Your browser is old and dusty. Try Google Chrome!

Details for sll0702

ORF sll0702
Accession NP_440001.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441818.1_9 Reverse -63 -82 -5.60541 0.254
NP_441465.1_8 Reverse -227 -245 4.83737 0.299
NP_442169.1_1 Reverse -64 -83 1.17943 0.261
NP_441721.1_6 Forward -37 -18 7.96426 0.281
NP_441812.1_3 Forward -211 -197 8.65272 0.251
NP_441812.1_3 Reverse -200 -214 7.86607 0.259
NP_440784.1_7 Forward -209 -202 5.84064 0.248
NP_441054.1_2 Reverse -58 -77 13.4708 0.199
NP_440878.1_9 Forward -176 -157 4.916 0.174
NP_442062.1_8 Forward -166 -156 2.7333 0.297
NP_442602.1_3 Reverse -355 -374 3.04771 0.163
NP_439923.1_5 Reverse -276 -295 8.75091 0.173
NP_441594.1_6 Reverse -295 -314 0.491109 0.285
NP_441738.1_2 Forward -311 -304 11.8385 0.0469
NP_441738.1_2 Reverse -368 -375 8.29857 0.176
NP_441738.1_2 Forward -283 -276 6.52862 0.261
NP_441942.1_6 Reverse -297 -316 14.4749 0.245
NP_441327.1_1 Forward -136 -117 3.73283 0.276
NP_440747.1_10 Forward -169 -157 -4.38592 0.0974
NP_441486.1_1 Forward -163 -149 -2.75368 0.175
NP_440057.1_1 Reverse -158 -177 8.16093 0.28
NP_441014.1_10 Reverse -288 -307 2.6536 0.216
NP_442848.1_4 Reverse -56 -70 8.84938 0.282
NP_440376.1_1 Forward -166 -157 4.42462 0.159
NP_440376.1_1 Reverse -99 -108 3.34298 0.206
NP_442296.1_5 Forward -70 -51 3.93269 0.251
NP_442782.1_2 Reverse -334 -348 4.81781 0.25
NP_442496.1_5 Reverse -340 -358 5.13236 0.288
NP_442937.1_5 Reverse -69 -88 10.9142 0.151
NP_442836.1_10 Reverse -339 -349 13.7464 0.212
NP_441097.1_2 Reverse -262 -279 14.2968 0.126
NP_442002.1_1 Forward -307 -289 -8.92897 0.272
NP_442002.1_9 Reverse -1 -8 12.2322 0.185
NP_441654.1_7 Reverse -355 -374 12.8237 0.262
NP_441294.1_7 Reverse -377 -391 8.96266 0.269
NP_441916.1_10 Reverse -149 -168 9.83255 0.154
NP_441725.1_3 Reverse -166 -185 20.1573 0.0158
NP_441725.1_5 Forward -159 -149 -0.609952 0.265
NP_439966.1_9 Reverse -274 -283 3.7363 0.253
NP_001035871.2_7 Reverse -336 -346 12.5664 0.264
NP_441087.1_6 Reverse -206 -224 -1.75153 0.27
NP_441860.1_1 Reverse -366 -380 14.4828 0.277
NP_441556.1_4 Forward -307 -288 16.2715 0.128
NP_440919.1_7 Forward -354 -336 4.29405 0.295
NP_440357.1_3 Forward -315 -296 3.04771 0.245
NP_440464.1_8 Forward -280 -267 18.3082 0.253
NP_441015.1_10 Reverse -299 -318 -7.37537 0.266
NP_441826.1_2 Reverse -232 -246 -4.22864 0.293
NP_441330.1_1 Forward -77 -58 -5.99873 0.139
NP_442719.1_2 Reverse -358 -376 -10.208 0.271
NP_442719.1_2 Reverse -357 -375 -10.3063 0.272
NP_443058.1_7 Reverse -45 -64 1.86774 0.294
NP_442050.1_5 Forward -287 -277 7.45273 0.256
NP_440038.1_4 Forward -351 -332 2.45773 0.275
NP_440558.1_2 Reverse -33 -52 -7.08038 0.287
NP_441878.1_6 Reverse -150 -160 -7.49312 0.231
NP_441557.1_8 Forward -107 -97 13.0576 0.225
NP_441590.1_4 Forward -79 -60 3.24359 0.29
NP_442066.2_9 Reverse -300 -313 10.2457 0.154
NP_441549.1_9 Reverse -42 -60 -10.1089 0.269
NP_441549.1_9 Forward -55 -37 -10.5023 0.279
NP_442645.1_2 Reverse -129 -148 -20.3551 0.288
NP_442965.1_2 Reverse -330 -349 -8.16202 0.277
NP_442508.1_8 Reverse -332 -349 9.18362 0.292
NP_442998.1_5 Reverse -345 -355 12.8614 0.158
NP_442998.1_5 Reverse -346 -356 10.9931 0.199
NP_442998.1_5 Forward -50 -40 9.22315 0.248
NP_442998.1_5 Reverse -363 -373 8.82982 0.261
NP_440299.1_1 Forward -164 -151 5.62358 0.169
NP_440299.1_1 Reverse -200 -213 2.28034 0.292
NP_440456.1_7 Forward -52 -38 11.701 0.285
NP_440525.1_1 Reverse -99 -118 8.55425 0.267
NP_441704.1_8 Reverse -293 -312 8.35677 0.208
NP_441464.1_10 Reverse -268 -282 9.43936 0.262
NP_441113.1_3 Reverse -345 -359 14.2569 0.289
NP_442993.1_1 Forward -210 -194 -6.82463 0.146
NP_442386.1_9 Forward -349 -340 5.70251 0.241
NP_440192.1_5 Reverse -259 -278 3.6377 0.271
NP_439937.1_8 Reverse -199 -218 -3.83545 0.273
NP_440408.1_7 Forward -304 -285 8.75091 0.269
NP_440408.1_7 Reverse -334 -353 6.78429 0.299
NP_440819.1_5 Reverse -345 -353 7.68924 0.266
NP_442887.1_5 Forward -294 -275 -12.7836 0.281
NP_442384.1_10 Forward -108 -95 3.95252 0.172
NP_442384.1_10 Reverse -201 -214 1.39592 0.26
NP_441018.1_7 Forward -400 -381 12.4875 0.16
NP_441689.1_5 Forward -188 -178 9.616 0.132
NP_440344.1_9 Forward -393 -374 18.5853 0.138
NP_440282.1_10 Forward -97 -78 -7.86702 0.254
NP_440189.1_2 Forward -293 -274 4.22769 0.268
NP_441335.1_8 Forward -376 -357 6.58763 0.281
NP_440297.1_9 Forward -159 -149 0.766681 0.282
NP_440350.1_5 Reverse -44 -63 -7.27704 0.299
NP_442280.1_10 Forward -347 -329 6.52583 0.274
NP_440888.1_2 Reverse -289 -303 6.88214 0.217
NP_440575.1_1 Forward -363 -344 -0.00131823 0.29
NP_440575.1_8 Reverse -21 -40 7.17762 0.152
NP_440255.1_2 Forward -292 -274 21.1603 0.142
NP_440516.1_6 Reverse -289 -303 7.17714 0.284
NP_442120.1_10 Reverse -151 -170 -8.752 0.238
NP_441867.1_2 Reverse -338 -357 -14.1602 0.277
NP_440577.1_2 Reverse -25 -44 11.3075 0.277
NP_441733.1_10 Reverse -301 -314 7.6891 0.152
NP_441004.1_1 Reverse -298 -317 -14.6519 0.269
NP_442694.1_9 Reverse -29 -48 9.63589 0.244
NP_442622.1_1 Forward -182 -163 -4.91709 0.257
NP_442515.1_1 Forward -167 -153 -2.65535 0.277
NP_442515.1_8 Forward -385 -367 12.9005 0.275
NP_441982.1_6 Reverse -344 -353 12.4854 0.275
NP_441982.1_6 Reverse -343 -352 10.48 0.296
NP_441349.1_10 Reverse -273 -292 -7.86702 0.261
NP_442843.1_1 Forward -54 -35 -2.95047 0.217
NP_441150.1_4 Reverse -210 -229 18.8781 0.149
NP_442006.1_2 Reverse -163 -180 -6.54933 0.164
NP_440483.1_1 Reverse -334 -353 -7.57203 0.266
NP_441570.1_1 Forward -390 -372 -10.8956 0.181
NP_442348.1_2 Forward -375 -366 7.76787 0.28
NP_442348.1_2 Forward -396 -387 7.57121 0.28
NP_441432.1_8 Forward -167 -158 5.40793 0.158
NP_440199.1_10 Forward -213 -203 10.6981 0.173
NP_440578.1_4 Reverse -25 -44 12.6841 0.247
NP_439935.1_6 Forward -387 -368 18.0924 0.15
NP_442407.1_2 Reverse -361 -380 8.25844 0.26
NP_442400.1_10 Forward -45 -32 14.672 0.173
NP_440713.1_4 Reverse -266 -285 8.25926 0.17
NP_442489.1_7 Reverse -157 -166 -1.57357 0.213
NP_442489.1_7 Forward -166 -157 -1.6719 0.235
NP_440352.1_5 Reverse -8 -27 12.169 0.235
NP_442603.1_10 Reverse -165 -182 16.8914 0.244
NP_441888.1_7 Reverse -46 -60 4.03116 0.225
NP_442699.1_8 Forward -57 -38 -12.4886 0.253
NP_442699.1_8 Reverse -339 -358 -13.1769 0.284
NP_442199.1_5 Reverse -155 -174 -6.29373 0.272
NP_441609.1_1 Reverse -129 -148 0.392778 0.211
NP_442216.1_4 Forward -25 -17 8.27883 0.255
NP_442479.1_9 Forward -375 -356 -0.688862 0.21
NP_442479.1_9 Reverse -355 -374 -9.14533 0.266
NP_442479.1_9 Forward -57 -38 -10.3253 0.266
NP_440270.1_2 Forward -66 -47 12.3892 0.24
NP_441474.1_1 Forward -82 -63 1.86696 0.247
NP_442402.1_2 Forward -357 -343 12.0937 0.272
NP_442402.1_6 Forward -378 -369 13.1761 0.289
NP_442402.1_10 Forward -354 -344 13.0576 0.204
NP_441848.1_4 Reverse -340 -356 7.93263 0.288
NP_441084.1_6 Forward -57 -43 10.1198 0.254
NP_442679.1_1 Reverse -4 -23 -5.99873 0.298
NP_441926.1_3 Forward -166 -150 3.30346 0.23
NP_440505.1_3 Reverse -35 -45 9.02648 0.128
NP_442456.1_5 Reverse -335 -353 5.62401 0.283
NP_441252.1_6 Reverse -343 -350 11.6422 0.288
NP_442844.1_5 Forward -353 -334 6.29183 0.26
NP_440914.1_1 Forward -285 -275 9.59102 0.183
NP_440914.1_1 Forward -269 -259 6.27291 0.288
NP_441011.1_8 Reverse -267 -276 5.3096 0.271
NP_442541.1_10 Reverse -36 -50 1.17898 0.29
NP_442322.1_4 Forward -110 -93 -4.38673 0.259
NP_440816.1_2 Reverse -344 -363 12.9214 0.165
NP_441028.1_6 Forward -353 -343 7.45273 0.229
NP_440007.1_9 Reverse -147 -161 1.27789 0.289
NP_439965.1_7 Reverse -291 -310 17.7172 0.133
NP_439965.1_7 Forward -388 -369 14.3104 0.242
NP_441286.1_1 Forward -161 -149 -6.74586 0.278
NP_439899.1_2 Reverse -98 -117 11.7992 0.12
NP_440028.1_6 Reverse -323 -341 12.5072 0.24
NP_442365.1_7 Reverse -42 -61 -6.58872 0.298
NP_442020.1_1 Reverse -357 -376 -1.37794 0.291
NP_442090.1_10 Reverse -69 -82 14.4739 0.17
NP_440766.1_5 Reverse -343 -355 7.46481 0.29
NP_442743.1_1 Forward -357 -338 5.50519 0.271
NP_441311.1_2 Forward -17 -3 12.6836 0.23
NP_439910.1_2 Reverse -193 -210 -22.0856 0.207
NP_442680.1_5 Reverse -341 -360 5.05444 0.227
NP_442582.1_3 Reverse -357 -371 13.8579 0.256
NP_442703.1_8 Reverse -31 -49 17.3246 0.253
NP_442341.1_7 Reverse -363 -377 3.44117 0.224
NP_442341.1_9 Forward -69 -55 11.012 0.133
NP_441173.1_9 Forward -352 -344 13.1954 0.184
NP_441173.1_9 Forward -351 -343 12.507 0.206
NP_440552.1_8 Forward -378 -361 10.2698 0.269
NP_441842.1_10 Reverse -297 -311 9.5377 0.191
NP_442932.1_9 Reverse -341 -360 5.30933 0.266
NP_441902.1_3 Reverse -343 -353 14.8281 0.205
NP_441190.1_2 Reverse -368 -387 1.37609 0.239
NP_441190.1_2 Forward -73 -54 -0.4922 0.291
NP_440175.1_7 Reverse -62 -80 9.07034 0.282
NP_440149.1_8 Reverse -157 -176 -6.39206 0.25
NP_440149.1_8 Forward -166 -147 -7.27704 0.278
NP_441105.1_3 Forward -171 -152 -8.65367 0.275
NP_440216.1_9 Forward -39 -30 8.45619 0.286
NP_442290.1_9 Reverse -58 -77 11.8975 0.287
NP_442015.1_3 Forward -82 -63 20.2548 0.155
NP_441226.1_7 Forward -347 -340 5.34865 0.289
NP_441226.1_7 Forward -279 -272 5.34865 0.289
NP_440988.1_10 Reverse -155 -169 4.89883 0.249
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCGGGGATGTTTATTGCACTTCTGGGGATTTTGACAAAGTTTGCATTTTTCCCCAACCCTTAGCCTTCTAAGAAGATATTCCCTCCTAAATCGCCACTACGGGAATGAGGACAACCAATCCCAACCCATAACGATGAGCTAAACGTAAACGGTCAATGATCATTGTTTCGAAATTTGGAAATTATGACGGTCATCACAGTTTACCTACAGAAATAAATCCCACCTCTGTCTTGGCATTTGCCATATCCCTTCAAGAATGCGGAAACATTCATTATCACATTCTTAATATAAGCTAACCCCCGGACAGTGAAGGTTCCAGCCCACCAAATCAGCGCAGCAGCAAGGCTAGGGGTAGAATTGCCAGGAAAGAGAATTATTCCCCCTTTAATTGTTTGCCC

CDS

ATGGCCATCGTTATCAATTACCGTTCTCCGATCGCCGTCCTTGGTGCCTGCTTATGTATCTCGGCGATCGCCCCTGTCCAAGCTATTCCCATTCAGCCTCCTCTGTTGGTGAGTCAGACTCAACTGTTACCACCGCCGCCCGCCAGTCCCAATCCAGTGCCGGACCCGAGTGCGCTGAGCTTCACCCCCAATGCCACTTCTTACCGGGTAATGGCCTTGATTACTTCCCCAGTAGAAGAACAACAGGTTAAAGCAGCCTATCCTGGCGCTTTTTTCACCAACTTCAATGGGCAACGGTTATTACAAATAGGTAGTTTTAGCGATCCTCTCAATGCTCAACAGGCGGCCTTAAGTCTGCAAAATTTAGGACTAGAAACGGTGATTAATCCCTAG

Protein

MAIVINYRSPIAVLGACLCISAIAPVQAIPIQPPLLVSQTQLLPPPPASPNPVPDPSALSFTPNATSYRVMALITSPVEEQQVKAAYPGAFFTNFNGQRLLQIGSFSDPLNAQQAALSLQNLGLETVINP