Your browser is old and dusty. Try Google Chrome!

Details for sll0733

ORF sll0733
Accession NP_442935.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -141 -160 6.29264 0.153
NP_440557.1_1 Reverse -91 -110 -2.26216 0.286
NP_441418.1_6 Reverse -274 -293 -29.1065 0.216
NP_441418.1_6 Reverse -211 -230 -30.2865 0.267
NP_441418.1_6 Reverse -295 -314 -30.4831 0.28
NP_440897.1_6 Reverse -223 -242 5.2102 0.123
NP_441453.1_4 Reverse -295 -303 9.75419 0.0493
NP_441453.1_7 Forward -328 -321 12.9205 0.23
NP_441453.1_7 Forward -128 -121 12.1338 0.295
NP_441623.1_1 Forward -328 -310 -1.35749 0.24
NP_441818.1_9 Reverse -277 -296 -9.34199 0.29
NP_441630.1_3 Forward -305 -286 0.392778 0.277
NP_442623.1_1 Reverse -347 -366 -8.752 0.221
NP_442655.1_10 Reverse -274 -293 -12.3902 0.261
NP_443002.1_5 Forward -297 -279 10.2448 0.259
NP_442173.1_1 Reverse -141 -149 5.0343 0.24
NP_442173.1_5 Forward -150 -140 14.8613 0.287
NP_443027.1_4 Reverse -308 -318 7.74818 0.235
NP_441812.1_10 Forward -100 -86 19.3641 0.256
NP_442861.1_1 Forward -120 -101 10.4225 0.295
NP_442062.1_8 Forward -297 -287 7.25653 0.104
NP_441900.1_1 Forward -335 -316 16.8705 0.14
NP_441859.1_3 Forward -193 -174 5.11187 0.206
NP_441859.1_3 Reverse -294 -313 2.75194 0.257
NP_442972.1_2 Forward -31 -17 21.0417 0.0499
NP_441802.1_1 Reverse -354 -373 6.58763 0.269
NP_440304.1_4 Reverse -138 -148 6.76487 0.146
NP_440304.1_4 Forward -151 -141 5.09324 0.229
NP_440304.1_4 Forward -188 -178 2.33998 0.299
NP_440304.1_10 Reverse -311 -329 12.5072 0.233
NP_442602.1_3 Reverse -194 -213 -0.787193 0.226
NP_441935.1_1 Reverse -311 -330 5.99764 0.292
NP_441082.1_10 Forward -128 -115 8.47575 0.272
NP_441925.1_4 Forward -296 -277 -14.2592 0.261
NP_441434.1_1 Forward -29 -15 13.094 0.233
NP_441434.1_1 Forward -38 -24 10.2293 0.233
NP_441558.1_5 Forward -388 -369 3.73603 0.299
NP_441713.1_3 Reverse -265 -284 4.42435 0.253
NP_441624.1_7 Reverse -178 -192 15.2409 0.154
NP_441533.1_7 Forward -287 -269 12.8997 0.296
NP_440343.1_3 Forward -296 -278 8.47483 0.197
NP_440747.1_10 Reverse -220 -232 -4.28759 0.0903
NP_442973.1_5 Reverse -131 -150 9.63589 0.298
NP_440403.1_10 Forward -313 -294 3.93269 0.268
NP_442848.1_9 Forward -303 -284 14.4541 0.117
NP_442848.1_9 Reverse -289 -308 0.294447 0.275
NP_441634.1_5 Reverse -213 -227 17.4042 0.154
NP_441634.1_8 Reverse -336 -350 -0.688726 0.265
NP_440376.1_1 Forward -123 -114 1.47469 0.251
NP_442687.1_7 Forward -233 -223 4.99491 0.225
NP_442191.1_4 Reverse -179 -193 11.4779 0.256
NP_441846.1_10 Forward -67 -48 -22.715 0.264
NP_440642.1_10 Reverse -208 -222 2.45727 0.277
NP_440642.1_10 Reverse -62 -76 2.45727 0.277
NP_440642.1_10 Reverse -182 -196 2.06395 0.284
NP_440533.1_9 Forward -61 -42 2.45773 0.277
NP_440667.1_2 Reverse -361 -380 -2.45882 0.232
NP_442658.1_1 Reverse -286 -296 5.58445 0.262
NP_440141.1_8 Reverse -265 -284 7.27595 0.243
NP_441855.2_4 Forward -291 -272 12.4153 0.196
NP_442496.1_5 Reverse -333 -351 18.8987 0.0892
NP_442496.1_5 Forward -56 -38 5.91901 0.285
NP_439968.1_2 Forward -296 -277 15.2399 0.252
NP_441478.1_6 Forward -229 -210 18.6815 0.176
NP_442937.1_5 Reverse -212 -231 5.99764 0.293
NP_442321.1_4 Reverse -43 -62 -7.76869 0.284
NP_441958.1_5 Reverse -139 -149 0.373358 0.154
NP_442690.1_1 Reverse -11 -30 -10.4236 0.213
NP_442911.1_2 Reverse -264 -283 -8.55534 0.237
NP_440153.1_8 Forward -193 -180 -3.61896 0.296
NP_443055.1_6 Forward -219 -201 5.62325 0.179
NP_440993.1_3 Forward -366 -347 1.76863 0.225
NP_441099.1_5 Forward -159 -140 -10.0303 0.24
NP_442002.1_9 Forward -298 -291 13.0188 0.185
NP_442438.1_10 Forward -324 -310 0.196253 0.236
NP_442431.1_10 Reverse -274 -292 -0.7675 0.294
NP_440879.1_6 Forward -324 -305 -4.81876 0.29
NP_441752.1_6 Forward -290 -271 1.96607 0.254
NP_440605.1_4 Reverse -278 -297 14.7358 0.215
NP_442771.1_1 Forward -299 -281 -8.53565 0.198
NP_440147.1_4 Reverse -138 -151 7.29578 0.0712
NP_440206.1_9 Forward -329 -310 7.17762 0.293
NP_441041.1_7 Forward -152 -140 11.5962 0.0757
NP_441041.1_7 Forward -300 -288 9.1668 0.12
NP_441547.1_2 Reverse -315 -333 5.13236 0.228
NP_440703.1_9 Forward -238 -225 12.5067 0.192
NP_440703.1_9 Forward -192 -179 9.5568 0.216
NP_440703.1_9 Forward -193 -180 4.83694 0.293
NP_439966.1_9 Reverse -286 -295 6.68623 0.253
NP_440983.1_5 Forward -232 -213 -5.21209 0.265
NP_440260.1_8 Forward -313 -295 -2.14413 0.243
NP_441514.1_4 Reverse -128 -147 16.7744 0.185
NP_441678.1_9 Reverse -328 -347 -4.91709 0.297
NP_442281.1_1 Forward -302 -288 5.40719 0.159
NP_442281.1_1 Reverse -290 -304 3.73557 0.221
NP_442281.1_1 Forward -154 -140 1.5723 0.296
NP_441334.1_7 Forward -321 -302 -14.6519 0.273
NP_440723.1_8 Reverse -354 -368 13.3726 0.178
NP_441556.1_4 Forward -241 -222 16.5608 0.119
NP_441644.1_6 Forward -149 -139 3.42118 0.282
NP_440867.1_10 Forward -314 -295 6.29264 0.256
NP_442215.1_2 Reverse -286 -302 2.02515 0.123
NP_442215.1_2 Reverse -221 -237 -2.30141 0.195
NP_442215.1_2 Reverse -311 -327 -6.33298 0.268
NP_442215.1_2 Reverse -175 -191 -6.62797 0.277
NP_441346.1_7 Reverse -36 -55 14.2574 0.183
NP_442554.1_8 Forward -318 -308 5.68323 0.141
NP_442075.1_5 Reverse -330 -349 16.4673 0.246
NP_441762.1_7 Forward -298 -286 -6.05754 0.268
NP_442313.1_6 Reverse -176 -195 16.1257 0.12
NP_442142.1_4 Forward -286 -273 3.46031 0.255
NP_440919.1_1 Reverse -260 -279 -8.16202 0.286
NP_442476.1_1 Forward -152 -133 11.6018 0.265
NP_442476.1_6 Forward -296 -282 8.35772 0.103
NP_440895.1_6 Reverse -217 -230 9.2624 0.228
NP_443009.1_5 Forward -298 -287 14.1195 0.024
NP_443009.1_5 Reverse -139 -150 9.69459 0.0913
NP_443009.1_5 Forward -150 -139 6.74468 0.15
NP_442301.1_2 Forward -290 -271 4.62021 0.275
NP_442301.1_2 Forward -293 -274 3.34192 0.296
NP_440357.1_3 Reverse -286 -305 5.99764 0.242
NP_441448.1_1 Forward -330 -311 3.93269 0.285
NP_442076.1_5 Forward -392 -373 10.2259 0.186
NP_441198.1_8 Forward -151 -141 12.1971 0.15
NP_440379.1_5 Forward -313 -294 -2.0655 0.194
NP_439939.1_6 Forward -298 -279 11.8975 0.285
NP_441020.2_6 Reverse -272 -289 5.64371 0.293
NP_441015.1_10 Reverse -218 -237 -8.65367 0.276
NP_441731.1_2 Forward -312 -293 17.994 0.142
NP_441426.1_6 Reverse -208 -227 18.6823 0.0727
NP_442811.1_2 Reverse -215 -234 -1.27885 0.256
NP_442719.1_2 Reverse -33 -51 -11.2896 0.291
NP_443058.1_7 Reverse -319 -338 1.86774 0.294
NP_442808.1_1 Forward -284 -274 5.38779 0.155
NP_442808.1_1 Reverse -294 -304 5.19112 0.168
NP_440145.1_4 Forward -282 -272 16.3025 0.141
NP_442718.1_2 Forward -32 -13 -7.27704 0.3
NP_440558.1_2 Reverse -180 -199 4.81767 0.148
NP_440558.1_2 Forward -196 -177 -7.67036 0.298
NP_441878.1_6 Reverse -202 -212 -7.59145 0.245
NP_441878.1_6 Forward -305 -295 -7.59145 0.245
NP_441878.1_6 Forward -298 -288 -7.59145 0.245
NP_441036.1_8 Reverse -287 -297 6.27322 0.239
NP_442503.1_9 Reverse -210 -229 6.78429 0.272
NP_441557.1_5 Reverse -140 -149 -0.885252 0.26
NP_441557.1_8 Forward -282 -272 10.796 0.275
NP_441520.1_9 Forward -232 -213 9.43923 0.279
NP_441445.1_8 Forward -327 -308 6.09597 0.102
NP_442066.2_4 Reverse -140 -159 7.7676 0.0828
NP_442066.2_9 Forward -268 -255 6.50913 0.284
NP_442777.1_3 Forward -290 -272 6.50823 0.22
NP_442183.1_1 Forward -297 -283 7.07942 0.149
NP_440440.1_2 Forward -300 -281 14.2566 0.27
NP_441459.1_8 Forward -239 -226 12.3107 0.286
NP_441574.1_1 Reverse -283 -302 -5.21209 0.26
NP_440276.1_2 Forward -75 -56 13.193 0.217
NP_441037.1_4 Reverse -272 -282 12.288 0.109
NP_442594.1_8 Reverse -271 -290 2.85105 0.293
NP_442317.1_6 Reverse -135 -154 10.6192 0.211
NP_441633.1_3 Reverse -286 -299 -2.83231 0.177
NP_442764.1_3 Forward -298 -288 15.418 0.295
NP_440136.1_2 Reverse -289 -296 3.97235 0.288
NP_442590.1_9 Reverse -303 -322 6.29264 0.261
NP_440899.1_8 Reverse -373 -392 2.45773 0.131
NP_440899.1_8 Reverse -97 -116 -1.47551 0.21
NP_440299.1_1 Reverse -16 -29 5.32859 0.18
NP_440299.1_1 Forward -236 -223 2.67367 0.279
NP_440299.1_1 Reverse -306 -319 2.47701 0.288
NP_441799.1_1 Reverse -136 -150 6.0955 0.183
NP_440087.1_1 Reverse -338 -357 -6.1954 0.252
NP_441090.1_6 Forward -329 -315 8.25939 0.276
NP_442007.1_8 Reverse -287 -305 11.1298 0.258
NP_440915.1_6 Forward -153 -139 2.35953 0.119
NP_440915.1_6 Reverse -284 -298 -1.96703 0.254
NP_440717.1_3 Forward -280 -266 7.47213 0.28
NP_441464.1_2 Forward -290 -280 16.008 0.233
NP_441494.1_6 Forward -154 -141 10.639 0.225
NP_442993.1_1 Forward -304 -288 -12.9212 0.282
NP_442386.1_9 Reverse -287 -296 9.14408 0.172
NP_441271.1_8 Forward -396 -386 13.4514 0.29
NP_440168.1_9 Reverse -209 -228 4.22769 0.227
NP_442506.1_2 Forward -231 -212 7.37428 0.269
NP_442474.1_9 Reverse -314 -333 14.7491 0.128
NP_440161.1_3 Forward -151 -132 14.2574 0.121
NP_440586.1_1 Reverse -270 -289 -5.99873 0.292
NP_440192.1_4 Reverse -308 -327 13.3754 0.169
NP_440027.1_3 Reverse -294 -312 5.52492 0.24
NP_443051.1_1 Reverse -139 -148 -0.000272808 0.245
NP_439937.1_8 Forward -231 -212 -3.54046 0.27
NP_439937.1_9 Forward -284 -267 -5.2717 0.157
NP_440836.1_6 Reverse -104 -118 11.111 0.227
NP_442384.1_10 Reverse -223 -236 4.34585 0.16
NP_442339.1_2 Reverse -260 -279 16.4207 0.255
NP_441877.1_9 Forward -183 -166 4.16874 0.284
NP_441018.1_7 Reverse -213 -232 13.6675 0.132
NP_442790.1_4 Forward -315 -296 -15.9302 0.3
NP_442244.1_6 Reverse -307 -326 -0.590531 0.291
NP_440344.1_10 Forward -130 -113 -11.2692 0.208
NP_440282.1_10 Forward -230 -211 9.0459 0.11
NP_440531.1_6 Reverse -25 -44 -4.81876 0.287
NP_440826.1_5 Forward -220 -202 14.5117 0.233
NP_442832.1_3 Reverse -1 -20 13.3725 0.248
NP_440562.1_5 Forward -363 -344 3.6377 0.261
NP_442750.1_3 Reverse -271 -290 -10.817 0.236
NP_442693.1_7 Forward -124 -105 8.16093 0.275
NP_442280.1_10 Reverse -310 -328 13.5387 0.141
NP_441896.1_3 Reverse -279 -298 5.11266 0.131
NP_440999.1_9 Forward -338 -324 0.392915 0.187
NP_440999.1_9 Forward -153 -139 0.294584 0.189
NP_440888.1_2 Forward -297 -283 5.21053 0.288
NP_442147.1_7 Forward -306 -287 12.3892 0.233
NP_441462.1_2 Reverse -140 -150 -0.314959 0.206
NP_442872.1_1 Forward -291 -272 -12.5869 0.255
NP_440516.1_6 Reverse -211 -225 10.422 0.226
NP_440516.1_6 Forward -283 -269 8.65209 0.246
NP_442120.1_10 Reverse -140 -159 8.55425 0.141
NP_442120.1_10 Forward -186 -167 -4.13045 0.199
NP_442120.1_10 Forward -155 -136 -7.37537 0.219
NP_441867.1_2 Reverse -331 -350 -11.7019 0.231
NP_441867.1_2 Reverse -256 -275 -12.3902 0.253
NP_440673.1_3 Reverse -225 -232 7.41394 0.263
NP_440673.1_3 Reverse -179 -186 6.23397 0.283
NP_442705.1_10 Forward -36 -17 4.22769 0.266
NP_441733.1_10 Reverse -285 -298 4.8375 0.24
NP_441004.1_1 Reverse -268 -287 -0.983855 0.124
NP_441004.1_1 Reverse -259 -278 -4.22878 0.169
NP_441004.1_1 Forward -238 -219 -17.7001 0.294
NP_441004.1_2 Reverse -263 -282 1.76941 0.217
NP_441004.1_5 Reverse -270 -284 13.1759 0.223
NP_442813.1_4 Reverse -208 -227 -8.85033 0.299
NP_442366.1_3 Forward -233 -215 3.85406 0.104
NP_440296.1_10 Forward -322 -303 -15.2418 0.29
NP_442430.1_10 Forward -159 -140 15.4366 0.121
NP_441851.1_3 Reverse -200 -219 8.45592 0.299
NP_441851.1_10 Forward -298 -288 13.7464 0.028
NP_442622.1_1 Reverse -309 -328 -12.9802 0.282
NP_441542.1_4 Forward -362 -348 15.4376 0.235
NP_441668.1_4 Reverse -130 -149 10.3242 0.109
NP_441668.1_4 Reverse -264 -283 1.67108 0.212
NP_442843.1_1 Forward -303 -284 -10.4236 0.278
NP_439960.1_4 Reverse -246 -265 12.4867 0.28
NP_439960.1_10 Reverse -294 -312 -0.472507 0.231
NP_442944.1_10 Forward -345 -326 8.84924 0.269
NP_440396.1_1 Forward -208 -189 5.70265 0.156
NP_440726.1_2 Forward -326 -307 18.3873 0.0667
NP_442450.1_5 Forward -299 -289 5.78156 0.227
NP_440588.1_2 Reverse -214 -233 3.34271 0.103
NP_440195.1_4 Reverse -344 -363 5.30933 0.288
NP_442006.1_2 Forward -220 -203 -17.3657 0.274
NP_441078.1_4 Reverse -114 -123 3.14632 0.15
NP_441078.1_4 Forward -297 -288 -1.96689 0.282
NP_442729.1_5 Reverse -273 -283 8.82982 0.244
NP_442729.1_8 Forward -236 -223 5.62415 0.238
NP_441528.1_2 Forward -307 -288 10.0284 0.255
NP_441094.1_7 Forward -330 -311 21.7221 0.0519
NP_441432.1_8 Reverse -139 -148 8.1612 0.0815
NP_442344.1_1 Forward -223 -204 17.7974 0.0817
NP_442344.1_7 Reverse -289 -308 -9.44032 0.251
NP_441945.1_10 Reverse -267 -286 6.98095 0.291
NP_441805.1_2 Reverse -350 -369 13.5691 0.0327
NP_441057.1_3 Reverse -99 -118 -10.9153 0.214
NP_442407.1_2 Reverse -200 -219 14.3549 0.138
NP_440713.1_9 Reverse -277 -296 14.3558 0.279
NP_442489.1_7 Forward -149 -140 -1.86856 0.259
NP_442489.1_7 Forward -297 -288 -1.96689 0.28
NP_442489.1_7 Reverse -140 -149 -1.96689 0.28
NP_440559.1_1 Reverse -289 -298 4.32629 0.288
NP_441659.2_8 Forward -232 -222 2.14332 0.211
NP_441659.2_8 Reverse -295 -305 1.06167 0.251
NP_442749.1_5 Forward -189 -172 8.51291 0.233
NP_440363.1_9 Reverse -305 -323 12.4089 0.281
NP_442346.1_5 Forward -233 -223 9.41981 0.118
NP_440545.1_3 Reverse -306 -323 -6.15601 0.27
NP_440025.1_3 Reverse -37 -51 9.93309 0.29
NP_440459.1_2 Forward -195 -178 14.4935 0.119
NP_442311.1_5 Reverse -344 -363 2.55606 0.251
NP_441585.1_5 Forward -329 -310 6.78348 0.211
NP_441888.1_7 Forward -267 -253 4.32615 0.225
NP_441047.1_2 Forward -92 -73 3.93269 0.229
NP_441329.1_6 Forward -75 -56 1.09773 0.244
NP_441973.1_1 Reverse -214 -229 19.2528 0.073
NP_442140.1_3 Reverse -296 -306 6.37155 0.172
NP_442497.1_10 Reverse -289 -298 0.393051 0.175
NP_440821.1_4 Reverse -286 -296 5.28991 0.116
NP_440227.1_2 Reverse -156 -172 12.2516 0.271
NP_441239.1_9 Reverse -286 -298 13.9036 0.0335
NP_441727.1_3 Reverse -204 -223 2.65439 0.299
NP_441892.1_1 Reverse -301 -318 -5.1727 0.275
NP_441892.1_1 Reverse -286 -303 -5.66436 0.285
NP_442044.1_1 Forward -297 -278 1.57275 0.153
NP_442044.1_1 Forward -219 -200 -14.4552 0.291
NP_442270.1_9 Reverse -212 -231 -9.24366 0.228
NP_440900.1_4 Reverse -185 -204 15.651 0.271
NP_440833.1_6 Forward -151 -137 10.2254 0.255
NP_442809.1_6 Forward -198 -179 5.211 0.256
NP_442499.1_4 Forward -195 -181 10.226 0.276
NP_442402.1_4 Forward -343 -324 -4.32786 0.224
NP_441848.1_4 Reverse -162 -178 15.381 0.154
NP_441848.1_4 Reverse -133 -149 9.26952 0.287
NP_440653.1_10 Reverse -314 -333 4.12936 0.252
NP_442882.1_7 Forward -304 -290 12.3887 0.261
NP_442039.1_4 Forward -296 -289 10.8555 0.109
NP_442679.1_1 Forward -83 -64 -4.72043 0.283
NP_440008.1_9 Reverse -217 -236 6.98095 0.283
NP_441926.1_3 Forward -356 -340 2.71347 0.257
NP_440505.1_7 Forward -341 -322 3.14605 0.22
NP_442360.1_5 Forward -328 -318 12.6647 0.298
NP_441011.1_8 Forward -303 -294 7.07956 0.179
NP_442533.1_1 Reverse -323 -342 -8.55534 0.209
NP_442533.1_6 Reverse -184 -193 2.16301 0.27
NP_442232.1_9 Forward -328 -309 12.6833 0.248
NP_440854.1_6 Reverse -85 -104 14.2756 0.26
NP_442229.1_1 Reverse -286 -300 10.2254 0.184
NP_443016.1_10 Forward -313 -294 10.5209 0.235
NP_441482.1_7 Forward -193 -179 -11.6035 0.275
NP_442269.1_10 Reverse -218 -237 6.19431 0.232
NP_442269.1_10 Reverse -236 -255 3.34271 0.252
NP_440116.1_5 Reverse -187 -204 5.05372 0.176
NP_440116.1_8 Reverse -289 -308 -8.94866 0.264
NP_441527.1_4 Forward -74 -55 7.01823 0.0961
NP_441527.1_4 Forward -72 -53 -10.3613 0.27
NP_441527.1_4 Forward -162 -143 -11.6982 0.284
NP_441527.1_8 Forward -154 -135 5.60432 0.279
NP_441815.1_6 Forward -282 -263 -0.0996487 0.291
NP_439903.1_6 Forward -152 -133 6.48849 0.167
NP_441286.1_1 Reverse -222 -234 -5.07423 0.188
NP_442674.1_1 Forward -388 -369 11.0468 0.252
NP_440670.1_8 Forward -297 -288 3.44131 0.267
NP_440886.1_7 Forward -284 -274 6.37109 0.13
NP_440828.1_1 Reverse -296 -315 -1.67294 0.287
NP_440828.1_4 Forward -293 -274 -0.00131823 0.19
NP_442072.1_9 Reverse -139 -157 -13.3539 0.11
NP_442401.1_3 Reverse -274 -293 15.9291 0.175
NP_442022.1_4 Reverse -217 -236 10.5209 0.224
NP_442022.1_4 Reverse -326 -345 9.24257 0.254
NP_440907.2_8 Forward -296 -286 4.7978 0.243
NP_442264.1_2 Reverse -173 -190 7.41366 0.24
NP_441021.1_1 Reverse -141 -160 -0.4922 0.103
NP_442842.1_10 Reverse -53 -72 4.63975 0.216
NP_442794.1_1 Reverse -219 -231 8.9871 0.0865
NP_442615.1_1 Reverse -131 -149 -3.91409 0.171
NP_441962.1_4 Forward -154 -135 -2.36049 0.132
NP_441836.1_2 Forward -325 -306 -3.83545 0.244
NP_441993.1_1 Forward -322 -303 2.1416 0.262
NP_442084.1_6 Reverse -352 -370 7.59063 0.221
NP_440114.1_10 Forward -149 -135 9.34103 0.177
NP_442698.1_10 Forward -36 -17 3.44104 0.279
NP_440293.1_3 Forward -305 -286 -0.0988766 0.228
NP_440293.1_6 Forward -229 -210 5.89931 0.219
NP_440293.1_10 Reverse -271 -290 -0.885524 0.264
NP_440766.1_4 Forward -308 -294 2.65453 0.176
NP_439998.1_10 Forward -65 -46 7.7676 0.0864
NP_442930.1_1 Reverse -170 -180 14.0409 0.239
NP_440457.1_1 Forward -308 -296 3.48056 0.195
NP_441801.1_4 Forward -279 -269 2.53664 0.292
NP_441332.1_3 Reverse -202 -221 18.7807 0.162
NP_441436.1_9 Forward -344 -334 18.4657 0.168
NP_442509.1_9 Reverse -288 -298 8.73102 0.192
NP_442509.1_9 Reverse -223 -233 7.74772 0.205
NP_442936.1_5 Reverse -56 -75 23.2056 0.00739
NP_442936.1_7 Reverse -9 -28 24.9755 0.00184
NP_442936.1_10 Forward -181 -167 7.25408 0.288
NP_442514.1_5 Forward -200 -181 -9.34271 0.295
NP_442341.1_7 Reverse -294 -308 3.34284 0.227
NP_442341.1_7 Reverse -113 -127 2.94952 0.239
NP_442341.1_7 Forward -124 -110 1.08123 0.299
NP_440686.1_1 Forward -26 -7 4.12936 0.253
NP_443000.1_7 Forward -19 -9 1.35667 0.251
NP_441842.1_10 Reverse -267 -281 6.3911 0.291
NP_440091.1_1 Forward -323 -311 0.530633 0.247
NP_442275.1_1 Reverse -310 -329 2.75272 0.284
NP_440679.1_10 Reverse -276 -295 -20.5517 0.286
NP_441389.1_5 Reverse -326 -345 13.4708 0.219
NP_439962.1_4 Reverse -293 -312 -8.65367 0.298
NP_442495.1_5 Reverse -284 -303 9.3409 0.287
NP_442495.1_5 Reverse -277 -296 5.50599 0.291
NP_441105.1_3 Reverse -172 -191 -5.50708 0.22
NP_441105.1_3 Forward -160 -141 -6.49039 0.236
NP_442373.1_2 Reverse -271 -290 -10.1286 0.272
NP_440216.1_9 Reverse -122 -131 12.1928 0.247
NP_440216.1_9 Forward -185 -176 8.75118 0.286
NP_440172.1_1 Reverse -140 -150 13.5497 0.0202
NP_442834.1_9 Reverse -317 -336 4.12936 0.298
NP_442379.1_10 Forward -156 -139 -4.18939 0.288
NP_440416.1_9 Reverse -293 -312 -16.6185 0.218
NP_440416.1_9 Forward -330 -311 -21.6334 0.295
NP_443052.1_9 Reverse -293 -312 4.71934 0.149
NP_442403.1_9 Reverse -217 -236 7.7676 0.191
NP_442154.1_1 Reverse -272 -290 -5.78238 0.127
NP_442154.1_1 Reverse -311 -329 -9.51896 0.181
NP_442154.1_1 Reverse -275 -293 -13.8455 0.217
NP_440261.1_5 Reverse -289 -302 -10.6988 0.203
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGGCTCAGGTTGAGTACAACGGAAAATAACTCCACTGCTTCGGCATAATTGCCTGCTTCCCCAGCTTTAACCCCCTGGGCAAAGATGGCCTCCGGTGCTATGGGCGATTCCAGCACCACCATCTCCCCAGTTACTCCAGGCCGCTCTAAGGCTAAATTCATTCCTAGGGCGACCATCAAGGCCAAAGGGACATTGACCAATAGGCTAGCCAAGGGCAACGGAAATTTTTTTTGACTTAAACTAAGGCAGAAGCAATTGCCTAAATTAACTTTCATTGGGTATAGGCAAGATCAGGCTAAAAAGTATTGCAACATACATAGCCGGTAAACAAAGGAAGAGAAAATGGATTGGGAACTGTGCCAAAGATATCAAAGATAGCAAAAGTGATCAAGCAAAGCT

CDS

ATGGAATTTACCTTTTTACTACCCCTGACTATCGGCTTAATAGTTGGTTATAAAGCGTGGGGTTCTCGCCATGATATTGCCCATCTGGCAGTAATTTTTGCCGTTGCGAATCTATTGGCAAGTTTACTCTTGGCTCCCTGGGAAATCAAAGTTATCTTGCTGATACTGGCGGCCATTGTAGTTGGGCCTTTATGGCAAAGCTTTGACAGTAAAAATAATCTTCCCAATACTCAAATTATCGACAGTAAGGATACAGAGCTTCATTACCGTGGCATTAGTTACGAATCGCCCAAATCAACAGTTCCCATCGAGAAAACTGAGAAAATAAGTAAATGTTATCGGGGAATCGACTATGAATCTTCTGGAACACATACGGCCCAGAATAACGAAGTAAAAGGAAAAGCAATCAAATACCGTGGCGTTGATATAGGAACTAAAACCCAAGACTAA

Protein

MEFTFLLPLTIGLIVGYKAWGSRHDIAHLAVIFAVANLLASLLLAPWEIKVILLILAAIVVGPLWQSFDSKNNLPNTQIIDSKDTELHYRGISYESPKSTVPIEKTEKISKCYRGIDYESSGTHTAQNNEVKGKAIKYRGVDIGTKTQD