Your browser is old and dusty. Try Google Chrome!

Details for sll0736

ORF sll0736
Accession NP_442930.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -195 -209 13.7659 0.166
NP_440815.1_5 Forward -278 -259 3.34271 0.286
NP_442291.1_5 Forward -342 -326 -1.61309 0.201
NP_441453.1_4 Forward -278 -270 3.95266 0.275
NP_440561.1_8 Reverse -120 -139 7.86593 0.282
NP_441145.1_7 Forward -122 -103 5.89931 0.22
NP_439979.1_9 Reverse -123 -141 8.57394 0.26
NP_442062.1_8 Forward -223 -213 4.50326 0.212
NP_440916.1_1 Forward -46 -32 10.0294 0.216
NP_439918.1_3 Forward -122 -103 9.24257 0.252
NP_442110.1_2 Forward -220 -207 13.8347 0.278
NP_440769.1_6 Reverse -11 -30 12.9791 0.186
NP_440769.1_8 Reverse -30 -49 9.73422 0.201
NP_441149.1_9 Forward -20 -1 3.44025 0.221
NP_441770.1_5 Reverse -34 -53 4.03102 0.226
NP_441327.1_1 Reverse -98 -117 7.19276 0.239
NP_440343.1_3 Reverse -215 -233 2.57501 0.296
NP_441265.1_3 Forward -128 -114 -0.787057 0.295
NP_442848.1_4 Forward -218 -204 9.14437 0.282
NP_442848.1_5 Reverse -207 -225 -2.73412 0.286
NP_443018.1_3 Reverse -270 -277 10.6589 0.0967
NP_443018.1_3 Forward -277 -270 4.16902 0.278
NP_441588.1_4 Reverse -271 -281 13.648 0.0943
NP_442191.1_4 Reverse -215 -229 11.7688 0.244
NP_442583.1_1 Forward -226 -207 9.14423 0.298
NP_440181.1_3 Forward -68 -49 6.29264 0.29
NP_440617.1_6 Forward -74 -55 7.57094 0.269
NP_440656.1_8 Forward -98 -79 -4.91709 0.212
NP_441414.1_9 Forward -278 -259 -2.65548 0.12
NP_441487.1_5 Forward -142 -123 14.3558 0.153
NP_441256.1_8 Reverse -193 -212 13.2741 0.143
NP_442937.1_5 Forward -221 -202 7.47261 0.251
NP_441127.1_1 Reverse -198 -212 9.83269 0.267
NP_442836.1_10 Reverse -200 -210 9.22315 0.282
NP_441338.2_9 Forward -50 -31 5.40766 0.252
NP_442376.1_6 Forward -225 -206 -3.24547 0.296
NP_442690.1_9 Forward -224 -206 19.5296 0.119
NP_440153.1_5 Reverse -291 -305 5.60446 0.191
NP_440153.1_8 Reverse -258 -271 -2.43899 0.238
NP_441099.1_8 Forward -336 -318 15.2596 0.158
NP_441646.1_1 Reverse -200 -219 -1.96717 0.298
NP_441550.1_8 Forward -280 -270 6.0761 0.214
NP_441916.1_7 Reverse -258 -268 3.02829 0.232
NP_440345.1_3 Forward -46 -32 11.7571 0.247
NP_442281.1_1 Reverse -209 -223 4.22722 0.203
NP_440375.1_8 Forward -277 -258 4.62101 0.193
NP_441644.1_6 Reverse -269 -279 4.99446 0.216
NP_442554.1_8 Forward -277 -267 2.33998 0.274
NP_442142.1_4 Reverse -266 -279 4.05029 0.234
NP_443009.1_5 Forward -224 -213 3.69644 0.282
NP_441468.1_1 Reverse -270 -277 3.97235 0.277
NP_441876.1_9 Forward -321 -311 10.9926 0.28
NP_443058.1_7 Forward -318 -299 5.99764 0.233
NP_441911.1_7 Forward -48 -29 -19.0774 0.275
NP_442808.1_1 Reverse -76 -86 2.04455 0.279
NP_441101.1_5 Forward -326 -308 16.5036 0.246
NP_442820.1_7 Forward -163 -150 15.4572 0.287
NP_442113.1_10 Reverse -74 -93 -9.63698 0.299
NP_440038.1_4 Reverse -46 -65 0.294447 0.277
NP_442721.1_6 Forward -71 -52 10.8159 0.119
NP_442066.2_4 Forward -223 -204 -9.24366 0.296
NP_442347.1_2 Forward -322 -313 7.96454 0.122
NP_442998.1_5 Reverse -315 -325 12.0747 0.176
NP_441559.1_8 Forward -228 -214 -0.688726 0.179
NP_440915.1_6 Reverse -129 -143 -0.0987402 0.182
NP_441179.1_2 Reverse -355 -374 -0.4922 0.272
NP_442785.1_7 Forward -279 -265 14.6509 0.228
NP_442967.1_10 Reverse -7 -21 15.219 0.272
NP_440748.1_5 Reverse -210 -229 4.52268 0.198
NP_440306.1_3 Forward -74 -55 9.14423 0.295
NP_442386.1_9 Reverse -268 -277 9.93072 0.144
NP_442386.1_9 Reverse -69 -78 8.55409 0.193
NP_441750.1_1 Forward -276 -257 -11.3086 0.3
NP_441340.1_5 Forward -277 -270 11.3472 0.0526
NP_440639.1_4 Forward -218 -199 14.2566 0.25
NP_440586.1_8 Reverse -270 -277 5.74197 0.283
NP_442959.1_6 Forward -87 -68 2.26107 0.252
NP_439996.1_9 Reverse -231 -250 17.4032 0.152
NP_440439.1_1 Forward -226 -213 -0.472371 0.221
NP_442239.1_8 Forward -226 -207 4.42435 0.297
NP_442511.1_2 Forward -125 -106 14.402 0.23
NP_440139.1_1 Reverse -193 -212 0.883656 0.279
NP_441572.1_7 Reverse -208 -227 -6.29373 0.288
NP_442262.1_10 Reverse -270 -277 12.0355 0.062
NP_440531.1_6 Reverse -62 -81 -5.50708 0.299
NP_441679.1_1 Forward -276 -257 -1.47551 0.211
NP_442553.1_4 Reverse -122 -141 8.06259 0.273
NP_443036.1_1 Reverse -218 -237 8.84842 0.288
NP_442845.1_2 Forward -284 -270 11.111 0.137
NP_442315.1_3 Reverse -36 -55 5.40766 0.275
NP_442204.1_1 Reverse -191 -202 1.33697 0.274
NP_440544.1_5 Reverse -244 -251 13.8024 0.28
NP_441351.1_8 Forward -180 -161 2.65439 0.243
NP_440516.1_8 Forward -278 -269 -0.590259 0.283
NP_442428.1_5 Reverse -270 -277 4.36568 0.271
NP_442120.1_10 Reverse -208 -227 -14.5535 0.288
NP_441052.1_2 Forward -57 -47 -0.511621 0.282
NP_440746.1_2 Reverse -257 -276 15.1424 0.173
NP_441004.1_1 Forward -276 -257 -17.3068 0.29
NP_441004.1_2 Reverse -224 -243 8.16093 0.169
NP_441004.1_4 Reverse -205 -215 7.74818 0.289
NP_439949.1_7 Forward -196 -182 13.1759 0.257
NP_441034.1_2 Forward -68 -49 15.9797 0.237
NP_440328.1_4 Forward -269 -250 1.47442 0.224
NP_441851.1_10 Reverse -381 -391 5.19158 0.221
NP_441851.1_10 Forward -224 -214 4.50326 0.266
NP_442208.1_5 Forward -86 -67 -10.522 0.299
NP_442515.1_1 Reverse -313 -327 -4.7203 0.298
NP_441982.1_6 Reverse -34 -43 10.48 0.296
NP_441046.1_2 Reverse -37 -56 0.0977854 0.271
NP_442689.1_3 Forward -71 -52 11.2092 0.261
NP_440023.1_5 Reverse -53 -72 5.70265 0.296
NP_442006.1_3 Forward -177 -159 -6.66736 0.298
NP_442038.1_1 Reverse -30 -49 0.491109 0.278
NP_441570.1_1 Forward -341 -323 -17.7788 0.291
NP_442348.1_2 Forward -193 -184 7.27622 0.28
NP_442443.1_1 Reverse -192 -211 -0.197208 0.222
NP_442443.1_2 Reverse -60 -79 11.4058 0.255
NP_442274.1_3 Reverse -367 -386 13.9625 0.297
NP_441805.1_2 Forward -278 -259 -1.96717 0.223
NP_442510.1_5 Reverse -260 -279 15.6341 0.201
NP_441072.1_2 Forward -227 -208 5.99764 0.295
NP_441923.1_6 Forward -277 -263 7.76774 0.298
NP_441943.1_5 Reverse -347 -366 17.2317 0.189
NP_440847.1_3 Forward -207 -193 14.3553 0.202
NP_442796.1_10 Forward -267 -248 11.0125 0.249
NP_441973.1_1 Forward -42 -27 0.373221 0.235
NP_440875.1_9 Forward -140 -130 7.69067 0.255
NP_440567.1_1 Reverse -259 -273 -0.197071 0.27
NP_440546.1_4 Forward -278 -268 11.3065 0.0872
NP_440546.1_4 Reverse -269 -279 9.27034 0.146
NP_442402.1_4 Forward -53 -34 1.76863 0.173
NP_442402.1_4 Reverse -246 -265 -8.35941 0.281
NP_442402.1_10 Forward -44 -34 16.2041 0.118
NP_441084.1_6 Forward -59 -45 9.73195 0.269
NP_441811.1_1 Forward -326 -307 4.81767 0.28
NP_442679.1_1 Forward -265 -246 -5.60541 0.293
NP_442829.1_2 Forward -259 -243 19.3506 0.12
NP_440505.1_3 Forward -225 -215 10.4031 0.108
NP_441252.1_6 Reverse -34 -41 11.6422 0.288
NP_442532.1_4 Reverse -29 -47 10.195 0.271
NP_442533.1_6 Reverse -269 -278 1.37636 0.3
NP_443016.1_1 Forward -215 -196 -8.06369 0.289
NP_441219.1_6 Forward -238 -220 9.36059 0.274
NP_441482.1_7 Forward -236 -222 -3.24533 0.115
NP_441697.1_5 Forward -365 -346 -10.2658 0.278
NP_440816.1_2 Reverse -34 -53 6.72539 0.27
NP_441028.1_6 Forward -322 -312 14.6309 0.158
NP_441028.1_6 Forward -43 -33 7.74772 0.218
NP_441527.1_4 Forward -259 -240 -9.2154 0.255
NP_441680.1_4 Forward -238 -219 4.81767 0.199
NP_441680.1_4 Reverse -119 -138 4.52268 0.206
NP_441869.1_2 Reverse -255 -274 8.94757 0.284
NP_442674.1_3 Reverse -294 -313 5.2102 0.271
NP_441753.1_3 Forward -216 -197 17.5024 0.128
NP_441753.1_10 Forward -276 -257 1.47442 0.264
NP_442022.1_4 Forward -192 -173 8.25926 0.268
NP_440907.2_8 Forward -141 -131 4.99446 0.228
NP_441463.1_3 Reverse -352 -371 -10.1286 0.289
NP_442365.1_5 Forward -216 -197 14.0608 0.114
NP_442794.1_1 Reverse -265 -277 8.6921 0.0961
NP_441174.1_4 Reverse -312 -322 19.2529 0.17
NP_440358.1_8 Forward -347 -328 0.884433 0.258
NP_440114.1_10 Reverse -269 -283 6.3911 0.273
NP_442323.1_7 Forward -358 -339 6.48849 0.194
NP_441510.2_7 Reverse -208 -222 9.34041 0.287
NP_439988.1_3 Reverse -148 -162 6.3911 0.278
NP_441237.1_9 Forward -277 -267 11.3864 0.184
NP_442930.1_1 Forward -49 -39 12.8609 0.239
NP_440457.1_1 Reverse -195 -207 -0.944332 0.285
NP_441489.1_3 Reverse -33 -47 10.7067 0.231
NP_440628.1_1 Forward -256 -246 13.1012 0.29
NP_442341.1_9 Forward -280 -266 11.307 0.127
NP_442341.1_9 Forward -183 -169 6.68548 0.217
NP_441173.1_9 Forward -43 -35 13.1954 0.184
NP_441173.1_9 Forward -42 -34 12.507 0.206
NP_442395.2_4 Reverse -370 -389 1.27698 0.245
NP_442513.1_4 Forward -334 -315 17.6982 0.276
NP_442932.1_9 Forward -264 -245 4.71934 0.277
NP_439962.1_4 Reverse -206 -225 -4.6221 0.271
NP_440175.1_10 Reverse -259 -278 9.93088 0.27
NP_440216.1_1 Reverse -214 -228 -12.5868 0.288
NP_440172.1_1 Reverse -269 -279 4.3066 0.194
NP_441226.1_7 Forward -277 -270 12.4284 0.0404
NP_441226.1_7 Reverse -71 -78 8.29857 0.205
NP_441766.1_2 Reverse -269 -278 5.40793 0.122
NP_440416.1_9 Forward -163 -144 -18.7818 0.264
NP_440416.1_9 Forward -144 -125 -18.8801 0.266
NP_442116.1_6 Forward -58 -41 11.0337 0.214
NP_442116.1_6 Forward -47 -30 7.97797 0.254
NP_442116.1_6 Reverse -30 -47 6.83207 0.271
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGTTTGTCGTCCTTCCCAGTCTAGTTGGGGCTATAAAGGTTTCCATGAATATTGGCTTAACGATACCAATGCTTGGATTTATCCCCATTTGCATAAAGCTGCTGAGCGCATGATTGAATTAAGCCATCGGGAAGCGGTGGATGAACTAGAAGAAAAAGCATTGAACCAGGCCGCCCGGGAATTGCTGTTGGCCCAATCCTCCGACTGGGCATTTATTATGCGGACAGGAACTATGGTGCCCTATGCGGTGCGTCGTACCCGTTCCCATCTGTTGCGCTTCGATAAACTGTTTGATGATATTCGAGCCAATAAAGTGGATGCGGGTTGGCTAGAAAAGGTTGAAGTTATGGACAATATTTTCCCCAAGATTGACTATCGAGTTTACCGTCCTCTGTAAAA

CDS

ATGTGGACTCCCTGGCATTATCTCGGTGGGAAATTGTGGCGGTTACTAGTTTTATTGGTTGCCCTATTGGTTGTTCTGACAACGGTTTTCCTTGGGCAGAATTCCTCAGCTTCTCCTAACAAAATTCGAGGAGTTTGGTTAACCAATGTGGACAGTAATGTTCTTTATGATCCAGTCCAATTAAAAACGGCGATCGCCGATCTGAAGAGTACTAATTTCAATACCCTTTATCCGACGGTGTGGAATGATGGCCATACCCTTTATCCCAGTGCGGTGGCCCAACAATGGTTAGGAAAAAAGCAAGATGAAAAATTAGGAGATCGGGATATGTTAGGGGAGGTAATTAACTTAGCTAAAGAAAAATCTTTGCGGGTTATCCCCTGGTTTGAATTTGGTTTTATGGCCCCGGCAGAGAGTGATTGGGTTAAAGCCCATCCCCATTGGTTAACTACTAATTCCCAAGGAGAAACTATTTGGTTGGAAGGGGGCACTATACCGAGGGTCTGGTTAAATCCGCTCCATCCCGAAGTGCAACAATTAATTACTGCTCTTTTAGTGGATTTAGTCCGTCGCTACGATGTGGATGGTATTCAATTAGATGATCATTTTGGCTATCCCTACAGCTTTGGCTATGATCCCATTACCGTTGCACTTTATCGCCAAGAAACTGGACAGGAACCGCTCCCAGTCCCTGAGTTAGATCTCAACCAAAACTGCGTTAGCTCCGACCCTATTTGGCAACAATGGACCGATTGGCGATCGGCTAAAATTAGTCGTTATGTGCAAAGTTTAGTGCCTATTTTAAAGGCGGTAAAACCAAATTTAACCATTTCCATTTCCCCCAATCCCCAAACTTTTTCCAAGAATTGTTTTTTGCTAGATTGGCAAACCTGGCATGAAGCAAAGGTAATAAATGAGCTAGTTCTACAAGTTTATCGGGAAAAACAAGCCGCTTTTACCGGGGAATTACAACAATCCTCAGTGCAACAAACTAAGCAGGAAATTCCTGTCGTAGTGGGCATTTTGAGCGGGCTAAAAAATCGTTCTATTCCCTCAGCAAGAATTAAGCAACAGGCTCAATGGGTTGACGATCAAAATTTTGCCGGCACCGCCTTCTTTTTCTATGAAAGTTTGTGGAATTTGGAAGCAGAAACTAGCCCCAATCCCTTCGGTTTAAAGCAACAGTGGCAAAGATTATATCGACAGCTTAACGCCGACAAATTTTAA

Protein

MWTPWHYLGGKLWRLLVLLVALLVVLTTVFLGQNSSASPNKIRGVWLTNVDSNVLYDPVQLKTAIADLKSTNFNTLYPTVWNDGHTLYPSAVAQQWLGKKQDEKLGDRDMLGEVINLAKEKSLRVIPWFEFGFMAPAESDWVKAHPHWLTTNSQGETIWLEGGTIPRVWLNPLHPEVQQLITALLVDLVRRYDVDGIQLDDHFGYPYSFGYDPITVALYRQETGQEPLPVPELDLNQNCVSSDPIWQQWTDWRSAKISRYVQSLVPILKAVKPNLTISISPNPQTFSKNCFLLDWQTWHEAKVINELVLQVYREKQAAFTGELQQSSVQQTKQEIPVVVGILSGLKNRSIPSARIKQQAQWVDDQNFAGTAFFFYESLWNLEAETSPNPFGLKQQWQRLYRQLNADKF