_440934.1_2 Reverse -323 -342 -0.295539 0.296
NP_440809.1_9 Reverse -379 -397 -7.84733 0.225
NP_441646.1_7 Forward -340 -326 14.6509 0.256
NP_442885.1_5 Forward -395 -376 16.0265 0.206
NP_440484.1_1 Forward -153 -134 12.7816 0.191
NP_441674.1_10 Reverse -137 -155 1.69077 0.259
NP_440147.1_4 Forward -399 -386 8.57408 0.0491
NP_440147.1_4 Reverse -386 -399 8.57408 0.0491
NP_440147.1_4 Reverse -135 -148 1.10092 0.239
NP_441550.1_8 Reverse -386 -396 14.5325 0.0141
NP_441550.1_8 Forward -399 -389 13.6475 0.0228
NP_441916.1_7 Forward -397 -387 9.32148 0.037
NP_441916.1_10 Forward -142 -123 2.0644 0.253
NP_441041.1_4 Forward -146 -127 -9.34199 0.215
NP_442642.1_9 Reverse -381 -398 5.84037 0.192
NP_442004.1_6 Reverse -376 -390 3.8345 0.231
NP_441725.1_4 Reverse -383 -397 2.06395 0.297
NP_439966.1_7 Forward -399 -389 6.27276 0.185
NP_439966.1_7 Reverse -386 -396 4.60114 0.265
NP_439966.1_8 Forward -166 -147 7.66927 0.24
NP_442941.1_3 Forward -396 -386 9.41981 0.0319
NP_442941.1_3 Reverse -389 -399 1.35667 0.15
NP_442847.1_3 Reverse -132 -151 6.48849 0.235
NP_442012.1_1 Forward -152 -133 -0.688862 0.265
NP_442012.1_1 Reverse -370 -389 -0.983855 0.272
NP_441556.1_7 Reverse -136 -155 1.6703 0.284
NP_441644.1_6 Forward -397 -387 18.7607 0.00127
NP_441644.1_6 Reverse -388 -398 7.74772 0.117
NP_441644.1_6 Reverse -137 -147 4.60114 0.233
NP_442215.1_2 Forward -148 -132 -3.08806 0.209
NP_440929.1_8 Forward -397 -388 16.5193 0.00413
NP_440929.1_8 Reverse -388 -397 9.53783 0.0296
NP_440929.1_8 Reverse -261 -270 4.42462 0.187
NP_442933.1_10 Forward -397 -388 8.06287 0.0885
NP_442933.1_10 Reverse -388 -397 7.96454 0.0937
NP_441095.1_1 Reverse -303 -322 20.1961 0.169
NP_442648.1_1 Reverse -297 -316 8.45592 0.248
NP_441751.2_8 Forward -396 -382 -5.21195 0.199
NP_442554.1_8 Reverse -389 -399 12.9597 0.021
NP_442554.1_8 Forward -396 -386 7.45319 0.092
NP_442554.1_8 Reverse -138 -148 6.37155 0.12
NP_442554.1_8 Forward -145 -135 2.63497 0.265
NP_442142.1_4 Reverse -143 -156 6.31189 0.169
NP_442142.1_4 Forward -344 -331 4.05029 0.234
NP_442292.1_1 Reverse -389 -398 8.75118 0.0306
NP_442292.1_1 Forward -396 -387 7.66954 0.0634
NP_442476.1_6 Forward -336 -322 0.392915 0.262
NP_443009.1_5 Forward -398 -387 4.8764 0.226
NP_441726.1_7 Forward -248 -229 7.47261 0.248
NP_441715.1_4 Forward -396 -386 6.96153 0.121
NP_440183.1_9 Reverse -139 -158 -11.6036 0.252
NP_440183.1_9 Reverse -325 -344 -21.0434 0.296
NP_441468.1_1 Reverse -389 -396 6.13563 0.209
NP_441468.1_1 Forward -396 -389 6.0373 0.223
NP_441015.1_8 Forward -329 -310 6.4893 0.258
NP_441015.1_10 Forward -151 -132 -0.885524 0.169
NP_441673.1_1 Reverse -388 -397 11.1111 0.0121
NP_441673.1_1 Forward -397 -388 11.0128 0.018
NP_441731.1_3 Reverse -135 -154 -6.88371 0.299
NP_442253.1_5 Forward -149 -132 0.333834 0.203
NP_441426.1_6 Forward -164 -145 24.1889 0.013
NP_442490.1_9 Reverse -376 -395 -4.72043 0.273
NP_442490.1_9 Forward -161 -142 -8.26035 0.287
NP_442490.1_10 Reverse -136 -154 22.2419 0.0136
NP_441764.1_4 Forward -26 -9 13.7058 0.156
NP_442868.1_6 Forward -107 -97 2.83163 0.205
NP_442868.1_6 Reverse -386 -396 0.668351 0.213
NP_442868.1_6 Forward -399 -389 -0.0199663 0.255
NP_443058.1_7 Forward -398 -379 4.71934 0.255
NP_442808.1_1 Forward -107 -97 12.6642 0.0481
NP_442808.1_1 Forward -398 -388 9.22267 0.0481
NP_442808.1_1 Forward -108 -98 1.35624 0.287
NP_442342.1_9 Forward -148 -132 6.35172 0.221
NP_440558.1_2 Forward -149 -130 -0.197208 0.198
NP_440558.1_2 Reverse -329 -348 -3.73712 0.238
NP_441878.1_6 Reverse -136 -146 19.5479 0.0065
NP_441878.1_6 Forward -147 -137 0.963343 0.128
NP_441878.1_6 Reverse -387 -397 0.766681 0.134
NP_441878.1_6 Forward -398 -388 0.57002 0.14
NP_441036.1_8 Reverse -387 -397 14.4347 0.0234
NP_441557.1_5 Reverse -388 -397 10.2261 0.0144
NP_441557.1_5 Forward -397 -388 10.1278 0.0188
NP_442066.2_9 Reverse -384 -397 12.2123 0.154
NP_441739.1_2 Forward -387 -371 2.31948 0.288
NP_442469.1_7 Reverse -259 -278 14.1591 0.282
NP_442192.1_8 Forward -156 -137 9.43923 0.29
NP_441116.1_9 Reverse -55 -69 12.8809 0.246
NP_441549.1_9 Forward -150 -132 -8.92897 0.238
NP_442212.1_7 Forward -377 -358 13.3725 0.27
NP_440861.1_2 Reverse -362 -381 13.9661 0.187
NP_442347.1_2 Forward -384 -375 9.4395 0.0691
NP_442347.1_2 Reverse -290 -299 8.06287 0.116
NP_442888.1_7 Forward -163 -144 13.6675 0.281
NP_442594.1_8 Reverse -88 -107 2.55606 0.295
NP_440136.1_2 Reverse -389 -396 6.23397 0.171
NP_440136.1_2 Forward -396 -389 6.13563 0.193
NP_442590.1_10 Forward -152 -133 14.7491 0.116
NP_442998.1_10 Forward -395 -388 15.5754 0.0102
NP_442998.1_10 Reverse -390 -397 5.84064 0.235
NP_440899.1_8 Forward -171 -152 -9.63698 0.267
NP_441799.1_1 Reverse -384 -398 5.01387 0.227
NP_441007.1_10 Reverse -383 -396 0.805932 0.216
NP_440256.1_1 Forward -400 -381 -6.58872 0.215
NP_441559.1_8 Forward -288 -274 -5.40861 0.261
NP_440915.1_6 Reverse -384 -398 0.687908 0.155
NP_440164.1_6 Forward -378 -359 10.5209 0.179
NP_442785.1_7 Reverse -386 -400 11.406 0.228
NP_442069.1_4 Reverse -135 -154 4.32602 0.254
NP_441464.1_10 Reverse -95 -109 15.6342 0.166
NP_440695.1_5 Reverse -376 -395 3.6377 0.221
NP_440695.1_5 Forward -397 -378 -1.86883 0.291
NP_442386.1_9 Forward -398 -389 10.029 0.142
NP_442386.1_9 Forward -107 -98 5.60418 0.245
NP_442386.1_9 Forward -76 -67 4.7192 0.289
NP_440570.1_5 Forward -165 -146 -3.14714 0.288
NP_441340.1_5 Reverse -389 -396 13.5105 0.0314
NP_441340.1_5 Forward -396 -389 5.84064 0.208
NP_440168.1_9 Forward -163 -144 -4.52377 0.296
NP_440586.1_8 Forward -396 -389 9.47853 0.146
NP_440586.1_8 Reverse -389 -396 5.74197 0.283
NP_441262.1_3 Reverse -388 -395 14.7888 0.0223
NP_443051.1_1 Reverse -387 -396 16.6177 0.00754
NP_443051.1_1 Forward -398 -389 0.589713 0.143
NP_439937.1_9 Forward -390 -373 -9.89323 0.215
NP_439937.1_9 Forward -339 -322 -12.3515 0.271
NP_440408.1_7 Reverse -137 -156 7.47261 0.288
NP_440439.1_1 Reverse -385 -398 1.39592 0.156
NP_440921.1_5 Forward -52 -33 13.9625 0.103
NP_439943.1_7 Reverse -121 -140 7.07928 0.208
NP_440372.1_2 Reverse -389 -396 13.8055 0.0214
NP_440372.1_2 Forward -396 -389 6.52896 0.188
NP_441789.1_7 Forward -346 -327 -5.60616 0.299
NP_440819.1_5 Reverse -106 -114 7.8859 0.266
NP_440316.1_10 Reverse -136 -146 8.33817 0.24
NP_442384.1_10 Forward -397 -384 14.1789 0.0163
NP_442384.1_10 Forward -385 -372 9.75405 0.0497
NP_442790.1_4 Reverse -379 -398 -6.68705 0.144
NP_442262.1_10 Forward -396 -389 13.2155 0.0213
NP_441689.1_5 Reverse -386 -396 5.78111 0.197
NP_440344.1_10 Forward -392 -375 -13.2358 0.278
NP_440282.1_10 Forward -156 -137 -6.88371 0.25
NP_440531.1_6 Forward -154 -135 5.99764 0.112
NP_441640.1_7 Reverse -276 -295 17.5024 0.0512
NP_440297.1_9 Forward -145 -135 0.275027 0.282
NP_441592.1_4 Forward -341 -322 1.76941 0.21
NP_441896.1_5 Reverse -370 -377 15.3787 0.268
NP_440894.1_10 Forward -157 -138 5.60432 0.228
NP_442078.1_3 Forward -326 -307 -1.57461 0.277
NP_440999.1_1 Reverse -135 -154 7.76679 0.156
NP_440888.1_2 Forward -397 -383 10.3237 0.0974
NP_440600.1_4 Reverse -380 -398 -2.14413 0.188
NP_441543.1_2 Reverse -389 -398 7.57121 0.113
NP_441543.1_2 Forward -396 -387 6.09625 0.153
NP_441543.1_3 Forward -330 -316 6.0955 0.286
NP_442845.1_2 Reverse -91 -105 3.8345 0.275
NP_441319.1_5 Forward -115 -96 9.53756 0.27
NP_442315.1_2 Reverse -92 -104 21.2785 0.0428
NP_442315.1_2 Reverse -61 -73 15.2803 0.27
NP_443064.1_6 Reverse -388 -398 11.4034 0.13
NP_443064.1_6 Forward -397 -387 8.6886 0.276
NP_443064.1_8 Forward -153 -143 16.4991 0.189
NP_442337.1_6 Forward -59 -40 14.0322 0.245
NP_442578.1_7 Reverse -389 -396 6.0373 0.18
NP_440220.1_4 Forward -168 -149 1.27698 0.238
NP_441462.1_2 Forward -397 -387 10.4031 0.011
NP_441462.1_2 Reverse -388 -398 9.81313 0.0143
NP_443062.1_1 Forward -397 -379 9.521 0.133
NP_443062.1_1 Reverse -49 -67 4.93815 0.244
NP_440889.1_2 Forward -111 -92 10.6192 0.23
NP_440519.1_3 Reverse -67 -86 8.16093 0.285
NP_440911.1_9 Forward -341 -322 4.916 0.244
NP_442204.1_1 Reverse -384 -395 1.82863 0.266
NP_442204.1_2 Reverse -378 -397 6.09597 0.292
NP_442204.1_6 Forward -155 -136 7.37428 0.237
NP_441351.1_8 Reverse -144 -163 1.0811 0.276
NP_440454.1_2 Forward -93 -79 14.9084 0.193
NP_440516.1_2 Forward -112 -94 0.314141 0.233
NP_440516.1_8 Reverse -388 -397 16.9127 0.00442
NP_440516.1_8 Forward -397 -388 14.8477 0.00685
NP_442428.1_5 Reverse -389 -396 6.13563 0.209
NP_442428.1_5 Forward -396 -389 6.0373 0.212
NP_440673.1_2 Forward -156 -137 17.3158 0.0505
NP_440673.1_3 Forward -395 -388 12.4288 0.0426
NP_441052.1_2 Reverse -388 -398 10.4031 0.0285
NP_441052.1_2 Reverse -137 -147 4.20827 0.163
NP_441052.1_2 Reverse -289 -299 2.63497 0.197
NP_441052.1_2 Forward -397 -387 0.57002 0.256
NP_442219.1_8 Reverse -142 -161 6.91087 0.282
NP_442219.1_9 Reverse -389 -398 8.06287 0.0696
NP_442219.1_9 Forward -384 -375 1.86802 0.295
NP_440436.1_4 Reverse -389 -398 7.66912 0.124
NP_441884.1_9 Reverse -134 -153 -4.72043 0.0594
NP_442412.1_5 Reverse -124 -143 5.99764 0.294
NP_440314.1_9 Forward -396 -377 -5.21209 0.218
NP_441719.1_4 Reverse -389 -396 6.82395 0.0855
NP_441719.1_4 Forward -396 -389 6.52896 0.188
NP_442813.1_4 Reverse -81 -100 -6.49039 0.299
NP_442366.1_5 Forward -400 -390 12.0743 0.147
NP_442366.1_5 Reverse -373 -383 11.8776 0.156
NP_442873.1_5 Reverse -145 -164 9.63507 0.248
NP_440296.1_10 Reverse -134 -153 -11.7019 0.269
NP_442206.1_10 Forward -397 -382 3.81481 0.181
NP_441851.1_10 Forward -398 -388 5.97822 0.19
NP_442208.1_5 Reverse -324 -343 2.65439 0.248
NP_441273.1_1 Reverse -279 -298 12.7825 0.269
NP_442515.1_1 Forward -398 -384 3.73617 0.115
NP_440593.1_3 Forward -151 -132 1.37609 0.19
NP_440165.1_5 Forward -398 -379 -5.70374 0.226
NP_440432.1_7 Forward -295 -276 19.9606 0.0247
NP_440432.1_9 Forward -396 -381 -3.36336 0.179
NP_441062.1_4 Forward -338 -320 13.2938 0.27
NP_442843.1_1 Reverse -50 -69 -4.91709 0.239
NP_439960.1_10 Forward -156 -138 -1.55415 0.242
NP_442450.1_3 Forward -94 -76 11.5231 0.207
NP_440588.1_2 Reverse -134 -153 1.37609 0.138
NP_441031.1_1 Forward -23 -4 6.3407 0.274
NP_442006.1_2 Forward -155 -138 -14.1208 0.201
NP_441570.1_1 Reverse -120 -138 0.904127 0.0353
NP_441570.1_1 Reverse -169 -187 -13.3539 0.222
NP_441078.1_4 Reverse -388 -397 9.93116 0.0203
NP_441078.1_4 Forward -397 -388 9.83282 0.0226
NP_441078.1_4 Forward -146 -137 -1.37691 0.254
NP_441078.1_4 Reverse -137 -146 -1.47524 0.266
NP_442729.1_5 Forward -156 -146 8.33817 0.248
NP_441432.1_8 Reverse -387 -396 14.0611 0.0258
NP_441432.1_8 Forward -398 -389 6.98123 0.112
NP_442320.1_9 Forward -159 -145 11.701 0.257
NP_441732.1_2 Reverse -133 -149 -6.52964 0.0495
NP_441732.1_5 Reverse -147 -161 17.6008 0.119
NP_440629.1_4 Forward -327 -308 8.94757 0.26
NP_442510.1_2 Forward -166 -147 17.2074 0.2
NP_442489.1_7 Forward -397 -388 10.5211 0.0102
NP_442489.1_7 Reverse -388 -397 10.4228 0.0151
NP_442489.1_7 Forward -146 -137 -1.37691 0.195
NP_442489.1_7 Reverse -137 -146 -1.47524 0.203
NP_440757.1_9 Forward -79 -60 26.1555 0.0084
NP_440559.1_1 Reverse -389 -398 14.651 0.0144
NP_441659.2_8 Forward -397 -387 17.7779 0.00179
NP_441659.2_8 Reverse -388 -398 8.63316 0.0405
NP_442346.1_5 Reverse -387 -397 7.15819 0.178
NP_442346.1_5 Forward -398 -388 6.8632 0.188
NP_442346.1_5 Reverse -136 -146 6.46988 0.201
NP_442346.1_5 Forward -147 -137 5.38824 0.248
NP_440545.1_3 Reverse -133 -150 1.51381 0.118
NP_440545.1_3 Forward -49 -32 -3.79607 0.212
NP_440545.1_3 Forward -150 -133 -4.68105 0.23
NP_440545.1_3 Forward -274 -257 -4.97604 0.237
NP_440545.1_3 Reverse -148 -165 -6.54933 0.283
NP_440831.1_3 Forward -155 -136 11.6293 0.161
NP_441629.1_3 Forward -342 -323 -1.96793 0.268
NP_440486.1_9 Reverse -133 -147 17.4042 0.149
NP_440250.1_4 Reverse -75 -94 4.81688 0.253
NP_440010.1_10 Forward -158 -139 2.0644 0.29
NP_442551.1_4 Forward -148 -133 14.2379 0.0946
NP_442603.1_7 Reverse -289 -303 6.0955 0.259
NP_441050.1_7 Forward -145 -127 7.39397 0.269
NP_441158.1_3 Forward -362 -343 19.174 0.0431
NP_441833.1_4 Forward -396 -389 6.52896 0.0924
NP_441833.1_4 Reverse -389 -396 6.23397 0.163
NP_441895.1_9 Forward -360 -341 0.982764 0.0395
NP_442162.1_9 Forward -396 -389 12.9205 0.0282
NP_442162.1_9 Reverse -389 -396 12.9205 0.0282
NP_440671.1_1 Forward -26 -7 9.95922 0.191
NP_442199.1_5 Reverse -380 -399 -1.27885 0.18
NP_442140.1_3 Forward -154 -144 3.42162 0.297
NP_441609.1_1 Reverse -308 -327 2.0644 0.189
NP_440875.1_9 Forward -395 -385 7.69067 0.255
NP_441813.1_5 Reverse -386 -396 8.4365 0.0432
NP_441813.1_5 Forward -399 -389 5.48657 0.123
NP_442497.1_10 Forward -396 -387 7.76787 0.0731
NP_442497.1_10 Reverse -389 -398 0.688044 0.141
NP_440821.1_4 Forward -399 -389 -0.41329 0.257
NP_441239.1_9 Reverse -135 -147 9.87208 0.0941
NP_441239.1_9 Reverse -386 -398 3.2839 0.289
NP_440706.1_1 Forward -297 -278 1.67108 0.258
NP_441892.1_1 Forward -67 -50 -5.1727 0.275
NP_442399.1_4 Forward -97 -83 18.3978 0.271
NP_442193.1_1 Reverse -85 -103 10.9339 0.228
NP_441017.1_8 Forward -149 -134 8.82968 0.244
NP_442052.1_8 Reverse -135 -145 12.4681 0.268
NP_440546.1_4 Reverse -388 -398 11.0156 0.0991
NP_440546.1_4 Forward -397 -387 10.9186 0.101
NP_441230.1_6 Reverse -260 -279 11.4058 0.263
NP_440675.1_9 Forward -364 -350 19.3708 0.173
NP_440462.1_6 Reverse -386 -396 9.22315 0.049
NP_440868.1_4 Reverse -384 -396 7.4138 0.0691
NP_441204.1_1 Reverse -379 -398 19.6656 0.047
NP_440401.1_9 Forward -102 -95 14.5917 0.287
NP_442499.1_1 Reverse -138 -157 8.16093 0.203
NP_442402.1_10 Forward -227 -217 12.8609 0.204
NP_441084.1_6 Reverse -386 -400 16.2281 0.0689
NP_440653.1_10 Forward -146 -127 3.83436 0.261
NP_442039.1_4 Reverse -389 -396 11.6422 0.0747
NP_441811.1_8 Forward -391 -377 5.89945 0.289
NP_442837.1_3 Forward -396 -389 6.0373 0.25
NP_442837.1_3 Reverse -389 -396 6.0373 0.25
NP_440160.1_9 Reverse -131 -150 8.25926 0.269
NP_442053.1_1 Forward -397 -388 16.6177 0.00257
NP_442053.1_1 Reverse -388 -397 8.65285 0.0741
NP_440505.1_3 Reverse -386 -396 15.6147 0.0106
NP_441959.1_8 Reverse -11 -24 8.32366 0.296
NP_440207.2_7 Forward -128 -109 16.8141 0.238
NP_441408.2_7 Reverse -28 -47 -5.40875 0.294
NP_440914.1_1 Forward -397 -387 14.373 0.0158
NP_440914.1_1 Reverse -388 -398 13.3971 0.0303
NP_442470.1_3 Reverse -139 -158 8.75009 0.286
NP_441011.1_8 Forward -396 -387 6.78456 0.184
NP_442533.1_6 Forward -397 -388 14.2577 0.0132
NP_442533.1_6 Forward -146 -137 13.8644 0.0178
NP_442533.1_6 Reverse -388 -397 7.47288 0.0898
NP_442533.1_6 Reverse -137 -146 7.17789 0.0948
NP_442533.1_6 Forward -106 -97 4.62128 0.179
NP_441089.1_10 Reverse -377 -396 1.67108 0.294
NP_442541.1_10 Reverse -137 -151 11.7987 0.182
NP_441482.1_7 Reverse -382 -396 -6.98191 0.193
NP_441482.1_7 Reverse -332 -346 -10.8168 0.216
NP_442269.1_10 Reverse -377 -396 10.4225 0.176
NP_440116.1_5 Forward -400 -383 5.54538 0.176
NP_440115.1_6 Reverse -385 -395 4.79825 0.282
NP_441347.1_9 Forward -24 -11 12.0725 0.171
NP_441961.1_10 Reverse -348 -361 20.4715 0.164
NP_441602.1_3 Forward -353 -334 3.73603 0.17
NP_441106.1_1 Reverse -387 -396 8.75118 0.0469
NP_442249.1_10 Forward -159 -140 13.1758 0.257
NP_441286.1_1 Forward -398 -386 -3.89426 0.147
NP_441286.1_1 Reverse -387 -399 -5.95921 0.235
NP_440670.1_8 Reverse -388 -397 18.0926 0.00136
NP_440670.1_8 Forward -397 -388 15.831 0.00494
NP_439955.1_10 Forward -109 -90 14.1583 0.258
NP_440886.1_7 Forward -398 -388 6.66608 0.115
NP_440886.1_7 Forward -107 -97 4.60114 0.227
NP_440828.1_4 Reverse -136 -155 -5.60616 0.258
NP_442213.1_5 Reverse -91 -110 1.86774 0.239
NP_442295.1_4 Forward -366 -347 18.7637 0.276
NP_442022.1_4 Reverse -320 -339 11.0125 0.217
NP_440907.2_8 Forward -396 -386 7.84605 0.117
NP_442264.1_2 Forward -150 -133 9.67528 0.196
NP_441463.1_3 Reverse -378 -397 -9.047 0.276
NP_442842.1_4 Reverse -66 -85 3.93269 0.254
NP_442842.1_4 Reverse -108 -127 3.73603 0.257
NP_441626.1_2 Reverse -389 -396 12.2322 0.0511
NP_441626.1_2 Forward -269 -262 11.1505 0.0716
NP_441626.1_2 Forward -396 -389 5.93897 0.231
NP_442615.1_1 Reverse -379 -397 0.510803 0.101
NP_441962.1_4 Reverse -181 -200 -14.7502 0.293
NP_440387.1_1 Forward -397 -381 -2.39974 0.147
NP_441836.1_2 Forward -158 -139 4.03102 0.147
NP_441836.1_2 Forward -363 -344 -6.58872 0.3
NP_441993.1_1 Reverse -302 -321 2.92126 0.246
NP_440114.1_10 Forward -397 -383 10.9143 0.13
NP_441272.1_7 Reverse -90 -100 13.0581 0.274
NP_440293.1_3 Reverse -90 -109 4.32602 0.192
NP_441237.1_9 Reverse -389 -399 12.0747 0.139
NP_441246.1_6 Reverse -365 -383 7.19731 0.219
NP_440457.1_1 Reverse -384 -396 1.61227 0.232
NP_441984.1_3 Reverse -126 -144 10.4422 0.186
NP_442514.1_5 Reverse -380 -399 -9.73604 0.298
NP_440554.1_4 Forward -396 -386 15.0247 0.02
NP_442862.1_3 Forward -367 -350 8.20031 0.247
NP_442862.1_3 Forward -171 -154 4.26707 0.29
NP_441885.1_5 Reverse -388 -398 18.6629 0.00274
NP_441885.1_5 Forward -397 -387 1.55333 0.109
NP_442341.1_9 Reverse -386 -400 12.487 0.103
NP_441756.1_5 Forward -156 -137 -4.91709 0.297
NP_441756.1_5 Reverse -133 -152 -5.21209 0.299
NP_440119.1_1 Reverse -128 -144 2.71347 0.194
NP_443000.1_7 Reverse -386 -396 10.5998 0.0345
NP_443000.1_7 Forward -399 -389 0.471689 0.298
NP_442513.1_5 Forward -154 -135 7.66846 0.276
NP_441842.1_10 Reverse -381 -395 7.47274 0.257
NP_440275.1_3 Reverse -386 -396 13.5497 0.0268
NP_441183.1_2 Forward -315 -305 16.8278 0.245
NP_442354.1_2 Reverse -324 -343 8.65258 0.257
NP_442275.1_1 Forward -155 -136 3.6377 0.281
NP_442451.1_2 Forward -356 -337 -10.227 0.265
NP_439962.1_4 Reverse -135 -154 -9.14533 0.299
NP_440175.1_7 Reverse -82 -100 11.6077 0.23
NP_440804.1_7 Forward -25 -8 11.8378 0.175
NP_440149.1_8 Reverse -120 -139 -7.57203 0.288
NP_441105.1_3 Forward -151 -132 -9.53865 0.29
NP_440216.1_1 Forward -397 -383 4.71948 0.0236
NP_440172.1_1 Forward -397 -387 14.6313 0.011
NP_440172.1_1 Reverse -388 -398 5.28991 0.146
NP_442015.1_10 Reverse -133 -146 -1.16069 0.297
NP_441226.1_7 Reverse -389 -396 12.7234 0.0312
NP_441226.1_7 Forward -396 -389 11.5435 0.0757
NP_441226.1_7 Forward -105 -98 5.34865 0.289
NP_442446.1_3 Forward -302 -283 12.3892 0.223
NP_441111.1_7 Reverse -389 -397 8.96754 0.0463
NP_441111.1_7 Forward -396 -388 8.86921 0.0589
NP_441766.1_2 Forward -397 -388 13.9627 0.0114
NP_441766.1_2 Reverse -388 -397 7.76787 0.0714
NP_441766.1_9 Forward -154 -135 7.86593 0.144
NP_442417.1_5 Forward -397 -383 5.40779 0.263
NP_440072.1_5 Reverse -319 -337 -0.570838 0.244
NP_442552.1_2 Reverse -143 -162 18.4857 0.0769
NP_442154.1_1 Reverse -324 -342 -13.4522 0.217
NP_442154.1_1 Forward -163 -145 -15.5171 0.22
NP_442564.1_10 Reverse -144 -158 13.8643 0.244
NP_440261.1_5 Reverse -138 -151 -4.7006 0.165
NP_440261.1_5 Forward -396 -383 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGCCGATCGCCTGAATGATCCCCAAACCATTATTTTGTTGCAGCAGTTGTTAGAATCCGCCCGGGCTGCCACCCAGAACCTAGAAAAAATCACTTCCGATGTGGATCAACTCACCGGTAATCCAGCTTTGCGAGAGCAGTTAATTCGTCTTATTCAAGGACTAAGTAATTTGGTTTCCACCACAGAACATCTGACGAAACAGGTGCAATATGCCCAGCAATTAAATCAACTTTCCGATGATTTGGCCCTGGTGGCCAGGGCCCAGGAATTGCAAACTCCTAGAGTTATTCCCGCCCAACCCCAAAAAACCGTCACAAAACCTTAGGAAACCCCTAAAATTAGCCTTCGAGGTGTGCCATATCAATCACCTGAATTATTAAGTTTAATTACCTTTACCC

CDS

ATGACTGCCGTACCCCCATCCTGCCAAATCCTTGACGGTAAAGCCCTCGCCCAAAAAATGCAGGGGGAATTACAACGGGACATTGCCCAACTGGTGGCCCAGGGCCATCGATCGCCGGGGTTGGCGGTGTTGATGGTGGGGGACAATCCAGCCAGTGCCGTTTATGTCCGCAATAAGGAAAAAGCCTGTGAAAAATTGGGCATGGTTTCCTTTGGCAAGCATTTTTCCGCTGATACGGACCAGGAAACATTGACGGCGGCGATCGCCAGTTTGAATGAGGATGAACGGGTGGATGGCATTTTGGTGCAATTGCCCCTACCGGATCATCTCGATGCAGTCAAACTATTACACACCATTGATCCCAGTAAAGATGCAGACGGGTTGCATCCAGTCAATTTGGGTCATTTGGTGCGGGGAGAAGAGGGTCTAAGGAGTTGTACTCCAGCGGGGGTGATGGCTCTATTGGCGGAATATAACCTTGATTTAACGGGCAAAAATGCGGTGGTGTTGGGGCGCAGTATTTTGGTGGGCAAACCCCTGGCTCTAATGTTGCTAGAGAAAAATTGCACCGTTACCATTGCCCATTCTCGCACCCAAAACTTGGCCGATATCACCCGGCAAGCAGACATCCTCGTAGCGGCGATCGGTAAGCCGGAATTTGTCACCGCCGATATGGTCAAACCAGGGGCAATCGTGGTGGATGTGGGTATTAACCGTCTTGATTTAGGAGAGGGGAAATCGACACTGGTGGGGGACGTGGATTTTGCGGGGGTTGCGCCCGTGGCCAGTTACCTCACCCCTGTGCCCGGTGGCATTGGCCCCATGACGGTGACTCTGTTGTTAGCTAACACTGTGGCTAGTTATCGGCAACGGTTAGGTATTTAA

Protein

MTAVPPSCQILDGKALAQKMQGELQRDIAQLVAQGHRSPGLAVLMVGDNPASAVYVRNKEKACEKLGMVSFGKHFSADTDQETLTAAIASLNEDERVDGILVQLPLPDHLDAVKLLHTIDPSKDADGLHPVNLGHLVRGEEGLRSCTPAGVMALLAEYNLDLTGKNAVVLGRSILVGKPLALMLLEKNCTVTIAHSRTQNLADITRQADILVAAIGKPEFVTADMVKPGAIVVDVGINRLDLGEGKSTLVGDVDFAGVAPVASYLTPVPGGIGPMTVTLLLANTVASYRQRLGI