Your browser is old and dusty. Try Google Chrome!

Details for sll0738

ORF sll0738
Accession NP_442706.1
Symbol
Category molybdate-binding periplasmic protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -39 -25 9.5377 0.0722
NP_440795.1_7 Forward -39 -32 14.6904 0.0123
NP_440795.1_7 Reverse -32 -39 14.6904 0.0123
NP_441418.1_6 Reverse -216 -235 -30.7781 0.296
NP_442291.1_5 Reverse -30 -46 1.04184 0.154
NP_441453.1_4 Reverse -31 -39 16.539 0.00633
NP_441453.1_4 Forward -40 -32 16.539 0.00633
NP_442151.1_6 Forward -40 -26 8.75105 0.164
NP_441818.1_1 Reverse -32 -43 8.80962 0.277
NP_441818.1_9 Reverse -160 -179 -4.03212 0.234
NP_441818.1_9 Reverse -216 -235 -7.17871 0.27
NP_440226.1_1 Reverse -31 -50 17.5024 0.0184
NP_441630.1_3 Reverse -23 -42 -1.18052 0.293
NP_442655.1_2 Reverse -157 -176 17.5024 0.0267
NP_442173.1_1 Forward -39 -31 15.4574 0.00633
NP_442173.1_1 Reverse -32 -40 15.4574 0.00633
NP_442752.1_4 Forward -40 -33 13.8055 0.0199
NP_442752.1_4 Reverse -31 -38 13.8055 0.0199
NP_443027.1_4 Forward -42 -32 13.2547 0.0521
NP_442975.1_10 Forward -44 -30 3.34225 0.259
NP_442975.1_10 Reverse -27 -41 1.37564 0.299
NP_440784.1_7 Forward -39 -32 15.9687 0.0123
NP_440784.1_7 Reverse -32 -39 15.9687 0.0123
NP_442909.1_7 Forward -39 -25 7.66879 0.208
NP_440061.1_9 Reverse -29 -43 13.7653 0.076
NP_440061.1_9 Forward -42 -28 9.24208 0.149
NP_440110.1_4 Reverse -20 -39 3.73603 0.215
NP_442062.1_8 Forward -40 -30 17.3846 0.00193
NP_442062.1_8 Reverse -31 -41 10.3048 0.0493
NP_442062.1_8 Reverse -290 -300 8.33817 0.0769
NP_442062.1_8 Reverse -174 -184 3.61828 0.26
NP_440761.1_4 Reverse -155 -174 -13.2752 0.257
NP_440304.1_4 Forward -42 -32 10.8948 0.051
NP_440304.1_4 Reverse -29 -39 1.84832 0.299
NP_442242.1_4 Forward -39 -32 14.3954 0.0124
NP_442242.1_4 Reverse -32 -39 14.3954 0.0124
NP_440044.1_1 Forward -381 -362 10.8159 0.284
NP_440916.1_1 Forward -143 -129 10.9143 0.206
NP_439918.1_2 Reverse -302 -321 3.14605 0.188
NP_439918.1_2 Forward -213 -194 0.58944 0.225
NP_439918.1_3 Reverse -28 -47 2.94938 0.271
NP_441619.1_8 Reverse -25 -39 18.3868 0.061
NP_441208.1_1 Reverse -166 -185 -6.29373 0.287
NP_441208.1_9 Reverse -28 -42 7.57108 0.221
NP_442110.1_7 Reverse -160 -174 0.196253 0.266
NP_441082.1_10 Reverse -161 -174 20.0788 0.0532
NP_441082.1_10 Reverse -358 -371 17.6205 0.137
NP_440856.1_4 Forward -47 -28 9.24257 0.0576
NP_441083.1_5 Forward -40 -30 20.3345 0.00053
NP_441083.1_5 Reverse -31 -41 11.2881 0.0159
NP_442841.1_10 Forward -41 -22 9.14423 0.298
NP_441738.1_2 Forward -38 -31 15.28 0.0102
NP_441738.1_2 Reverse -33 -40 15.28 0.0102
NP_441738.1_2 Reverse -158 -165 8.1019 0.204
NP_441558.1_5 Forward -42 -23 5.40766 0.251
NP_440209.1_1 Reverse -31 -39 18.1123 0.00295
NP_440209.1_1 Forward -40 -32 18.1123 0.00295
NP_440209.1_2 Reverse -349 -365 10.8749 0.251
NP_442889.1_8 Forward -43 -29 11.4053 0.0733
NP_440410.1_10 Forward -316 -297 4.12936 0.247
NP_441713.1_1 Reverse -25 -44 -5.11376 0.113
NP_442706.1_5 Forward -32 -13 24.0119 0.00615
NP_442706.1_10 Forward -223 -205 25.1919 0.00734
NP_441716.1_1 Reverse -31 -45 13.7659 0.0689
NP_442111.1_4 Reverse -30 -44 18.5841 0.00633
NP_441624.1_7 Reverse -204 -218 8.94771 0.23
NP_440343.1_3 Forward -321 -303 3.45998 0.278
NP_440906.1_5 Forward -39 -32 15.8704 0.0124
NP_440906.1_5 Reverse -32 -39 15.8704 0.0124
NP_441209.1_8 Forward -367 -349 9.89671 0.217
NP_440747.1_10 Reverse -28 -40 14.887 0.00223
NP_440747.1_10 Forward -43 -31 7.4138 0.00422
NP_441130.1_10 Reverse -29 -43 7.57108 0.155
NP_442973.1_5 Reverse -22 -41 12.2908 0.206
NP_441486.1_1 Forward -43 -29 6.09611 0.0344
NP_441486.1_1 Reverse -28 -42 -2.45868 0.175
NP_442145.1_4 Reverse -8 -27 5.20389 0.259
NP_442634.1_2 Forward -46 -27 1.37609 0.287
NP_442634.1_4 Forward -42 -28 -1.8687 0.149
NP_441695.1_4 Forward -99 -81 17.7187 0.119
NP_441695.1_8 Reverse -198 -212 9.83269 0.296
NP_442848.1_5 Forward -384 -366 0.0191479 0.276
NP_443018.1_3 Forward -39 -32 14.8871 0.0123
NP_443018.1_3 Reverse -32 -39 14.8871 0.0123
NP_441634.1_8 Reverse -29 -43 -3.93365 0.295
NP_440376.1_1 Forward -40 -31 19.4693 0.000692
NP_440376.1_1 Reverse -31 -40 19.4693 0.000692
NP_440376.1_1 Forward -214 -205 -0.295266 0.286
NP_441588.1_4 Forward -38 -28 15.9097 0.0369
NP_443065.1_8 Reverse -333 -352 19.469 0.0743
NP_442687.1_7 Forward -41 -31 9.02648 0.0994
NP_442687.1_7 Reverse -30 -40 8.92815 0.0994
NP_442687.1_7 Reverse -239 -249 4.10993 0.266
NP_442191.1_4 Reverse -32 -46 14.3866 0.101
NP_441846.1_10 Reverse -87 -106 -21.9284 0.257
NP_440642.1_10 Reverse -141 -155 3.93223 0.264
NP_440642.1_10 Forward -109 -95 1.27731 0.296
NP_441013.1_2 Forward -372 -354 -4.99573 0.299
NP_440667.1_8 Forward -174 -155 16.3215 0.188
NP_440360.1_10 Forward -181 -167 3.63784 0.227
NP_442658.1_1 Forward -42 -32 14.2375 0.0237
NP_442658.1_1 Forward -301 -291 8.92768 0.172
NP_442658.1_1 Reverse -29 -39 6.76441 0.214
NP_440141.1_8 Reverse -82 -101 4.81767 0.28
NP_442205.1_9 Forward -46 -30 -2.98973 0.277
NP_441414.1_9 Forward -40 -21 17.0107 0.00979
NP_441414.1_9 Reverse -31 -50 -10.1286 0.277
NP_440800.1_1 Reverse -243 -262 13.47 0.299
NP_441487.1_6 Forward -48 -29 -2.0655 0.286
NP_441487.1_7 Reverse -298 -317 7.96426 0.238
NP_441958.1_5 Forward -41 -31 21.2195 0.000805
NP_441958.1_5 Reverse -30 -40 12.2714 0.00183
NP_440450.1_7 Reverse -198 -212 17.1085 0.183
NP_442836.1_10 Reverse -166 -176 14.3364 0.212
NP_439905.1_1 Reverse -32 -45 9.16406 0.221
NP_439905.1_1 Forward -322 -309 6.60746 0.283
NP_440984.1_7 Reverse -26 -40 11.0127 0.122
NP_439990.1_5 Reverse -26 -39 7.6891 0.186
NP_442911.1_2 Forward -50 -31 -1.08219 0.0811
NP_442911.1_2 Reverse -21 -40 -4.52377 0.136
NP_441580.1_6 Reverse -270 -289 1.86774 0.117
NP_441580.1_6 Forward -340 -321 -3.54046 0.235
NP_440153.1_5 Reverse -32 -46 5.50613 0.191
NP_441941.1_4 Forward -286 -267 10.7175 0.23
NP_442064.1_1 Reverse -26 -45 -1.86883 0.146
NP_443055.1_3 Forward -49 -30 10.5496 0.288
NP_443055.1_6 Forward -183 -165 10.0481 0.131
NP_440471.1_3 Reverse -212 -226 15.7325 0.282
NP_441099.1_5 Reverse -21 -40 -11.6036 0.287
NP_440809.1_9 Forward -49 -31 2.18243 0.118
NP_441294.1_7 Forward -44 -30 19.1375 0.00332
NP_441646.1_1 Reverse -24 -43 7.86593 0.152
NP_442438.1_10 Reverse -166 -180 -1.18038 0.296
NP_441292.1_2 Forward -51 -32 -11.8986 0.296
NP_441000.1_6 Reverse -30 -44 4.62115 0.0946
NP_440605.1_4 Forward -50 -31 14.0562 0.243
NP_442771.1_1 Reverse -172 -190 -6.1757 0.168
NP_440484.1_3 Forward -42 -28 12.1926 0.242
NP_440147.1_4 Reverse -29 -42 18.4072 0.00407
NP_440147.1_4 Forward -42 -29 10.344 0.0355
NP_441550.1_8 Forward -42 -32 15.8108 0.0132
NP_441550.1_8 Reverse -29 -39 14.6309 0.0132
NP_441331.1_5 Forward -292 -273 13.6666 0.294
NP_441916.1_7 Reverse -31 -41 18.9579 0.00144
NP_441916.1_7 Forward -40 -30 10.3048 0.0261
NP_441916.1_7 Forward -183 -173 1.74999 0.275
NP_441041.1_4 Reverse -308 -327 -12.5869 0.269
NP_441041.1_7 Forward -43 -31 7.32042 0.169
NP_442396.1_5 Reverse -27 -40 21.1604 0.00421
NP_440703.1_9 Forward -372 -359 10.1468 0.208
NP_441725.1_5 Forward -39 -29 2.04498 0.115
NP_441725.1_5 Reverse -32 -42 1.94665 0.115
NP_439966.1_7 Forward -42 -32 14.3359 0.0203
NP_439966.1_7 Reverse -29 -39 7.25606 0.15
NP_439966.1_9 Reverse -163 -172 4.12963 0.253
NP_442941.1_3 Reverse -32 -42 19.2529 0.00262
NP_442941.1_3 Forward -39 -29 11.0914 0.0116
NP_440289.1_2 Forward -43 -30 3.26421 0.0811
NP_440983.1_5 Forward -180 -161 3.83436 0.194
NP_441514.1_6 Reverse -131 -138 14.2971 0.248
NP_441678.1_9 Forward -56 -37 -5.31042 0.297
NP_442281.1_1 Reverse -26 -40 8.94708 0.0747
NP_441334.1_7 Reverse -29 -48 -20.945 0.284
NP_440177.1_9 Reverse -23 -42 12.7825 0.229
NP_442256.1_2 Reverse -29 -47 -8.04399 0.217
NP_442256.1_2 Forward -42 -24 -8.14232 0.217
NP_440437.1_1 Forward -189 -170 -2.55715 0.219
NP_440437.1_1 Forward -46 -27 -4.13045 0.251
NP_442500.1_8 Forward -23 -9 12.7813 0.222
NP_440375.1_6 Reverse -348 -367 9.43923 0.239
NP_441644.1_6 Reverse -31 -41 19.0557 0.000803
NP_441644.1_6 Forward -40 -30 17.3841 0.00127
NP_443049.1_6 Reverse -165 -175 11.153 0.278
NP_442177.1_5 Forward -211 -197 11.701 0.22
NP_442029.1_1 Reverse -86 -105 -16.7168 0.272
NP_442029.1_6 Reverse -26 -45 2.55606 0.294
NP_442247.1_8 Reverse -267 -281 15.5359 0.247
NP_440929.1_8 Forward -40 -31 19.2726 0.000701
NP_440929.1_8 Reverse -31 -40 19.2726 0.000701
NP_442933.1_10 Forward -40 -31 17.601 0.00325
NP_442933.1_10 Reverse -31 -40 17.601 0.00325
NP_442933.1_10 Forward -183 -174 8.1612 0.0885
NP_441751.2_8 Forward -39 -25 6.6861 0.0348
NP_441751.2_8 Reverse -32 -46 4.91614 0.0453
NP_442554.1_4 Forward -390 -371 14.9458 0.126
NP_442554.1_8 Reverse -32 -42 17.2863 0.00543
NP_442554.1_8 Forward -39 -29 15.3197 0.00882
NP_441762.1_7 Forward -41 -29 0.530633 0.0747
NP_441762.1_7 Reverse -30 -42 -6.84419 0.284
NP_442142.1_4 Forward -43 -30 3.7553 0.246
NP_442142.1_4 Reverse -28 -41 3.55864 0.251
NP_442142.1_4 Forward -172 -159 2.57534 0.286
NP_442292.1_1 Forward -39 -30 18.486 0.00229
NP_442292.1_1 Reverse -32 -41 17.5026 0.00435
NP_442476.1_6 Forward -39 -25 1.57289 0.211
NP_441523.1_6 Reverse -188 -207 6.98095 0.203
NP_443009.1_5 Reverse -30 -41 14.5128 0.02
NP_443009.1_5 Forward -41 -30 10.1862 0.0792
NP_441741.1_6 Reverse -10 -29 13.5691 0.247
NP_441715.1_4 Reverse -32 -42 16.7946 0.0106
NP_441715.1_4 Forward -39 -29 7.94484 0.107
NP_440464.1_10 Forward -39 -29 13.0082 0.169
NP_441468.1_1 Forward -39 -32 15.8704 0.0124
NP_441468.1_1 Reverse -32 -39 15.8704 0.0124
NP_441673.1_1 Forward -40 -31 20.8459 0.000698
NP_441673.1_1 Reverse -31 -40 20.8459 0.000698
NP_441826.1_2 Reverse -339 -353 -1.96703 0.261
NP_441826.1_2 Reverse -25 -39 -4.52363 0.296
NP_442811.1_2 Reverse -160 -179 3.53937 0.226
NP_442490.1_9 Reverse -162 -181 -3.83545 0.247
NP_442868.1_6 Forward -42 -32 10.4031 0.038
NP_442868.1_6 Reverse -29 -39 9.81313 0.038
NP_442868.1_6 Reverse -214 -224 0.275027 0.243
NP_441251.1_7 Reverse -8 -21 11.7207 0.27
NP_440785.1_2 Forward -33 -14 5.40766 0.251
NP_440051.1_5 Reverse -16 -30 15.4196 0.219
NP_442677.1_7 Forward -375 -365 17.8763 0.237
NP_441612.1_2 Forward -40 -30 8.54929 0.21
NP_442559.1_3 Forward -376 -357 10.8159 0.22
NP_442227.1_2 Forward -104 -85 4.12936 0.208
NP_442808.1_1 Forward -41 -31 8.73102 0.0481
NP_442808.1_1 Reverse -30 -40 8.63269 0.0481
NP_442808.1_1 Forward -101 -91 4.50281 0.197
NP_442808.1_1 Reverse -197 -207 4.30615 0.2
NP_442808.1_1 Forward -176 -166 3.32285 0.244
NP_442692.1_10 Forward -141 -128 16.5182 0.213
NP_440145.1_3 Reverse -88 -107 -1.08219 0.146
NP_442050.1_5 Forward -42 -32 15.9091 0.0091
NP_442050.1_5 Reverse -29 -39 7.64939 0.243
NP_442903.1_2 Forward -28 -9 3.48503 0.242
NP_440342.1_1 Reverse -89 -108 14.2574 0.192
NP_442789.1_4 Reverse -172 -191 -2.75381 0.242
NP_441878.1_6 Forward -41 -31 10.5014 0.0176
NP_441878.1_6 Reverse -30 -40 10.4031 0.0176
NP_441878.1_6 Reverse -97 -107 -7.68978 0.255
NP_441878.1_6 Reverse -363 -373 -7.98478 0.285
NP_441036.1_8 Forward -41 -31 15.713 0.00724
NP_441036.1_8 Reverse -30 -40 8.33817 0.174
NP_441036.1_8 Forward -279 -269 5.28991 0.295
NP_441557.1_5 Forward -40 -31 19.9609 0.000699
NP_441557.1_5 Reverse -31 -40 19.9609 0.000699
NP_441557.1_8 Forward -174 -164 15.0242 0.183
NP_441557.1_8 Forward -94 -84 12.0743 0.236
NP_441445.1_1 Forward -49 -30 7.96426 0.124
NP_442267.1_4 Reverse -362 -381 0.392778 0.285
NP_442066.2_9 Reverse -27 -40 11.1307 0.154
NP_441433.1_8 Forward -291 -272 -3.14714 0.276
NP_442183.1_1 Forward -40 -26 11.5043 0.0702
NP_442166.1_7 Reverse -32 -46 9.43936 0.191
NP_442397.1_9 Forward -390 -371 7.96426 0.246
NP_440086.1_4 Forward -161 -147 18.6311 0.163
NP_441549.1_9 Reverse -27 -45 -4.99573 0.198
NP_442632.1_3 Reverse -176 -195 4.81767 0.178
NP_442347.1_2 Forward -39 -30 12.4878 0.056
NP_442347.1_2 Reverse -32 -41 3.34298 0.284
NP_442645.1_2 Reverse -23 -42 -15.2418 0.194
NP_442645.1_2 Forward -48 -29 -21.4367 0.29
NP_441037.1_4 Reverse -29 -39 7.9999 0.237
NP_441037.1_4 Forward -42 -32 7.22024 0.237
NP_442047.1_2 Forward -134 -120 14.4542 0.19
NP_442317.1_6 Forward -304 -285 2.55606 0.275
NP_441633.1_3 Reverse -29 -42 1.10092 0.109
NP_441633.1_3 Forward -42 -29 -3.71729 0.177
NP_440136.1_2 Forward -39 -32 15.9687 0.0123
NP_440136.1_2 Reverse -32 -39 15.9687 0.0123
NP_442998.1_5 Reverse -132 -142 13.0581 0.158
NP_442998.1_5 Forward -384 -374 11.6814 0.179
NP_442998.1_5 Reverse -258 -268 11.1898 0.191
NP_442998.1_10 Forward -38 -31 15.5754 0.0102
NP_442998.1_10 Reverse -33 -40 15.5754 0.0102
NP_440299.1_1 Reverse -27 -40 12.9984 0.0319
NP_440299.1_1 Forward -44 -31 5.0336 0.191
NP_440299.1_1 Forward -229 -216 4.05029 0.221
NP_441799.1_1 Forward -44 -30 17.5018 0.011
NP_441799.1_1 Reverse -27 -41 16.8135 0.0129
NP_441799.1_1 Reverse -152 -166 3.63724 0.289
NP_441007.1_10 Reverse -26 -39 8.27909 0.115
NP_442201.1_10 Forward -51 -32 -8.16202 0.213
NP_440256.1_1 Reverse -28 -47 4.81767 0.0411
NP_440256.1_1 Reverse -73 -92 -9.83364 0.289
NP_441512.1_4 Forward -44 -25 8.65258 0.261
NP_441559.1_8 Forward -45 -31 18.1908 0.044
NP_440915.1_6 Reverse -27 -41 2.85119 0.111
NP_440915.1_6 Forward -44 -30 0.0979218 0.176
NP_440915.1_6 Reverse -87 -101 -1.5737 0.239
NP_442855.1_6 Reverse -212 -231 12.9791 0.298
NP_442785.1_7 Forward -42 -28 10.7177 0.228
NP_441464.1_10 Forward -209 -195 10.1277 0.262
NP_440695.1_6 Forward -21 -7 11.5748 0.265
NP_440695.1_6 Forward -144 -130 10.4114 0.265
NP_442993.1_1 Forward -274 -258 -1.71142 0.0986
NP_442386.1_9 Reverse -30 -39 13.8639 0.0289
NP_442386.1_9 Forward -300 -291 8.16077 0.209
NP_442386.1_9 Forward -41 -32 6.39082 0.219
NP_441340.1_5 Forward -39 -32 15.6737 0.0124
NP_441340.1_5 Reverse -32 -39 15.6737 0.0124
NP_441271.1_8 Forward -258 -248 14.0414 0.266
NP_440327.1_8 Reverse -308 -327 14.6508 0.264
NP_442240.1_2 Reverse -32 -51 -13.0786 0.163
NP_440211.1_3 Forward -174 -155 15.3391 0.287
NP_440586.1_8 Forward -39 -32 13.2151 0.026
NP_440586.1_8 Reverse -32 -39 13.2151 0.026
NP_440586.1_8 Reverse -175 -182 10.7568 0.128
NP_442251.1_6 Forward -39 -32 15.2804 0.0124
NP_442251.1_6 Reverse -32 -39 15.2804 0.0124
NP_440192.1_4 Forward -316 -297 12.3082 0.184
NP_440684.1_9 Reverse -25 -39 22.4191 0.00262
NP_441262.1_3 Reverse -31 -38 14.7888 0.0223
NP_441262.1_3 Forward -40 -33 14.7888 0.0223
NP_440027.1_3 Forward -383 -365 2.08335 0.293
NP_443051.1_1 Forward -41 -32 19.5676 0.00335
NP_443051.1_1 Reverse -30 -39 10.4228 0.00754
NP_439984.1_3 Reverse -24 -38 18.8785 0.0523
NP_439937.1_8 Reverse -163 -182 2.94938 0.209
NP_439937.1_9 Reverse -30 -47 -5.07504 0.157
NP_442294.1_3 Forward -271 -257 13.8636 0.252
NP_440836.1_6 Reverse -371 -385 11.7993 0.214
NP_440408.1_7 Reverse -86 -105 11.7992 0.213
NP_440439.1_1 Forward -43 -30 13.1956 0.0211
NP_440372.1_2 Forward -39 -32 16.3621 0.0124
NP_440372.1_2 Reverse -32 -39 16.3621 0.0124
NP_440316.1_10 Forward -208 -198 8.4365 0.239
NP_442384.1_10 Reverse -31 -44 19.4888 0.00338
NP_442384.1_10 Forward -40 -27 15.8506 0.00946
NP_441877.1_5 Reverse -371 -390 15.9291 0.124
NP_441877.1_5 Reverse -134 -153 3.53937 0.234
NP_442790.1_4 Reverse -22 -41 2.65439 0.0729
NP_442262.1_10 Forward -39 -32 14.1988 0.0123
NP_442262.1_10 Reverse -32 -39 14.1988 0.0123
NP_441689.1_5 Forward -42 -32 8.3377 0.132
NP_441689.1_5 Reverse -29 -39 5.78111 0.197
NP_440344.1_10 Forward -47 -30 -8.0243 0.121
NP_440344.1_10 Forward -285 -268 -12.9408 0.269
NP_440075.1_1 Reverse -169 -188 3.73603 0.281
NP_440282.1_3 Reverse -199 -218 -0.4922 0.291
NP_440531.1_6 Forward -48 -29 7.27595 0.0998
NP_440531.1_8 Reverse -86 -105 2.85105 0.282
NP_440189.1_10 Reverse -20 -39 11.8975 0.172
NP_442641.1_1 Reverse -273 -292 -7.17871 0.192
NP_441965.1_10 Forward -43 -27 10.9733 0.107
NP_440297.1_9 Forward -39 -29 -0.118297 0.282
NP_440297.1_9 Reverse -217 -227 -0.216628 0.282
NP_440297.1_9 Reverse -32 -42 -0.216628 0.282
NP_441592.1_4 Forward -40 -21 14.2574 0.0779
NP_441592.1_10 Forward -146 -132 17.6985 0.279
NP_440999.1_9 Forward -44 -30 -0.295402 0.203
NP_440888.1_2 Reverse -31 -45 15.4369 0.0107
NP_440888.1_2 Forward -40 -26 7.07881 0.208
NP_440888.1_2 Reverse -290 -304 6.29216 0.241
NP_440803.1_3 Forward -202 -183 4.71934 0.259
NP_440600.1_4 Forward -48 -30 -0.669169 0.155
NP_440600.1_4 Reverse -23 -41 -2.3408 0.195
NP_442277.1_4 Forward -49 -30 9.24175 0.115
NP_442033.1_10 Forward -177 -158 -8.94866 0.21
NP_441543.1_2 Forward -39 -30 16.9127 0.00359
NP_441543.1_2 Reverse -32 -41 15.9293 0.00518
NP_441543.1_2 Reverse -175 -184 8.25953 0.104
NP_442845.1_2 Reverse -25 -39 15.3392 0.0729
NP_441469.1_8 Forward -41 -32 6.5879 0.227
NP_441469.1_8 Reverse -30 -39 6.48957 0.227
NP_443064.1_6 Forward -40 -30 12.5669 0.0796
NP_443064.1_6 Reverse -31 -41 10.8217 0.13
NP_442578.1_7 Forward -39 -32 14.5921 0.026
NP_442578.1_7 Reverse -32 -39 14.5921 0.026
NP_440710.1_1 Forward -48 -30 2.47742 0.121
NP_441462.1_2 Reverse -31 -41 20.2362 0.000805
NP_441462.1_2 Forward -40 -30 11.5831 0.00406
NP_440519.1_8 Reverse -216 -232 7.82668 0.199
NP_442204.1_1 Forward -44 -33 9.59678 0.0736
NP_440504.1_7 Reverse -92 -111 -4.6221 0.295
NP_440454.1_2 Forward -29 -15 16.8182 0.154
NP_440516.1_2 Reverse -25 -43 7.29564 0.118
NP_440516.1_8 Forward -40 -31 16.9127 0.00442
NP_440516.1_8 Reverse -31 -40 16.9127 0.00442
NP_442428.1_5 Forward -39 -32 15.8704 0.0124
NP_442428.1_5 Reverse -32 -39 15.8704 0.0124
NP_442120.1_10 Reverse -98 -117 -15.6352 0.294
NP_440673.1_2 Reverse -21 -40 9.12141 0.257
NP_440673.1_3 Forward -38 -31 12.4288 0.0426
NP_440673.1_3 Reverse -33 -40 12.4288 0.0426
NP_440673.1_3 Forward -223 -216 8.8889 0.206
NP_441052.1_2 Forward -40 -30 19.9412 0.00106
NP_441052.1_2 Reverse -31 -41 10.4031 0.0285
NP_442219.1_9 Forward -39 -30 17.7976 0.00718
NP_442219.1_9 Reverse -32 -41 8.25953 0.0681
NP_440436.1_4 Forward -39 -30 17.2072 0.00233
NP_440436.1_4 Reverse -32 -41 9.24241 0.0871
NP_440436.1_4 Reverse -270 -279 8.06244 0.118
NP_440314.1_9 Forward -39 -20 -1.57384 0.135
NP_441719.1_4 Forward -39 -32 16.3621 0.0124
NP_441719.1_4 Reverse -32 -39 16.3621 0.0124
NP_441004.1_1 Reverse -168 -187 -8.26035 0.2
NP_441004.1_1 Reverse -210 -229 -10.817 0.226
NP_442366.1_3 Forward -41 -23 -2.14413 0.221
NP_442366.1_3 Reverse -173 -191 -2.53746 0.229
NP_442366.1_5 Reverse -28 -38 15.4175 0.0374
NP_441115.1_4 Reverse -30 -48 9.06482 0.227
NP_443054.1_2 Forward -42 -28 -0.393733 0.294
NP_441851.1_10 Reverse -30 -40 15.8113 0.00552
NP_441851.1_10 Reverse -97 -107 11.9764 0.0583
NP_441851.1_10 Forward -41 -31 8.53483 0.114
NP_441851.1_10 Reverse -268 -278 4.10993 0.287
NP_442011.1_1 Reverse -30 -49 -3.3438 0.294
NP_441668.1_4 Reverse -21 -40 7.27595 0.151
NP_441668.1_4 Forward -54 -35 -2.45882 0.288
NP_442515.1_1 Forward -41 -27 4.71948 0.107
NP_442515.1_1 Reverse -30 -44 2.2612 0.14
NP_442515.1_1 Forward -178 -164 -4.13031 0.298
NP_440593.1_3 Reverse -326 -345 -1.47551 0.211
NP_440463.1_7 Forward -178 -164 17.2075 0.227
NP_440165.1_5 Reverse -30 -49 -7.27704 0.259
NP_442709.1_3 Reverse -24 -43 7.17762 0.135
NP_440338.1_4 Forward -30 -11 6.1935 0.29
NP_441349.1_10 Forward -50 -31 1.76941 0.0809
NP_441349.1_10 Reverse -21 -40 -7.37537 0.248
NP_441349.1_10 Reverse -364 -383 -9.73531 0.297
NP_442843.1_1 Reverse -282 -301 0.687771 0.17
NP_442843.1_1 Reverse -157 -176 -4.81876 0.239
NP_442843.1_1 Reverse -128 -147 -11.0136 0.285
NP_440474.1_8 Reverse -32 -46 4.12889 0.291
NP_441124.1_6 Reverse -346 -360 20.0649 0.173
NP_442450.1_5 Reverse -29 -39 7.55152 0.13
NP_442450.1_5 Reverse -238 -248 6.07655 0.204
NP_442168.1_5 Reverse -241 -260 -1.7705 0.264
NP_440588.1_2 Reverse -22 -41 -0.0988766 0.15
NP_440588.1_2 Forward -258 -239 -5.9004 0.264
NP_441570.1_1 Reverse -31 -49 -6.4707 0.0796
NP_441078.1_4 Forward -40 -31 19.6659 0.0007
NP_441078.1_4 Reverse -31 -40 19.6659 0.0007
NP_442729.1_8 Reverse -27 -40 10.639 0.125
NP_440707.1_6 Forward -48 -29 19.7631 0.0461
NP_442443.1_1 Reverse -214 -233 -3.54046 0.267
NP_442443.1_1 Forward -285 -266 -4.81876 0.278
NP_442906.1_3 Forward -195 -176 5.40766 0.2
NP_442906.1_9 Reverse -342 -361 7.17762 0.207
NP_440526.1_3 Forward -106 -95 1.04151 0.267
NP_440526.1_3 Forward -39 -28 1.04151 0.267
NP_440526.1_3 Forward -99 -88 0.156538 0.297
NP_441432.1_8 Reverse -30 -39 16.8143 0.00595
NP_441432.1_8 Forward -41 -32 16.8143 0.00595
NP_441432.1_8 Forward -208 -199 7.27622 0.101
NP_441432.1_8 Reverse -313 -322 2.85133 0.281
NP_442320.1_8 Reverse -25 -39 -4.81863 0.188
NP_442320.1_8 Reverse -275 -289 -4.91696 0.192
NP_442320.1_8 Forward -305 -291 -5.31028 0.217
NP_441732.1_2 Forward -44 -28 -6.7263 0.0495
NP_441732.1_2 Reverse -27 -43 -16.4611 0.167
NP_440685.1_5 Forward -312 -293 10.2259 0.291
NP_440760.1_1 Forward -40 -21 2.85105 0.0212
NP_440760.1_1 Forward -225 -206 -18.2901 0.212
NP_442353.1_4 Forward -46 -27 4.71854 0.2
NP_440713.1_4 Forward -50 -31 9.14423 0.155
NP_442489.1_7 Forward -40 -31 20.1576 0.000695
NP_442489.1_7 Reverse -31 -40 20.1576 0.000695
NP_440757.1_7 Forward -188 -170 -2.73412 0.282
NP_440559.1_1 Forward -39 -30 17.4043 0.00658
NP_440559.1_1 Reverse -32 -41 8.65285 0.0586
NP_441659.2_8 Reverse -31 -41 20.9245 0.000805
NP_441659.2_8 Forward -40 -30 18.1713 0.00133
NP_441659.2_8 Reverse -216 -226 -0.0199663 0.282
NP_442913.1_9 Forward -106 -87 13.5691 0.136
NP_442913.1_10 Forward -49 -30 -3.3438 0.207
NP_441040.1_5 Forward -388 -369 3.34271 0.275
NP_442346.1_5 Reverse -30 -40 16.6963 0.00248
NP_442346.1_5 Forward -41 -31 16.303 0.00248
NP_442346.1_5 Reverse -215 -225 9.41981 0.118
NP_440545.1_3 Reverse -27 -44 2.59545 0.0976
NP_440486.1_9 Forward -175 -161 17.8958 0.116
NP_440250.1_4 Reverse -11 -30 4.62021 0.253
NP_440459.1_2 Reverse -207 -224 7.80699 0.278
NP_440459.1_2 Reverse -355 -372 7.61033 0.285
NP_442603.1_7 Forward -40 -26 7.17714 0.211
NP_441888.1_7 Forward -170 -156 10.3243 0.122
NP_441593.1_1 Forward -129 -110 19.2723 0.024
NP_441948.1_4 Forward -47 -29 0.805796 0.135
NP_441833.1_4 Forward -39 -32 15.9687 0.0124
NP_441833.1_4 Reverse -32 -39 15.9687 0.0124
NP_442162.1_9 Forward -39 -32 16.2637 0.0124
NP_442162.1_9 Reverse -32 -39 16.2637 0.0124
NP_442404.1_9 Reverse -192 -206 8.16044 0.296
NP_442943.1_1 Forward -399 -384 3.00991 0.286
NP_442546.1_6 Forward -361 -342 21.8195 0.145
NP_442199.1_5 Forward -48 -29 -2.36049 0.185
NP_442140.1_3 Forward -39 -29 12.2714 0.0632
NP_442140.1_3 Reverse -32 -42 4.69992 0.238
NP_442723.1_1 Forward -111 -92 3.24359 0.278
NP_442778.1_10 Reverse -14 -32 8.08229 0.259
NP_441671.1_3 Forward -48 -29 13.5691 0.252
NP_440875.1_9 Reverse -33 -43 13.5309 0.0677
NP_441813.1_5 Forward -42 -32 18.1713 0.00743
NP_441813.1_5 Reverse -29 -39 8.63316 0.0367
NP_440594.1_8 Reverse -32 -45 20.1765 0.0534
NP_440590.1_4 Reverse -32 -45 5.13249 0.0585
NP_440590.1_4 Forward -39 -26 0.805932 0.143
NP_440590.1_4 Forward -224 -211 -2.63565 0.247
NP_440590.1_4 Reverse -92 -105 -5.68391 0.286
NP_440567.1_1 Forward -39 -25 8.84938 0.0528
NP_440567.1_1 Reverse -32 -46 3.24451 0.148
NP_442497.1_10 Reverse -32 -41 17.601 0.00813
NP_442497.1_10 Forward -39 -30 10.4228 0.0087
NP_440821.1_4 Reverse -29 -39 9.41981 0.0286
NP_440821.1_4 Forward -42 -32 2.24165 0.131
NP_441239.1_9 Forward -42 -30 13.0187 0.0389
NP_441239.1_9 Forward -375 -363 5.84051 0.206
NP_441239.1_9 Reverse -29 -41 3.38223 0.285
NP_441009.1_2 Forward -43 -25 18.702 0.275
NP_441009.1_4 Reverse -216 -235 16.9124 0.143
NP_441009.1_4 Reverse -240 -259 11.5042 0.254
NP_442691.1_2 Forward -380 -361 4.12936 0.283
NP_441892.1_1 Forward -49 -32 0.727158 0.163
NP_441892.1_1 Reverse -311 -328 -6.05768 0.296
NP_440665.1_2 Forward -208 -189 -5.60541 0.247
NP_440876.1_5 Forward -38 -19 16.3224 0.191
NP_441617.1_6 Reverse -24 -43 -4.32711 0.265
NP_442052.1_2 Reverse -91 -110 19.3707 0.18
NP_440546.1_4 Reverse -31 -41 13.5365 0.0459
NP_440546.1_4 Forward -40 -30 10.046 0.109
NP_443033.1_7 Forward -260 -241 11.1109 0.293
NP_440462.1_6 Forward -42 -32 18.7612 0.00454
NP_440462.1_6 Reverse -29 -39 1.35667 0.294
NP_440868.1_2 Forward -169 -155 16.5197 0.28
NP_440868.1_4 Forward -44 -32 17.6402 0.0124
NP_440868.1_4 Reverse -27 -39 8.10212 0.0602
NP_440401.1_9 Reverse -196 -203 14.5917 0.287
NP_442499.1_3 Forward -184 -166 3.3624 0.295
NP_442479.1_9 Reverse -372 -391 -5.99873 0.266
NP_440812.1_4 Forward -388 -369 15.2212 0.205
NP_442402.1_4 Reverse -184 -203 -8.75273 0.284
NP_441084.1_6 Forward -42 -28 17.1007 0.0523
NP_440696.1_3 Reverse -364 -382 12.4089 0.109
NP_442023.1_2 Forward -226 -207 12.4875 0.199
NP_442023.1_3 Forward -29 -10 18.4848 0.0517
NP_442039.1_4 Forward -39 -32 15.1821 0.0124
NP_442039.1_4 Reverse -32 -39 15.1821 0.0124
NP_442039.1_4 Reverse -270 -277 8.69224 0.172
NP_441811.1_8 Reverse -25 -39 5.99778 0.289
NP_440825.1_7 Forward -39 -29 12.9096 0.152
NP_442696.1_6 Forward -377 -358 -12.0953 0.249
NP_442837.1_3 Forward -39 -32 15.7721 0.0124
NP_442837.1_3 Reverse -32 -39 15.7721 0.0124
NP_440160.1_2 Reverse -75 -94 -2.36049 0.245
NP_440160.1_2 Forward -378 -359 -8.55534 0.286
NP_442053.1_1 Forward -40 -31 18.3876 0.0007
NP_442053.1_1 Reverse -31 -40 18.3876 0.0007
NP_440505.1_3 Forward -42 -32 17.188 0.00332
NP_440505.1_3 Reverse -29 -39 9.22315 0.122
NP_441408.2_7 Forward -42 -23 -2.85214 0.272
NP_440914.1_1 Forward -40 -30 17.5935 0.000537
NP_440914.1_1 Reverse -31 -41 16.3248 0.00196
NP_440914.1_1 Reverse -98 -108 6.85846 0.263
NP_441011.1_6 Reverse -187 -206 20.354 0.0574
NP_441011.1_8 Reverse -32 -41 16.6177 0.00602
NP_441011.1_8 Forward -39 -30 8.25953 0.144
NP_442533.1_6 Forward -40 -31 17.2076 0.00137
NP_442533.1_6 Reverse -31 -40 17.2076 0.00137
NP_442533.1_6 Forward -372 -363 10.2261 0.0558
NP_442533.1_6 Reverse -174 -183 3.14632 0.224
NP_442533.1_6 Reverse -364 -373 2.458 0.255
NP_442541.1_10 Forward -383 -369 3.44058 0.254
NP_442322.1_4 Forward -103 -86 -9.99156 0.297
NP_440854.1_2 Forward -40 -21 9.3409 0.26
NP_443016.1_1 Reverse -25 -44 -7.37537 0.274
NP_441482.1_7 Forward -46 -32 -12.1934 0.29
NP_439944.1_9 Forward -39 -29 10.5014 0.0887
NP_439944.1_9 Reverse -32 -42 9.12481 0.1
NP_441028.1_6 Forward -105 -95 7.64939 0.218
NP_441527.1_4 Forward -21 -2 -1.28956 0.146
NP_440115.1_6 Forward -43 -33 13.0581 0.0818
NP_442673.1_7 Reverse -17 -36 13.8937 0.208
NP_441106.1_1 Forward -41 -32 18.486 0.0028
NP_441106.1_1 Reverse -30 -39 9.63616 0.0311
NP_440480.1_8 Forward -331 -318 18.3088 0.29
NP_439903.1_6 Forward -43 -24 4.91521 0.188
NP_442306.1_10 Forward -45 -26 -0.983855 0.0484
NP_442306.1_10 Reverse -161 -180 -21.3384 0.263
NP_441286.1_1 Reverse -30 -42 5.93884 0.0258
NP_441286.1_1 Forward -41 -29 3.48056 0.0467
NP_441286.1_1 Reverse -215 -227 -7.04085 0.3
NP_442674.1_2 Reverse -151 -170 7.47261 0.278
NP_440670.1_8 Forward -40 -31 18.3876 0.000699
NP_440670.1_8 Reverse -31 -40 18.3876 0.000699
NP_440886.1_7 Forward -101 -91 9.616 0.0805
NP_440886.1_7 Forward -41 -31 8.04271 0.0805
NP_440886.1_7 Reverse -30 -40 7.94438 0.0805
NP_442614.1_2 Reverse -31 -45 6.3911 0.291
NP_442614.1_2 Reverse -216 -230 5.70279 0.298
NP_439995.1_5 Reverse -21 -40 5.60432 0.276
NP_441399.1_5 Reverse -272 -291 20.5506 0.166
NP_440907.2_8 Reverse -32 -42 9.616 0.103
NP_440907.2_8 Forward -39 -29 7.64939 0.117
NP_441021.1_1 Forward -322 -303 -10.3253 0.234
NP_441021.1_1 Forward -224 -205 -11.4069 0.262
NP_441021.1_1 Forward -39 -20 -11.4069 0.262
NP_441626.1_2 Forward -39 -32 15.7721 0.0124
NP_441626.1_2 Reverse -32 -39 15.7721 0.0124
NP_442365.1_7 Reverse -27 -46 3.34271 0.156
NP_442365.1_7 Forward -44 -25 -6.58872 0.298
NP_442794.1_1 Reverse -27 -39 9.28209 0.0795
NP_442794.1_1 Reverse -176 -188 3.57889 0.286
NP_442615.1_1 Reverse -22 -40 4.6407 0.0444
NP_442615.1_1 Forward -49 -31 -6.4707 0.248
NP_441962.1_4 Forward -45 -26 -10.522 0.229
NP_440387.1_1 Forward -40 -24 22.3797 0.00192
NP_440387.1_1 Reverse -31 -47 -0.334789 0.137
NP_441431.1_2 Forward -43 -29 15.6336 0.045
NP_441431.1_2 Reverse -248 -262 8.84875 0.204
NP_441431.1_3 Forward -91 -72 2.65439 0.282
NP_441836.1_1 Reverse -20 -39 22.603 0.00512
NP_441836.1_2 Forward -46 -27 13.2741 0.0686
NP_440467.1_3 Reverse -32 -51 12.7212 0.221
NP_440114.1_10 Reverse -31 -45 14.3559 0.0418
NP_442437.1_4 Forward -200 -181 6.98095 0.28
NP_442698.1_10 Forward -38 -19 0.884433 0.297
NP_440293.1_3 Reverse -356 -375 -2.0655 0.239
NP_439988.1_3 Reverse -162 -176 9.5377 0.247
NP_441237.1_9 Forward -39 -29 14.828 0.0242
NP_440457.1_1 Forward -44 -32 10.8554 0.092
NP_440798.1_6 Reverse -32 -45 3.36254 0.151
NP_440942.1_3 Forward -206 -187 6.09597 0.273
NP_442297.1_4 Reverse -94 -113 11.4598 0.3
NP_441984.1_3 Forward -377 -359 9.36059 0.211
NP_441332.1_6 Forward -176 -166 14.1639 0.158
NP_441332.1_6 Forward -101 -91 14.1639 0.158
NP_440473.1_1 Forward -43 -24 14.5352 0.148
NP_442509.1_9 Forward -40 -30 8.14104 0.192
NP_442509.1_9 Reverse -31 -41 8.04271 0.192
NP_442514.1_5 Forward -380 -361 -8.75273 0.29
NP_442514.1_5 Reverse -244 -263 -9.04772 0.294
NP_440554.1_4 Reverse -32 -42 17.9746 0.0131
NP_441885.1_5 Forward -40 -30 20.9245 0.000538
NP_441885.1_5 Reverse -31 -41 11.3864 0.00668
NP_440022.1_4 Reverse -10 -29 16.6174 0.188
NP_440478.1_10 Reverse -29 -43 7.76774 0.257
NP_442341.1_7 Forward -41 -27 5.21113 0.165
NP_442341.1_7 Reverse -75 -89 2.2612 0.263
NP_442341.1_9 Forward -42 -28 12.6836 0.0984
NP_441173.1_9 Reverse -377 -385 13.2937 0.17
NP_443000.1_7 Forward -42 -32 20.3345 0.00223
NP_443000.1_7 Reverse -29 -39 10.3048 0.0345
NP_440507.2_3 Reverse -171 -190 7.17681 0.286
NP_441842.1_1 Reverse -33 -46 15.555 0.0619
NP_440275.1_3 Forward -42 -32 16.1063 0.0155
NP_440275.1_3 Reverse -29 -39 8.04317 0.0602
NP_440091.1_1 Forward -44 -32 0.825626 0.227
NP_442354.1_7 Forward -43 -24 7.27595 0.216
NP_442275.1_1 Reverse -32 -51 10.8159 0.222
NP_441207.1_7 Forward -31 -17 10.8044 0.253
NP_441105.1_3 Forward -51 -32 -7.86702 0.261
NP_441105.1_3 Forward -388 -369 -9.53865 0.29
NP_440216.1_1 Reverse -31 -45 17.5025 0.00188
NP_440216.1_1 Forward -40 -26 -10.6202 0.145
NP_440172.1_1 Reverse -31 -41 17.5813 0.00421
NP_440172.1_1 Forward -40 -30 15.0247 0.00945
NP_441852.1_7 Forward -204 -185 18.0924 0.171
NP_442015.1_10 Forward -44 -31 4.14919 0.178
NP_442015.1_10 Reverse -27 -40 1.39592 0.204
NP_441045.1_1 Forward -31 -12 11.8975 0.281
NP_441226.1_7 Forward -39 -32 14.4934 0.0123
NP_441226.1_7 Reverse -32 -39 14.4934 0.0123
NP_441226.1_7 Forward -174 -167 5.34865 0.289
NP_440305.1_1 Forward -31 -17 13.3805 0.281
NP_441111.1_7 Forward -39 -31 18.7023 0.00294
NP_441111.1_7 Reverse -32 -40 18.7023 0.00294
NP_442379.1_10 Reverse -24 -41 -1.33779 0.223
NP_441766.1_2 Forward -40 -31 17.5026 0.00297
NP_441766.1_2 Reverse -31 -40 17.5026 0.00297
NP_441766.1_9 Forward -99 -80 1.86774 0.246
NP_443052.1_9 Reverse -264 -283 0.58944 0.194
NP_443052.1_9 Forward -232 -213 -2.75381 0.242
NP_440072.1_5 Reverse -363 -381 -4.01242 0.288
NP_440261.1_5 Reverse -32 -45 3.16588 0.0655
NP_440261.1_5 Forward -39 -26 -10.3055 0.201
NP_440261.1_5 Forward -182 -169 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAATTGGTACAAGCTTGGCAAAATCCAGCCCAGGCCCAAGAGTTAATCAATCAAGCTTGGCTCCAGGTTAATGGAACGCCTATGCCAGAACCTTTACTGCAGCAAACCCTCCGTTCTCTGCAGGAAGCGCCGGATTTTTACCTTTGGCTGAGGGATTACGCTCCCATACTCCAGTACCGTCGCCAGAGGTTAGGCTTTGGGGTTAATCTGCGCCACATTGATGGCCCCAACCCCAGCGATTTTTATCAAGTGACGGAAAATCTTCCCCTGGTAACTTGGTTCCCGTTTATGTTGCCTTCCCCCATCCTCGCTCCGGAGTTGGACAATGAACTGCAACCTTTACGGACAGAACTCTGGCAGGCGATCGCCAAAATCTAAAAAAATCTCAAGATGAAATAA

CDS

ATGAAACTAGCTTGGTTTTGGCTACTGATCCTAGTGGGTTTATTGACTGCGTGTGGAGTTTCTTCGTTTAACCAATTGTTCCCCAGTTCAGAAACTTTCGTTGTCCCAACAAAAGAGTCCATTACCCTAACTGTGTCGGCGGCGGCCAGCCTGCAGGATGCACTGGAAACCTTAGACCCACGGTTTGAATCGACCCATCCCAACATTGAAGTGAATTACAACTTTGCCGCTTCTGGCACACTGCAACAGCAAATTGAGCAGGGAGCTAGGGTTGATCTGTTTATTTCCGCTGCGTCTAAACAAATGGATGGGTTGCAAGCAAAAAGTTTAATCATTAACGATACCCGTCGCAATTTACTCAGTAATAGTTTGGTGTTGGTTGTGCCCCAGGATTCCGCCCTACAAATTAGCAAATTTCAGCAACTCACTGACCCCGCCGTTAAGCGTATTTCCTTGGGGGAACCCCGCAGTGTTCCCGCTGGGCAGTATGCAGAGGAAGTTTTTGAAAATCTAGACATTTTGGCCCAGTTACAATCCAAGTTTGTTTACGGTAATTCGGTACGAAATGTTTTAGGTTCCGTGGAAAGCGCCAATGCCGATGCTGGGATAGTTTACGCCACCGATACCCAAATTTCCGATCAAGTAAAAACTGTGGTTAAAGCCCCGGCTAATTTGCATGCCCCCATTGTTTATCCGATCGCCGTGATAGCGGCCAGTCCCCAGTCAGAAGCAGCCCGCACCTATGGCCAATTTCTCGCTAGTGAAGAAGCCCAGAAGGTTTTCAGTCAATATGGTTTTGGCCCGGGTGAATAA

Protein

MKLAWFWLLILVGLLTACGVSSFNQLFPSSETFVVPTKESITLTVSAAASLQDALETLDPRFESTHPNIEVNYNFAASGTLQQQIEQGARVDLFISAASKQMDGLQAKSLIINDTRRNLLSNSLVLVVPQDSALQISKFQQLTDPAVKRISLGEPRSVPAGQYAEEVFENLDILAQLQSKFVYGNSVRNVLGSVESANADAGIVYATDTQISDQVKTVVKAPANLHAPIVYPIAVIAASPQSEAARTYGQFLASEEAQKVFSQYGFGPGE