Your browser is old and dusty. Try Google Chrome!

Details for sll0720

ORF sll0720
Accession NP_442954.1
Symbol
Category Cell killing
Definition RTX toxin activating protein homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -304 -290 5.70279 0.131
NP_441453.1_4 Forward -304 -296 11.9175 0.0344
NP_442752.1_4 Reverse -290 -297 7.90559 0.144
NP_440061.1_9 Forward -301 -287 13.7653 0.076
NP_440908.1_8 Forward -296 -277 20.4514 0.132
NP_441492.1_5 Forward -45 -26 5.28116 0.237
NP_440856.1_4 Forward -306 -287 -3.83545 0.239
NP_441738.1_2 Forward -281 -274 6.52862 0.261
NP_442111.1_4 Forward -305 -291 6.29277 0.131
NP_441831.1_5 Reverse -219 -238 18.1907 0.0572
NP_440343.1_3 Forward -303 -285 5.22993 0.257
NP_443018.1_3 Forward -303 -296 10.4622 0.103
NP_443018.1_3 Reverse -296 -303 4.36568 0.254
NP_441182.1_6 Reverse -223 -242 10.3242 0.189
NP_441002.1_3 Forward -263 -244 12.29 0.25
NP_441077.1_6 Reverse -14 -30 17.4557 0.0933
NP_441422.1_7 Forward -291 -274 -3.10775 0.227
NP_441422.1_7 Forward -306 -289 -4.97604 0.247
NP_441414.1_9 Reverse -94 -113 -7.76869 0.225
NP_439959.1_6 Reverse -92 -111 7.07928 0.267
NP_441958.1_5 Reverse -294 -304 -1.88825 0.26
NP_440203.1_5 Forward -296 -286 14.7292 0.0886
NP_442816.1_7 Forward -141 -122 3.58052 0.293
NP_439975.1_2 Reverse -95 -113 6.41066 0.249
NP_442013.1_10 Reverse -96 -115 14.9458 0.109
NP_441550.1_8 Forward -306 -296 5.68278 0.236
NP_441916.1_10 Reverse -101 -120 16.3224 0.0888
NP_440206.1_4 Forward -294 -275 0.981987 0.289
NP_441041.1_4 Forward -163 -144 -11.8986 0.254
NP_442396.1_5 Forward -263 -250 9.06573 0.134
NP_439966.1_3 Forward -320 -301 15.5357 0.269
NP_439966.1_7 Forward -291 -281 5.38779 0.226
NP_441079.1_7 Reverse -13 -32 -0.787962 0.2
NP_441644.1_6 Forward -304 -294 12.1726 0.0371
NP_442215.1_2 Forward -313 -297 -1.41643 0.185
NP_442029.1_6 Reverse -269 -288 7.7676 0.222
NP_442247.1_6 Reverse -231 -250 14.6508 0.14
NP_441751.2_8 Forward -303 -289 -4.7203 0.179
NP_442554.1_8 Forward -303 -293 4.89658 0.168
NP_442554.1_8 Reverse -296 -306 2.24165 0.276
NP_442292.1_1 Forward -303 -294 4.12963 0.185
NP_442143.1_10 Reverse -251 -270 12.6841 0.213
NP_440379.1_5 Reverse -229 -248 -2.16383 0.196
NP_441468.1_1 Reverse -296 -303 4.07068 0.263
NP_441468.1_5 Forward -325 -307 16.3421 0.229
NP_441015.1_10 Reverse -279 -298 -4.22878 0.201
NP_441015.1_10 Reverse -290 -309 -6.88371 0.258
NP_441876.1_9 Forward -107 -97 11.4843 0.275
NP_442808.1_1 Forward -290 -280 5.58445 0.146
NP_442050.1_1 Reverse -288 -307 11.8975 0.233
NP_442050.1_5 Forward -285 -275 6.96107 0.27
NP_442903.1_2 Reverse -8 -27 9.50102 0.165
NP_442342.1_9 Forward -249 -233 4.87675 0.243
NP_440558.1_2 Forward -302 -283 -6.49039 0.275
NP_440558.1_2 Reverse -286 -305 -6.49039 0.275
NP_440084.1_8 Reverse -79 -93 12.4256 0.241
NP_441458.1_10 Reverse -197 -216 1.37609 0.29
NP_441549.1_9 Forward -122 -104 -9.22396 0.244
NP_442347.1_2 Forward -108 -99 8.25953 0.102
NP_441037.1_4 Reverse -288 -298 6.34312 0.267
NP_442594.1_8 Reverse -272 -291 4.71934 0.259
NP_442764.1_3 Reverse -289 -299 15.713 0.295
NP_441799.1_1 Forward -308 -294 11.1104 0.0627
NP_441007.1_10 Reverse -290 -303 1.88757 0.203
NP_442333.2_5 Forward -294 -275 -0.590531 0.214
NP_441362.1_2 Forward -203 -184 4.69551 0.265
NP_440915.1_6 Reverse -286 -300 3.73617 0.1
NP_440537.1_3 Forward -333 -314 15.9291 0.259
NP_442386.1_9 Forward -305 -296 9.5374 0.159
NP_440570.1_5 Reverse -258 -277 0.786102 0.254
NP_441340.1_5 Reverse -296 -303 4.07068 0.239
NP_443028.1_4 Reverse -110 -129 8.44315 0.293
NP_440586.1_8 Forward -303 -296 7.61025 0.227
NP_440586.1_8 Reverse -314 -321 7.1186 0.272
NP_441262.1_3 Reverse -295 -302 5.34899 0.181
NP_443051.1_1 Reverse -294 -303 4.81794 0.105
NP_439937.1_9 Forward -300 -283 -1.04349 0.122
NP_441595.1_2 Reverse -114 -127 8.36957 0.292
NP_440408.1_7 Reverse -274 -293 9.63589 0.255
NP_440439.1_1 Forward -302 -289 -0.865694 0.241
NP_440372.1_2 Reverse -296 -303 4.07068 0.262
NP_441138.1_5 Forward -25 -12 5.88678 0.272
NP_439977.1_5 Forward -305 -286 -3.14714 0.296
NP_442549.1_6 Forward -132 -113 11.0125 0.23
NP_442114.1_2 Reverse -380 -399 9.24257 0.262
NP_441877.1_9 Forward -133 -116 1.51381 0.297
NP_442262.1_10 Forward -303 -296 10.6589 0.14
NP_440894.1_10 Forward -294 -275 2.26107 0.292
NP_442277.1_7 Forward -57 -41 -2.09402 0.297
NP_440575.1_1 Reverse -320 -339 6.09517 0.221
NP_440575.1_8 Forward -396 -377 -6.29373 0.281
NP_442845.1_2 Reverse -289 -303 9.04604 0.182
NP_442845.1_2 Reverse -88 -102 5.99778 0.219
NP_440982.1_1 Forward -304 -285 3.83357 0.294
NP_443062.1_1 Reverse -290 -308 10.5936 0.114
NP_440519.1_6 Forward -309 -295 11.3077 0.29
NP_440519.1_8 Reverse -275 -291 11.1699 0.193
NP_442428.1_5 Reverse -296 -303 4.46401 0.267
NP_442823.1_8 Reverse -221 -240 15.1424 0.198
NP_441884.1_8 Reverse -153 -172 -8.94866 0.265
NP_441336.1_10 Reverse -236 -255 10.9142 0.265
NP_442366.1_5 Forward -262 -252 13.5492 0.0739
NP_442206.1_10 Reverse -290 -305 13.7462 0.0799
NP_442308.1_4 Forward -272 -253 2.65439 0.267
NP_441851.1_10 Reverse -289 -299 4.3066 0.277
NP_441668.1_4 Forward -131 -112 -2.45882 0.288
NP_440593.1_3 Forward -288 -269 -4.03212 0.244
NP_442689.1_8 Reverse -48 -65 -3.40274 0.251
NP_442843.1_1 Reverse -296 -315 -9.53865 0.266
NP_440431.1_3 Reverse -107 -126 -9.73531 0.256
NP_442450.1_5 Reverse -248 -258 4.79825 0.287
NP_442168.1_5 Reverse -296 -315 -3.63879 0.289
NP_440040.1_8 Reverse -7 -26 4.05798 0.283
NP_441003.1_9 Reverse -85 -104 5.30933 0.266
NP_441432.1_9 Forward -26 -13 9.56794 0.274
NP_441333.1_1 Forward -132 -122 13.0198 0.217
NP_441333.1_1 Forward -28 -18 12.9245 0.217
NP_440713.1_4 Forward -293 -274 1.27776 0.289
NP_440559.1_1 Reverse -296 -305 5.01461 0.161
NP_441659.2_8 Forward -304 -294 10.1081 0.0243
NP_441022.1_1 Forward -66 -57 11.5462 0.274
NP_439956.1_7 Reverse -284 -303 14.4541 0.141
NP_441800.1_7 Forward -298 -280 -0.7675 0.232
NP_440352.1_5 Reverse -108 -127 10.6116 0.27
NP_440545.1_3 Reverse -286 -303 3.48043 0.0834
NP_440545.1_3 Forward -308 -291 -0.452814 0.154
NP_440545.1_3 Forward -303 -286 -6.35267 0.276
NP_440545.1_3 Reverse -296 -313 -6.94266 0.293
NP_440545.1_5 Reverse -227 -244 5.44704 0.234
NP_440010.1_2 Forward -288 -269 14.8466 0.298
NP_442603.1_7 Forward -103 -89 6.48882 0.24
NP_442603.1_9 Forward -306 -288 3.85406 0.293
NP_441047.1_1 Forward -291 -272 -0.197208 0.282
NP_442799.1_8 Reverse -109 -128 12.7645 0.172
NP_442498.1_7 Forward -264 -247 16.0096 0.291
NP_440671.1_4 Reverse -289 -303 5.40779 0.283
NP_442199.1_7 Reverse -113 -132 5.70185 0.212
NP_441696.1_6 Forward -303 -284 5.40766 0.223
NP_440875.1_9 Forward -302 -292 12.2655 0.127
NP_440590.1_4 Reverse -281 -294 2.77255 0.0813
NP_440590.1_4 Forward -298 -285 -5.78224 0.289
NP_441239.1_9 Forward -301 -289 12.0354 0.0512
NP_442044.1_1 Forward -304 -285 -5.99873 0.194
NP_441541.1_1 Reverse -42 -60 -0.666458 0.237
NP_442611.1_1 Forward -304 -285 -2.0655 0.284
NP_442611.1_1 Reverse -290 -309 -3.04881 0.297
NP_442499.1_3 Forward -299 -281 4.6407 0.289
NP_440341.1_1 Reverse -286 -305 14.1591 0.192
NP_442402.1_6 Forward -382 -373 13.7661 0.276
NP_442402.1_10 Reverse -371 -381 16.2041 0.118
NP_440653.1_1 Forward -274 -255 3.6377 0.277
NP_440653.1_10 Reverse -371 -390 2.55606 0.288
NP_441811.1_8 Reverse -284 -298 7.47274 0.243
NP_440160.1_9 Reverse -290 -309 9.63589 0.235
NP_440914.1_1 Reverse -290 -300 8.12715 0.207
NP_442533.1_1 Reverse -85 -104 -15.1435 0.252
NP_442533.1_1 Reverse -97 -116 -17.9951 0.299
NP_440263.1_5 Reverse -176 -190 9.83269 0.294
NP_443016.1_10 Reverse -281 -300 8.55425 0.289
NP_441697.1_5 Forward -397 -378 -8.73794 0.268
NP_441697.1_5 Reverse -16 -35 -10.2658 0.278
NP_441028.1_6 Forward -108 -98 12.9592 0.166
NP_440116.1_8 Reverse -296 -315 -1.37718 0.119
NP_440116.1_8 Reverse -251 -270 -3.93378 0.159
NP_440115.1_6 Reverse -287 -297 6.96153 0.166
NP_440007.1_9 Reverse -286 -300 4.62115 0.267
NP_001035870.1_3 Reverse -263 -282 -5.31042 0.279
NP_441286.1_1 Forward -260 -248 -6.15587 0.251
NP_441479.1_9 Reverse -340 -358 14.8671 0.271
NP_440886.1_7 Forward -104 -94 3.22451 0.291
NP_442614.1_2 Reverse -232 -246 6.29277 0.291
NP_440907.2_8 Forward -303 -293 5.87944 0.184
NP_440907.2_8 Forward -298 -288 5.09279 0.222
NP_442264.1_2 Reverse -280 -297 16.0668 0.122
NP_440193.1_7 Reverse -288 -302 17.6984 0.174
NP_440962.1_5 Reverse -185 -195 16.1063 0.289
NP_442893.1_4 Forward -33 -14 -2.36125 0.281
NP_442365.1_7 Forward -107 -88 5.30933 0.136
NP_442365.1_7 Forward -287 -268 2.45773 0.168
NP_442365.1_7 Reverse -202 -221 1.17943 0.172
NP_442238.1_7 Forward -46 -27 8.65176 0.239
NP_441174.1_4 Reverse -236 -246 12.5664 0.288
NP_440082.1_5 Forward -31 -12 14.9422 0.275
NP_442323.1_7 Forward -304 -285 9.43841 0.158
NP_440766.1_4 Reverse -276 -290 3.53951 0.146
NP_442930.1_1 Reverse -120 -130 10.1076 0.278
NP_440457.1_1 Reverse -286 -298 6.92215 0.108
NP_440457.1_1 Reverse -291 -303 6.1355 0.128
NP_442680.1_5 Reverse -8 -27 3.88216 0.227
NP_442297.1_1 Forward -254 -235 19.4681 0.168
NP_441159.1_7 Reverse -288 -307 -0.885524 0.237
NP_440554.1_4 Forward -303 -293 10.7964 0.0448
NP_440727.1_8 Reverse -381 -395 14.0489 0.274
NP_440275.1_3 Reverse -293 -303 6.46988 0.105
NP_440679.1_10 Forward -329 -310 -18.6834 0.279
NP_441105.1_3 Reverse -263 -282 -7.57203 0.255
NP_442015.1_10 Forward -303 -290 1.10092 0.213
NP_441045.1_4 Reverse -373 -392 14.3558 0.273
NP_442329.1_7 Forward -249 -230 12.29 0.273
NP_441226.1_7 Forward -303 -296 11.2485 0.0971
NP_441177.1_7 Forward -306 -287 10.9134 0.224
NP_443052.1_8 Reverse -102 -121 -6.39206 0.143
NP_440988.1_10 Reverse -92 -106 3.25301 0.298
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTAAAAAATTTAATCCCTTTGTGGAAAGTCATAAGTTAGAATCCCTCAACAGCTTAGGCCTGCGTTACAAAGATGAAGTTGTTGGCTGGATGCTTACCCATCGCATCGCCCCCGATACCATTCGCTACACCCAGATGTTTGTCGATCCAGCTCTTCAGCCCCTCAGCCGAAGTTTGATCATGCTTGCTACGGCTATGAATATTCAAATTAAAACTGCGCCAGATGCTCCTAAAGCAACCTGTCGAGTCGACATTGATAACTATCCTATGGTTAATTTTGTTGAGCGTCGTCTTGCTCCCCATCTCGACAATCTTAAATATGCGTGGCGGGCTTCTAAACTTTTAACATGACTACAAATATTGCATAATATGATTTTAGTTTTTTATTCGATAACAGTTA

CDS

ATGACTGCTGATAAATATACAGTTGCTATCAATGAAAACGCTCTAAAAATACTGGGCGAAATTGTATTTTTAATGGGGGCTTCACAGAACTTTGCCAAGTATCCTGTTAGTTTTATTATAAATTACCTTTTGCCCTCTATCTACCTGAATCAATATCGAATCTATCGGACAGTTAAAGATAATAAGCCAATTGGCTTTGCTTGTTGGGCTTTTATTAATGATCAAGTAGAAAAAGAACTTATTGAAAATGATATTAATTTAAGTGTCGAAGAGAGAAACTCGGGAGAAAACATTTATGTTCTTTACTTCATTGCACCCTTTGGTCATGCCAAACAAATTGTCCATGATCTGAAAAACAATATCTTTCCCAATAAAATAGTCAAAGGTTTAAGGCTAGATAAAGATGGGAAAAAAGTCCTACGGGTAGCAACTTATTATTGCTAA

Protein

MTADKYTVAINENALKILGEIVFLMGASQNFAKYPVSFIINYLLPSIYLNQYRIYRTVKDNKPIGFACWAFINDQVEKELIENDINLSVEERNSGENIYVLYFIAPFGHAKQIVHDLKNNIFPNKIVKGLRLDKDGKKVLRVATYYC