Your browser is old and dusty. Try Google Chrome!

Details for sll0749

ORF sll0749
Accession NP_442074.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -371 -357 -0.0987402 0.221
NP_442151.1_6 Forward -124 -110 8.75105 0.164
NP_440996.1_2 Reverse -192 -201 14.8477 0.248
NP_442287.1_1 Forward -152 -142 14.6309 0.256
NP_441812.1_3 Forward -361 -347 11.996 0.21
NP_441812.1_3 Forward -60 -46 7.9644 0.254
NP_442118.1_1 Forward -213 -194 13.2741 0.252
NP_440061.1_9 Forward -221 -207 12.192 0.0999
NP_440928.1_5 Forward -250 -232 6.31233 0.269
NP_441054.1_2 Reverse -141 -160 9.73422 0.284
NP_442074.1_2 Forward -107 -89 20.9636 0.0881
NP_442074.1_3 Forward -75 -62 19.4882 0.178
NP_442074.1_7 Forward -179 -163 19.0364 0.248
NP_441035.1_3 Forward -71 -52 -0.983855 0.298
NP_440853.1_5 Reverse -112 -131 17.994 0.0907
NP_440049.1_2 Reverse -255 -274 6.98095 0.148
NP_441935.1_9 Reverse -156 -175 21.915 0.0647
NP_440893.1_3 Forward -220 -201 12.88 0.262
NP_442196.1_10 Reverse -221 -240 11.8975 0.224
NP_442110.1_7 Reverse -363 -377 1.86788 0.222
NP_441082.1_10 Reverse -79 -92 9.06573 0.257
NP_442726.1_7 Forward -252 -234 2.28076 0.225
NP_441925.1_4 Forward -318 -299 -16.8158 0.285
NP_440856.1_4 Forward -328 -309 -5.31042 0.285
NP_441558.1_5 Reverse -234 -253 7.37428 0.182
NP_442111.1_4 Forward -339 -325 5.1128 0.176
NP_441387.1_2 Reverse -116 -135 10.2259 0.282
NP_440343.1_9 Forward -355 -336 10.5209 0.243
NP_441486.1_1 Forward -154 -140 0.0979218 0.145
NP_441667.1_1 Forward -266 -251 15.1643 0.284
NP_440842.1_6 Reverse -340 -359 12.7816 0.242
NP_441014.1_5 Reverse -232 -250 9.0656 0.287
NP_441012.1_4 Forward -128 -115 5.91914 0.286
NP_443018.1_3 Forward -359 -352 10.2655 0.107
NP_440376.1_1 Forward -245 -236 5.50626 0.131
NP_440376.1_1 Reverse -363 -372 3.04799 0.21
NP_440376.1_1 Reverse -142 -151 2.06468 0.236
NP_440376.1_1 Reverse -141 -150 0.589713 0.267
NP_442687.1_7 Forward -246 -236 5.19158 0.217
NP_442485.1_3 Reverse -340 -359 -4.6221 0.285
NP_442485.1_3 Forward -371 -352 -5.60541 0.293
NP_441422.1_7 Forward -94 -77 -9.3026 0.297
NP_441950.1_7 Reverse -86 -105 0.982764 0.175
NP_442198.1_3 Forward -297 -278 5.40766 0.259
NP_440141.1_8 Reverse -201 -220 5.50599 0.273
NP_440141.1_9 Forward -387 -368 -2.65548 0.276
NP_442937.1_5 Reverse -300 -319 6.68596 0.272
NP_442321.1_4 Reverse -326 -345 -5.50708 0.284
NP_439905.1_1 Forward -218 -205 8.08242 0.238
NP_440984.1_7 Reverse -113 -127 6.09611 0.227
NP_440153.1_6 Reverse -114 -133 11.9958 0.222
NP_442536.1_7 Forward -344 -325 10.8159 0.273
NP_440827.1_3 Forward -371 -352 12.4875 0.247
NP_442002.1_9 Reverse -209 -216 11.3472 0.185
NP_441646.1_1 Forward -252 -233 11.1109 0.105
NP_441646.1_7 Forward -129 -115 13.9626 0.257
NP_441110.1_1 Reverse -282 -301 4.42435 0.296
NP_441041.1_4 Forward -366 -347 -10.0303 0.227
NP_440437.1_1 Forward -133 -114 -3.73712 0.244
NP_442012.1_1 Reverse -112 -131 -0.000545616 0.249
NP_442501.1_2 Forward -379 -360 1.17943 0.222
NP_442215.1_2 Forward -153 -137 -6.33298 0.268
NP_442177.1_5 Reverse -81 -95 13.1759 0.22
NP_442075.1_3 Reverse -189 -208 15.6341 0.232
NP_442142.1_4 Reverse -348 -361 6.80355 0.154
NP_442142.1_4 Forward -363 -350 2.37867 0.294
NP_442301.1_2 Forward -315 -296 3.9319 0.284
NP_441371.1_3 Forward -208 -190 5.23069 0.292
NP_441020.2_6 Reverse -234 -251 8.20031 0.205
NP_441673.1_1 Reverse -236 -245 -7.76842 0.168
NP_441673.1_1 Forward -245 -236 -8.06341 0.254
NP_441330.1_1 Reverse -225 -244 -14.0619 0.212
NP_442868.1_6 Reverse -116 -126 5.38824 0.149
NP_441251.1_5 Reverse -72 -91 12.6841 0.289
NP_442427.1_8 Reverse -201 -220 8.16093 0.203
NP_442808.1_1 Forward -94 -84 1.65123 0.282
NP_442903.1_2 Forward -106 -87 5.0129 0.199
NP_442789.1_4 Reverse -91 -110 -8.45701 0.299
NP_441878.1_6 Forward -246 -236 0.766681 0.134
NP_441878.1_6 Reverse -235 -245 -6.8048 0.196
NP_441878.1_6 Reverse -141 -151 -7.19813 0.21
NP_441557.1_8 Forward -296 -286 11.9759 0.236
NP_442777.1_1 Forward -367 -348 4.03023 0.3
NP_440440.1_1 Reverse -342 -361 11.995 0.168
NP_441574.1_1 Forward -372 -353 6.88262 0.11
NP_442998.1_10 Forward -364 -357 3.97235 0.297
NP_440299.1_1 Forward -249 -236 5.23026 0.184
NP_442201.1_2 Reverse -156 -175 20.352 0.135
NP_440087.1_1 Reverse -279 -298 -4.6221 0.246
NP_441559.1_8 Reverse -331 -345 -5.40861 0.261
NP_440915.1_3 Reverse -231 -250 17.2074 0.137
NP_441866.1_6 Reverse -309 -328 6.58682 0.285
NP_441464.1_10 Reverse -82 -96 10.0294 0.262
NP_440677.1_1 Forward -136 -117 7.27595 0.241
NP_442386.1_9 Forward -152 -143 6.29249 0.226
NP_442386.1_9 Forward -60 -51 4.62087 0.294
NP_440570.1_5 Reverse -347 -366 2.0644 0.234
NP_441750.1_4 Forward -263 -244 5.60432 0.185
NP_440168.1_4 Reverse -347 -366 1.67108 0.22
NP_440327.1_6 Reverse -130 -149 9.73422 0.206
NP_440327.1_6 Reverse -79 -98 2.94938 0.285
NP_440586.1_8 Forward -359 -352 9.08521 0.178
NP_439937.1_9 Forward -105 -88 -11.7615 0.264
NP_439937.1_9 Reverse -334 -351 -11.9582 0.269
NP_439937.1_9 Forward -289 -272 -15.0064 0.287
NP_441803.1_2 Forward -377 -358 -0.885524 0.291
NP_442384.1_10 Reverse -236 -249 4.73917 0.148
NP_441877.1_7 Reverse -267 -286 6.58682 0.218
NP_441877.1_7 Reverse -231 -250 2.55527 0.225
NP_442262.1_10 Forward -359 -352 9.18389 0.211
NP_440344.1_10 Forward -134 -117 -11.4659 0.215
NP_440282.1_10 Reverse -40 -59 -8.55534 0.263
NP_441965.1_10 Forward -62 -46 10.5799 0.107
NP_441640.1_8 Forward -365 -346 -5.9004 0.292
NP_442693.1_6 Forward -93 -74 -0.983855 0.297
NP_440350.1_5 Reverse -12 -31 -5.31042 0.289
NP_440990.1_10 Reverse -279 -298 13.7658 0.293
NP_440999.1_1 Reverse -340 -359 7.66846 0.157
NP_440888.1_2 Forward -245 -231 10.8154 0.0842
NP_442277.1_2 Forward -220 -206 11.0127 0.287
NP_442277.1_4 Reverse -227 -246 4.81688 0.184
NP_440575.1_8 Reverse -194 -213 -4.22878 0.265
NP_442818.1_3 Reverse -144 -161 -4.38605 0.243
NP_441759.1_2 Reverse -343 -362 -0.787193 0.281
NP_441551.1_5 Forward -63 -47 6.35103 0.273
NP_441319.1_8 Reverse -351 -369 5.72234 0.277
NP_441469.1_8 Forward -345 -336 8.84951 0.227
NP_442315.1_2 Reverse -86 -98 9.47875 0.291
NP_441462.1_2 Forward -245 -235 -0.609952 0.24
NP_442204.1_1 Reverse -232 -243 1.63197 0.267
NP_440516.1_6 Forward -218 -204 6.29216 0.3
NP_440516.1_8 Reverse -357 -366 -0.196935 0.185
NP_442120.1_10 Forward -372 -353 -9.24366 0.242
NP_442120.1_10 Reverse -357 -376 -12.2919 0.27
NP_442823.1_9 Reverse -250 -269 13.999 0.277
NP_440603.1_3 Reverse -53 -72 6.19431 0.265
NP_441052.1_2 Forward -124 -114 2.14332 0.216
NP_442854.1_6 Forward -251 -232 3.04771 0.272
NP_440328.1_8 Forward -248 -229 16.4937 0.249
NP_443054.1_2 Reverse -234 -248 2.85119 0.24
NP_441851.1_10 Reverse -141 -151 4.99491 0.233
NP_441349.1_10 Forward -348 -329 -9.53865 0.294
NP_442843.1_1 Reverse -143 -162 -11.0136 0.285
NP_442843.1_6 Reverse -144 -163 3.6377 0.29
NP_439960.1_4 Forward -361 -342 16.2232 0.153
NP_442006.1_2 Reverse -230 -247 -15.7924 0.228
NP_442243.1_1 Reverse -230 -248 7.09821 0.178
NP_441078.1_4 Reverse -236 -245 -1.47524 0.266
NP_442729.1_6 Reverse -245 -263 15.8575 0.289
NP_442729.1_7 Forward -391 -373 16.9321 0.183
NP_441663.1_8 Reverse -282 -301 0.0977854 0.223
NP_441732.1_2 Forward -376 -360 -7.51295 0.0859
NP_441732.1_2 Forward -131 -115 -16.3627 0.165
NP_441732.1_2 Reverse -353 -369 -17.2477 0.247
NP_440760.1_1 Reverse -236 -255 -20.3551 0.222
NP_442353.1_4 Forward -133 -114 -0.689632 0.29
NP_443011.1_4 Forward -361 -342 9.63589 0.217
NP_440713.1_4 Reverse -353 -372 8.45592 0.17
NP_442489.1_7 Reverse -236 -245 -0.983583 0.178
NP_440565.1_7 Reverse -352 -371 -2.36049 0.3
NP_441659.2_8 Forward -245 -235 6.37155 0.0774
NP_442913.1_9 Forward -287 -268 10.4225 0.216
NP_442346.1_5 Reverse -114 -124 4.3066 0.291
NP_440545.1_3 Forward -249 -232 0.137172 0.144
NP_441856.1_7 Forward -360 -341 8.94757 0.292
NP_441888.1_9 Reverse -142 -161 14.7509 0.267
NP_442799.1_4 Forward -341 -322 8.45592 0.268
NP_442140.1_3 Reverse -51 -61 4.99491 0.232
NP_441239.1_9 Forward -61 -49 10.7571 0.0723
NP_440665.1_1 Reverse -345 -364 -11.5053 0.244
NP_442193.1_1 Reverse -290 -308 9.0656 0.258
NP_441017.1_6 Forward -43 -29 12.3887 0.221
NP_441617.1_6 Reverse -84 -103 -7.4737 0.292
NP_441603.1_8 Forward -210 -191 15.9282 0.205
NP_440868.1_4 Reverse -26 -38 2.49725 0.153
NP_440401.1_9 Forward -147 -140 12.6251 0.287
NP_440401.1_9 Forward -96 -89 12.6251 0.287
NP_441848.1_7 Forward -159 -140 -4.32786 0.289
NP_441084.1_6 Reverse -48 -62 13.6102 0.125
NP_440505.1_3 Reverse -355 -365 10.2065 0.114
NP_440505.1_3 Reverse -139 -149 9.91146 0.122
NP_442533.1_6 Reverse -236 -245 4.32629 0.184
NP_442533.1_6 Forward -372 -363 2.55633 0.25
NP_442533.1_6 Forward -124 -115 2.458 0.255
NP_442588.1_6 Forward -363 -344 5.60432 0.175
NP_001035870.1_3 Reverse -19 -38 1.47442 0.163
NP_001035870.1_3 Reverse -79 -98 -4.6221 0.278
NP_442306.1_3 Forward -340 -321 13.4708 0.216
NP_442306.1_10 Reverse -231 -250 -20.5517 0.213
NP_442306.1_10 Reverse -45 -64 -20.8467 0.231
NP_440886.1_7 Forward -367 -357 5.19112 0.194
NP_442072.1_9 Forward -246 -228 -22.9903 0.271
NP_442072.1_9 Reverse -90 -108 -23.2853 0.288
NP_441069.1_5 Reverse -232 -250 11.7205 0.0843
NP_441463.1_3 Forward -69 -50 -10.522 0.296
NP_441901.1_9 Forward -362 -343 10.9142 0.19
NP_440387.1_1 Reverse -357 -373 2.61514 0.0763
NP_440387.1_1 Reverse -236 -252 -5.448 0.232
NP_441193.1_1 Forward -105 -86 9.63507 0.277
NP_441993.1_1 Forward -251 -232 1.94669 0.267
NP_441174.1_2 Reverse -47 -61 14.6509 0.156
NP_441174.1_4 Reverse -283 -293 13.5497 0.267
NP_442698.1_10 Forward -173 -154 -1.27885 0.297
NP_442323.1_7 Forward -92 -73 3.63691 0.238
NP_440766.1_4 Reverse -79 -93 2.85119 0.167
NP_440766.1_4 Forward -337 -323 2.5562 0.179
NP_440766.1_5 Reverse -374 -386 6.70087 0.294
NP_439988.1_3 Reverse -365 -379 9.34103 0.249
NP_441311.1_2 Forward -378 -364 17.9935 0.229
NP_440457.1_1 Reverse -353 -365 -1.23932 0.3
NP_441801.1_6 Forward -153 -134 15.0432 0.137
NP_441984.1_3 Reverse -232 -250 5.42735 0.286
NP_440473.1_9 Reverse -286 -305 -6.98204 0.236
NP_441885.1_5 Forward -372 -362 -1.49493 0.264
NP_440275.1_3 Reverse -116 -126 4.0116 0.205
NP_443046.1_9 Forward -35 -17 14.3747 0.116
NP_443046.1_9 Forward -107 -89 1.5917 0.295
NP_442214.1_1 Reverse -72 -91 11.6025 0.226
NP_442015.1_10 Reverse -232 -245 -0.669033 0.277
NP_442015.1_10 Forward -131 -118 -1.06236 0.293
NP_441226.1_7 Forward -150 -143 8.29857 0.205
NP_441226.1_7 Forward -371 -364 5.93863 0.266
NP_440416.1_9 Forward -304 -285 -17.1101 0.231
NP_442403.1_10 Reverse -229 -248 13.3725 0.222
NP_441430.1_6 Reverse -358 -377 13.0775 0.2
NP_440261.1_5 Forward -218 -205 -6.47056 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTTCCCAATGGACATTTTGTGCCCCTAGGCGGACCCTACCGCCATGGAGTTGTTGGGACATGCCGCTCAAATCGGTGAAAGGAACACACAACACCACCTCACGACTTTCCGCCGCATCTTCGATTAAAGGTTTAAACCCCTGCAAAAACGCTTGGGCCTCCGCCTGCGTCTTATGCATTTTCCAATTGCCCGCAATAATGATTTTTCGCACGATTCCAATCTTTAACGATGAAGGTCACAACAAAATTTGCCAACCCCCAGTTTACGTCGTCCGGGGTCGTCACCATTAACCAACGAGGAACTAACCCCCAAACTCAACTGCTTGAAGCCGAATTAATGCCGCCCTGGCTTTCAATCTAGTCCAATCGAGAAGATAAACTGGAATTAGTTCCGGCACTG

CDS

GTGGAAAAAATCATGAGCGAACAAAAATCATCTTCGTCCCTGACCGGCTTTGCTCTGGCCGCTCTGATGGTGGCATTGGTTGGCACCGGCTTTGCCTTCTGGACTGGATTTAATCTTTCCCAACGTTCCCCCACGGTCACAGTGGACCCCGATAAGCCCGACAAGGCCGTCCCTGGGCAAGCACAAATTTACTGGCTTAACAACAATGACACGGCGATCGCCTTTGTGCCCCAAAACATTCCCCCCAACAATGATCCACCAGAAGTACAGACGGAACGAGCCCTGAAAACCCTATTAGCCGCTCCTGACAGCGACATTTCCGCCATTCCCCCCAATACCAGCCTTCTGAGCCTCACCAAAACCGCCACCGGCATCAACGTTGACCTATCAGCCCAATTCACCGCAGGGGGAGGGAGTCAAAGTATGATTGCCAGACTGGGACAAATTATTTACACCGCTACCAGTACAGACCCCAATCTTCCTGTTCGTTTACTAGTGGAGGGAGAACCTCTAACAGTACTAGGAGGAGAAGGGTTAATGATTGCCCAGCCCATCACCCGCAAGCAATTTGAAACGGATTTTATGCCCCCTGATCGTTGA

Protein

MEKIMSEQKSSSSLTGFALAALMVALVGTGFAFWTGFNLSQRSPTVTVDPDKPDKAVPGQAQIYWLNNNDTAIAFVPQNIPPNNDPPEVQTERALKTLLAAPDSDISAIPPNTSLLSLTKTATGINVDLSAQFTAGGGSQSMIARLGQIIYTATSTDPNLPVRLLVEGEPLTVLGGEGLMIAQPITRKQFETDFMPPDR