Your browser is old and dusty. Try Google Chrome!

Details for sll0726

ORF sll0726
Accession NP_442947.1
Symbol
Category Polysaccharides and glycoproteins
Definition phosphoglucomutase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -396 -377 -30.4831 0.28
NP_442272.1_1 Reverse -253 -271 19.0049 0.0652
NP_441453.1_7 Reverse -76 -83 11.9372 0.298
NP_442151.1_1 Forward -129 -110 3.24438 0.291
NP_441818.1_9 Forward -134 -115 -8.26035 0.276
NP_440259.1_4 Forward -103 -89 11.046 0.262
NP_442752.1_4 Forward -340 -333 5.54565 0.194
NP_443027.1_4 Forward -342 -332 6.56821 0.275
NP_441054.1_2 Forward -118 -99 16.4207 0.132
NP_442062.1_3 Forward -268 -249 0.786102 0.232
NP_440304.1_4 Forward -354 -344 3.42162 0.299
NP_442110.1_7 Reverse -33 -47 -0.197071 0.276
NP_440014.1_2 Forward -369 -351 11.5239 0.276
NP_441083.1_5 Reverse -125 -135 -0.216628 0.261
NP_442889.1_8 Reverse -122 -136 8.65209 0.114
NP_440407.1_6 Reverse -41 -55 13.5693 0.225
NP_440447.1_1 Reverse -46 -64 2.37909 0.284
NP_442570.1_3 Forward -142 -123 4.81767 0.159
NP_442570.1_3 Forward -46 -27 -9.53865 0.299
NP_441716.1_1 Forward -149 -135 4.81781 0.248
NP_442111.1_4 Reverse -386 -400 7.07942 0.105
NP_440343.1_7 Forward -56 -37 18.879 0.153
NP_440747.1_10 Forward -137 -125 -4.28759 0.0903
NP_440403.1_10 Reverse -283 -302 3.53937 0.273
NP_440842.1_6 Reverse -18 -37 11.3067 0.261
NP_440842.1_10 Reverse -122 -136 1.96621 0.281
NP_441014.1_10 Forward -150 -131 2.75194 0.216
NP_443018.1_3 Forward -47 -40 7.11894 0.16
NP_441634.1_9 Forward -144 -125 12.9783 0.191
NP_441634.1_9 Forward -128 -109 10.4217 0.252
NP_440376.1_1 Forward -134 -125 3.24465 0.206
NP_441588.1_4 Forward -323 -313 6.07655 0.214
NP_441077.1_6 Forward -264 -248 9.26113 0.176
NP_441846.1_10 Forward -368 -349 -22.2233 0.257
NP_440642.1_10 Forward -57 -43 3.73557 0.265
NP_441013.1_2 Forward -145 -127 3.55906 0.23
NP_440656.1_8 Reverse -129 -148 -8.55534 0.273
NP_442544.1_2 Forward -21 -7 -1.47537 0.287
NP_441414.1_9 Forward -384 -365 -7.27704 0.214
NP_442685.1_2 Forward -239 -229 13.7464 0.289
NP_442816.1_7 Forward -168 -149 14.7531 0.084
NP_442876.1_6 Forward -272 -254 10.2196 0.298
NP_443001.1_7 Forward -146 -127 1.57275 0.279
NP_439990.1_5 Reverse -76 -89 6.01747 0.261
NP_442690.1_1 Reverse -252 -271 -7.57203 0.175
NP_442690.1_1 Forward -110 -91 -16.6185 0.29
NP_442911.1_2 Forward -311 -292 -7.57203 0.214
NP_441580.1_6 Forward -351 -332 -8.94866 0.277
NP_442064.1_4 Forward -144 -125 9.53674 0.204
NP_443055.1_6 Forward -201 -183 4.54162 0.181
NP_440993.1_4 Reverse -125 -142 1.90713 0.3
NP_441099.1_5 Reverse -115 -134 -4.52377 0.146
NP_441550.1_8 Reverse -123 -133 4.60114 0.299
NP_441916.1_7 Forward -44 -34 1.55333 0.282
NP_441041.1_7 Reverse -89 -101 4.98816 0.282
NP_440260.1_8 Forward -187 -169 0.117479 0.202
NP_440260.1_8 Forward -143 -125 -2.73412 0.245
NP_441514.1_4 Reverse -243 -262 12.1147 0.294
NP_442281.1_1 Reverse -120 -134 6.78381 0.115
NP_441079.1_7 Forward -264 -245 -5.50783 0.266
NP_001035871.2_7 Forward -82 -72 16.4996 0.14
NP_442500.1_8 Reverse -61 -75 8.9251 0.285
NP_441644.1_6 Reverse -125 -135 5.87944 0.174
NP_442215.1_2 Forward -354 -338 0.943514 0.144
NP_442215.1_2 Forward -57 -41 -4.95634 0.242
NP_442029.1_10 Forward -149 -130 6.58763 0.284
NP_442247.1_5 Reverse -231 -245 16.4927 0.234
NP_442247.1_5 Reverse -146 -160 14.1043 0.267
NP_440780.1_1 Reverse -88 -107 7.68668 0.274
NP_441751.2_8 Reverse -344 -358 -6.29359 0.259
NP_442554.1_8 Reverse -29 -39 2.43831 0.272
NP_442554.1_8 Forward -133 -123 2.14332 0.281
NP_440397.1_2 Reverse -283 -302 9.43923 0.289
NP_441448.1_7 Forward -365 -346 6.4893 0.26
NP_441876.1_9 Forward -147 -137 11.4843 0.275
NP_441826.1_2 Forward -358 -344 -2.16369 0.267
NP_441826.1_2 Reverse -29 -43 -4.32697 0.295
NP_442745.1_6 Reverse -32 -51 10.9142 0.268
NP_442490.1_10 Reverse -124 -142 7.68896 0.292
NP_441764.1_6 Forward -341 -330 16.7749 0.253
NP_441764.1_8 Reverse -87 -97 13.5119 0.284
NP_442719.1_2 Forward -107 -89 -11.1913 0.29
NP_440785.1_1 Reverse -83 -102 5.211 0.119
NP_440785.1_2 Forward -325 -306 4.71934 0.277
NP_441612.1_2 Forward -340 -330 11.6473 0.21
NP_442808.1_1 Forward -45 -35 4.50281 0.197
NP_440145.1_3 Reverse -18 -37 6.98095 0.0495
NP_441114.1_3 Reverse -382 -391 6.39124 0.277
NP_441518.1_3 Reverse -130 -149 -6.78538 0.145
NP_441878.1_6 Forward -135 -125 0.963343 0.128
NP_441878.1_6 Reverse -124 -134 -0.0199663 0.163
NP_441590.1_4 Reverse -110 -129 9.34008 0.249
NP_441549.1_9 Reverse -371 -389 -6.27403 0.198
NP_442347.1_2 Reverse -332 -341 8.65285 0.0792
NP_442347.1_2 Forward -148 -139 8.45619 0.0886
NP_442645.1_2 Reverse -31 -50 -22.9117 0.299
NP_442594.1_8 Forward -368 -349 1.96607 0.295
NP_442594.1_10 Reverse -356 -375 9.43841 0.28
NP_441633.1_3 Reverse -341 -354 -4.89726 0.216
NP_442590.1_10 Forward -130 -111 3.83436 0.283
NP_440299.1_1 Reverse -383 -396 2.37867 0.291
NP_440640.1_6 Reverse -206 -225 3.14605 0.227
NP_440256.1_1 Reverse -111 -130 -2.95047 0.125
NP_440256.1_1 Reverse -328 -347 -9.53865 0.281
NP_441362.1_2 Reverse -233 -252 12.2561 0.243
NP_441090.1_6 Reverse -39 -53 11.0127 0.221
NP_441090.1_6 Reverse -124 -138 7.66941 0.284
NP_440709.1_1 Reverse -223 -242 7.76679 0.109
NP_441559.1_8 Forward -48 -34 -6.49025 0.279
NP_440915.1_6 Reverse -172 -186 -2.65535 0.278
NP_440717.1_1 Reverse -381 -400 7.07928 0.265
NP_440717.1_3 Reverse -353 -367 12.782 0.227
NP_442947.1_1 Forward -162 -145 28.1615 0.000817
NP_442069.1_4 Reverse -17 -36 6.39097 0.245
NP_442866.1_1 Forward -129 -110 -1.18052 0.202
NP_441464.1_8 Reverse -343 -357 4.52282 0.269
NP_441464.1_10 Forward -136 -122 7.9644 0.287
NP_440695.1_5 Reverse -197 -216 -2.36049 0.299
NP_441939.1_3 Forward -184 -165 5.50599 0.273
NP_440570.1_5 Reverse -71 -90 0.491109 0.254
NP_441340.1_9 Reverse -88 -98 7.58037 0.256
NP_440639.1_4 Forward -57 -38 13.5683 0.25
NP_442240.1_1 Reverse -335 -354 3.44025 0.29
NP_441027.1_1 Reverse -19 -33 11.307 0.277
NP_440027.1_8 Forward -47 -28 5.60352 0.279
NP_440408.1_7 Forward -352 -333 9.93088 0.253
NP_440372.1_3 Forward -268 -254 14.2399 0.209
NP_442887.1_5 Reverse -373 -392 -8.752 0.264
NP_441018.1_7 Forward -138 -119 6.98095 0.278
NP_442262.1_10 Forward -47 -40 8.20058 0.25
NP_440531.1_6 Forward -142 -123 6.09597 0.112
NP_442280.1_10 Forward -47 -29 10.227 0.223
NP_440888.1_2 Reverse -351 -365 5.01387 0.298
NP_442454.1_2 Forward -260 -241 7.30471 0.291
NP_441771.1_4 Reverse -87 -106 7.96426 0.192
NP_442845.1_2 Reverse -170 -184 3.73617 0.279
NP_441178.1_6 Reverse -115 -134 2.75194 0.27
NP_442337.1_8 Forward -20 -1 0.687771 0.245
NP_441462.1_2 Forward -134 -124 -0.904945 0.265
NP_440911.1_1 Forward -238 -219 16.4199 0.212
NP_441443.1_1 Forward -360 -341 -1.96717 0.256
NP_441052.1_2 Forward -90 -80 1.25834 0.249
NP_442219.1_9 Forward -383 -374 2.458 0.27
NP_442219.1_9 Forward -148 -139 2.26134 0.28
NP_441884.1_9 Reverse -122 -141 -26.7466 0.29
NP_441321.1_5 Reverse -19 -38 2.65439 0.285
NP_441004.1_1 Forward -116 -97 -6.58872 0.19
NP_441004.1_1 Reverse -200 -219 -11.8986 0.243
NP_442366.1_3 Forward -45 -27 -4.99573 0.28
NP_442206.1_10 Reverse -125 -140 0.569883 0.254
NP_441851.1_2 Forward -119 -100 4.12936 0.186
NP_441668.1_4 Reverse -19 -38 2.0644 0.205
NP_441668.1_4 Forward -111 -92 -2.95047 0.299
NP_441668.1_5 Forward -112 -93 13.9625 0.22
NP_441982.1_6 Reverse -9 -18 12.2944 0.286
NP_442689.1_8 Forward -68 -51 -6.54933 0.285
NP_442314.1_1 Reverse -107 -125 -4.11075 0.256
NP_440432.1_9 Reverse -317 -332 -2.8717 0.176
NP_440726.1_2 Reverse -127 -146 8.45592 0.194
NP_441477.1_5 Reverse -110 -129 10.7175 0.268
NP_440431.1_3 Forward -253 -234 -11.4069 0.286
NP_440431.1_4 Reverse -48 -67 -8.06949 0.275
NP_440431.1_4 Reverse -49 -68 -8.54695 0.275
NP_442168.1_6 Forward -152 -133 12.7825 0.202
NP_441003.1_9 Forward -143 -124 17.109 0.207
NP_441570.1_1 Forward -149 -131 -11.5839 0.198
NP_441570.1_1 Reverse -125 -143 -17.6804 0.287
NP_441078.1_4 Forward -134 -125 -1.86856 0.272
NP_442443.1_1 Forward -189 -170 -6.88371 0.299
NP_440793.1_1 Forward -66 -52 10.8154 0.279
NP_440526.1_3 Reverse -344 -355 0.353199 0.287
NP_441432.1_8 Forward -295 -286 3.14632 0.259
NP_441432.1_9 Forward -105 -92 9.95576 0.26
NP_442003.1_9 Reverse -198 -217 6.29264 0.235
NP_441057.1_4 Forward -144 -126 -3.02911 0.278
NP_442968.1_8 Forward -127 -108 16.4207 0.116
NP_442489.1_7 Forward -134 -125 -1.37691 0.195
NP_441659.2_8 Reverse -125 -135 3.61828 0.154
NP_441040.1_1 Forward -22 -3 12.7825 0.235
NP_440831.1_3 Forward -143 -124 6.9696 0.268
NP_440486.1_6 Forward -124 -105 6.09597 0.283
NP_440459.1_2 Forward -46 -29 8.49531 0.259
NP_440010.1_10 Forward -146 -127 12.9791 0.19
NP_442311.1_5 Reverse -96 -115 2.0644 0.254
NP_442603.1_7 Forward -384 -370 5.70218 0.277
NP_441050.1_5 Forward -87 -69 4.14905 0.194
NP_441050.1_5 Forward -393 -375 -2.73412 0.284
NP_441329.1_6 Forward -255 -236 1.86167 0.231
NP_441895.1_10 Forward -245 -226 -18.8801 0.282
NP_440224.1_1 Forward -351 -332 3.24438 0.132
NP_440875.1_9 Reverse -333 -343 7.98268 0.251
NP_440594.1_3 Forward -44 -26 12.8022 0.25
NP_442028.1_1 Forward -68 -55 11.1388 0.251
NP_441239.1_9 Reverse -348 -360 4.36554 0.253
NP_440665.1_1 Forward -146 -127 -14.2585 0.261
NP_441508.1_1 Forward -241 -222 12.0953 0.233
NP_440833.1_6 Reverse -90 -104 7.96378 0.277
NP_440546.1_4 Forward -134 -124 9.17338 0.151
NP_440462.1_4 Forward -125 -111 9.83269 0.242
NP_440462.1_4 Forward -141 -127 9.34103 0.243
NP_440462.1_6 Forward -342 -332 4.0116 0.219
NP_442479.1_5 Forward -108 -89 5.4628 0.286
NP_442479.1_9 Reverse -90 -109 0.982764 0.191
NP_442402.1_4 Forward -104 -85 -9.73604 0.292
NP_441848.1_4 Forward -108 -92 12.2298 0.208
NP_441848.1_4 Reverse -53 -69 9.36501 0.285
NP_440696.1_3 Forward -48 -30 -2.43913 0.274
NP_440696.1_3 Forward -117 -99 -3.81576 0.29
NP_442679.1_1 Reverse -44 -63 3.83436 0.147
NP_442679.1_1 Forward -376 -357 -2.26216 0.24
NP_442837.1_3 Forward -148 -141 7.11894 0.173
NP_442837.1_3 Reverse -332 -339 6.52896 0.2
NP_442053.1_1 Reverse -125 -134 5.70292 0.172
NP_441701.1_7 Reverse -123 -142 11.6025 0.226
NP_442844.1_5 Forward -65 -46 3.53858 0.26
NP_441011.1_8 Forward -26 -17 5.3096 0.271
NP_442533.1_6 Reverse -125 -134 11.8978 0.0362
NP_442533.1_6 Forward -37 -28 2.16301 0.27
NP_442533.1_6 Forward -48 -39 1.76968 0.289
NP_442541.1_10 Forward -48 -34 1.27731 0.287
NP_442322.1_4 Reverse -350 -367 -4.09173 0.253
NP_439944.1_9 Forward -293 -283 6.17489 0.192
NP_441697.1_5 Reverse -246 -265 1.00224 0.188
NP_440816.1_8 Forward -330 -316 16.5185 0.282
NP_441028.1_6 Forward -95 -85 11.4843 0.192
NP_441028.1_6 Forward -291 -281 5.48612 0.255
NP_441028.1_6 Forward -148 -138 3.8145 0.281
NP_441527.1_4 Reverse -48 -67 3.10306 0.121
NP_441527.1_4 Reverse -47 -66 2.62561 0.127
NP_441527.1_4 Reverse -50 -69 -2.81744 0.161
NP_441527.1_4 Forward -373 -354 -10.2658 0.268
NP_441527.1_4 Reverse -46 -65 -12.2711 0.285
NP_439965.1_7 Forward -147 -128 11.0983 0.294
NP_442674.1_10 Reverse -21 -40 11.7008 0.21
NP_442614.1_2 Reverse -170 -184 7.07942 0.275
NP_442842.1_10 Forward -59 -40 9.78484 0.206
NP_442365.1_7 Forward -147 -128 -3.54046 0.221
NP_442365.1_7 Reverse -371 -390 -4.81876 0.25
NP_442020.1_1 Reverse -92 -111 7.86512 0.157
NP_442020.1_2 Forward -47 -28 9.24257 0.141
NP_441836.1_2 Reverse -33 -52 -3.83545 0.244
NP_441993.1_1 Forward -199 -180 2.23906 0.261
NP_442867.1_8 Reverse -127 -146 11.6025 0.197
NP_441801.1_4 Forward -224 -214 3.12662 0.231
NP_442680.1_5 Reverse -140 -159 -0.611604 0.288
NP_441436.1_8 Forward -390 -371 8.65258 0.279
NP_442514.1_5 Forward -56 -37 -0.29631 0.182
NP_442514.1_5 Reverse -117 -136 -7.27777 0.276
NP_442703.1_6 Reverse -243 -262 17.8088 0.175
NP_442703.1_8 Forward -65 -47 14.0797 0.253
NP_442341.1_7 Forward -45 -31 3.44117 0.224
NP_442341.1_9 Reverse -123 -137 6.98048 0.208
NP_441397.1_8 Reverse -86 -99 12.5712 0.256
NP_441902.1_3 Reverse -86 -96 11.524 0.298
NP_440880.1_2 Reverse -246 -265 19.6232 0.115
NP_442495.1_4 Forward -119 -109 17.5813 0.0771
NP_442373.1_2 Forward -119 -100 -11.1119 0.293
NP_440172.1_1 Forward -101 -91 1.84832 0.294
NP_441766.1_9 Forward -142 -123 0.392778 0.246
NP_440416.1_9 Reverse -107 -126 -9.93197 0.135
NP_440416.1_9 Forward -49 -30 -21.0434 0.29
NP_442552.1_4 Reverse -229 -248 13.6072 0.253
NP_442154.1_1 Forward -126 -108 -9.22396 0.177
NP_442154.1_1 Forward -142 -124 -18.2704 0.279
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGAGTCTATGGGCAACGTGTTCGGGAGCAAAAAGACAGAGGGAGAGGGGAGACTGCACAGGGGATCAATAATCAGTCGAAGGTTAATCAAATAAGGGCTCAGATAGGCTTTCTCACCATGGTACGGTGCAAGTTAAGAAAATATTAATACTATTAATTGGAAAATTGTGTTAAGCAACTCCCCTGAACGTTAACACAATCTGAGTGCTCCTTGGCCGGATAGCTTCCGGCCTGTTTACAAAGTTTGAATTTGTGCTCCCCATCTTGGCGCTGGGCCGTGTATGGCCTGGGGTAACTTTGGCAATTTTTTCTCTATGACCAGGGATTTGGAGACTTTTTCTTTTATCTCTTTGCCCATGGATAGCCCTTGGCTAGTTAACCCTTTTTGGCTAGGATTTGG

CDS

GTGTCTAAGCCCCTGATCGCCGCCCTCCATTTTTTACAATTTTTGTATATGACAAGCAGAATTAATCCCCTCGCCGGCCAGCATCCCCCCGCCGACAGCCTTTTGGATGTGGCCAAACTTTTAGACGACTATTACCGTCAGCAACCGGACCCGGAAAATCCCGCCCAGTTAGTGAGCTTTGGTACCTCTGGCCATCGGGGTTCTGCCCTCAACGGTACTTTTAATGAAGCCCATATTTTGGCGGTGACCCAGGCAGTGGTGGACTATCGCCAAGCCCAGGGCATTACGGGGCCCCTTTATATGGGGATGGATAGCCATGCTCTGTCGGAACCAGCCCAGAAAACGGCGTTGGAAGTGTTGGCCGCTAACCAAGTAGAAACTTTTTTAACCACCGCCACGGATTTAACCCGTTTCACCCCCACTCCGGCGGTATCCTACGCCATTTTGACCCACAACCAGGGACGTAAAGAAGGTTTAGCGGACGGCATTATTATTACCCCTTCCCACAATCCCCCCACTGATGGAGGCTTTAAATATAATCCCCCCTCCGGTGGCCCGGCGGAACCGGAAGCGACCCAATGGATTCAGAACCGGGCCAATGAGTTGCTGAAAAATGGCAATAAAACAGTTAAACGGCTGGATTACGAGCAGGCATTAAAAGCCACCACCACCCATGCCCATGATTTTGTCACTCCCTATGTGGCCGGTCTGGCGGACATCATTGACTTGGATGTAATTCGTTCAGCGGGCTTGCGCTTGGGAGTTGACCCCCTGGGGGGAGCCAATGTGGGCTATTGGGAACCCATTGCCGCTAAATACAATTTGAACATCAGCTTGGTTAATCCCGGGGTAGATCCCACGTTTAAATTTATGACCCTGGATTGGGACGGCAAAATCCGCATGGATTGTTCTTCCCCCTACGCCATGGCCAGTTTGGTGAAAATCAAAGACCATTACGACATTGCCTTTGGCAACGACACCGACGGCGATCGCCATGGCATTGTCACCCCCAGCGTGGGTTTGATGAATCCCAATCATTTTCTTTCCGTGGCCATTTGGTATTTGTTTAGTCAGCGGCAACAGTGGTCAGGGCTGTCGGCGATCGGCAAAACCCTAGTCAGCAGCAGCATGATTGACCGGGTGGGGGCCATGATTAATCGCCAAGTTTACGAAGTGCCCGTGGGCTTTAAATGGTTTGTCAGCGGTTTGCTAGATGGTTCCTTTGGCTTTGGGGGTGAAGAAAGTGCCGGGGCTTCGTTTTTGAAAAAAAATGGCACCGTTTGGACCACCGACAAAGATGGCACCATTATGGATTTATTGGCGGCGGAAATCACCGCTAAAACCGGCAAAGATCCCGGCCTCCATTACCAGGATTTGACCGCTAAGTTAGGTAATCCCATTTACCAACGCATTGATGCCCCCGCCACTCCGGCCCAAAAAGACCGCTTGAAAAAACTGTCCCCCGATGACGTTACAGCTACCTCCTTAGCTGGGGATGCCATTACTGCTAAATTAACCAAAGCCCCTGGCAACCAAGCGGCGATCGGTGGGTTGAAGGTGACCACTGCGGAAGGTTGGTTTGCGGCCCGGCCCTCCGGCACGGAAAATGTTTACAAAATCTATGCCGAAAGTTTCAAAGACGAAGCCCATCTCCAGGCTATTTTCACGGAGGCGGAAGCCATTGTTACCTCGGCTTTGGGCTAA

Protein

MSKPLIAALHFLQFLYMTSRINPLAGQHPPADSLLDVAKLLDDYYRQQPDPENPAQLVSFGTSGHRGSALNGTFNEAHILAVTQAVVDYRQAQGITGPLYMGMDSHALSEPAQKTALEVLAANQVETFLTTATDLTRFTPTPAVSYAILTHNQGRKEGLADGIIITPSHNPPTDGGFKYNPPSGGPAEPEATQWIQNRANELLKNGNKTVKRLDYEQALKATTTHAHDFVTPYVAGLADIIDLDVIRSAGLRLGVDPLGGANVGYWEPIAAKYNLNISLVNPGVDPTFKFMTLDWDGKIRMDCSSPYAMASLVKIKDHYDIAFGNDTDGDRHGIVTPSVGLMNPNHFLSVAIWYLFSQRQQWSGLSAIGKTLVSSSMIDRVGAMINRQVYEVPVGFKWFVSGLLDGSFGFGGEESAGASFLKKNGTVWTTDKDGTIMDLLAAEITAKTGKDPGLHYQDLTAKLGNPIYQRIDAPATPAQKDRLKKLSPDDVTATSLAGDAITAKLTKAPGNQAAIGGLKVTTAEGWFAARPSGTENVYKIYAESFKDEAHLQAIFTEAEAIVTSALG