Your browser is old and dusty. Try Google Chrome!

Details for sll0699

ORF sll0699
Accession NP_440006.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY100i: 123475 - 124420]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -328 -314 5.1128 0.142
NP_441061.1_2 Reverse -320 -334 -1.18038 0.252
NP_441061.1_2 Forward -235 -221 -1.8687 0.274
NP_441480.1_1 Forward -165 -146 -0.000545616 0.287
NP_442291.1_5 Reverse -220 -236 -4.46469 0.276
NP_440561.1_1 Reverse -228 -247 9.04509 0.285
NP_441818.1_9 Forward -122 -103 -1.47551 0.2
NP_441818.1_9 Forward -181 -162 -2.16383 0.202
NP_441098.1_6 Forward -397 -378 12.3883 0.214
NP_442287.1_1 Reverse -226 -236 13.7459 0.277
NP_443002.1_5 Reverse -320 -338 14.3747 0.202
NP_442975.1_10 Forward -91 -77 4.52221 0.245
NP_442975.1_10 Reverse -289 -303 3.8339 0.252
NP_441900.1_2 Reverse -262 -280 -4.60312 0.288
NP_441859.1_2 Reverse -297 -316 17.9932 0.0867
NP_441492.1_1 Forward -21 -2 11.1109 0.148
NP_439918.1_2 Reverse -187 -206 5.80098 0.154
NP_439918.1_2 Forward -110 -91 1.96607 0.208
NP_441365.1_5 Forward -21 -2 37.5619 0.000000115
NP_440300.1_5 Reverse -30 -48 12.225 0.271
NP_441925.1_4 Reverse -103 -122 -13.3743 0.257
NP_442889.1_1 Forward -376 -357 -12.6852 0.238
NP_441713.1_8 Forward -267 -249 8.37728 0.286
NP_442570.1_3 Forward -331 -312 -5.9004 0.25
NP_441716.1_1 Reverse -355 -369 6.58777 0.195
NP_441716.1_2 Reverse -53 -72 3.35565 0.229
NP_442111.1_4 Reverse -273 -287 12.1926 0.0451
NP_441624.1_7 Reverse -320 -334 7.86607 0.241
NP_441209.1_4 Forward -96 -77 11.3067 0.279
NP_441209.1_4 Reverse -88 -107 11.11 0.279
NP_441209.1_4 Reverse -311 -330 10.4217 0.284
NP_441880.2_10 Reverse -291 -309 8.37728 0.273
NP_442145.1_3 Forward -352 -333 6.58763 0.243
NP_442687.1_7 Reverse -312 -322 3.81494 0.286
NP_441846.1_10 Forward -181 -162 -4.32711 0.165
NP_441846.1_10 Forward -252 -233 -21.535 0.256
NP_441013.1_2 Reverse -344 -362 -4.01242 0.295
NP_440667.1_2 Forward -116 -97 -5.50708 0.261
NP_440141.1_8 Reverse -305 -324 11.7008 0.196
NP_442376.1_2 Forward -288 -269 -5.40875 0.286
NP_442376.1_2 Reverse -296 -315 -12.2919 0.286
NP_440153.1_8 Reverse -161 -174 -2.34066 0.235
NP_442236.1_3 Reverse -190 -209 6.4893 0.284
NP_441099.1_3 Forward -246 -227 2.55606 0.279
NP_442002.1_1 Forward -251 -233 -8.04399 0.261
NP_440411.1_10 Forward -113 -94 17.7763 0.186
NP_441646.1_1 Forward -106 -87 -0.688862 0.271
NP_441000.1_1 Forward -22 -4 13.3937 0.184
NP_441041.1_4 Forward -334 -315 -7.57203 0.19
NP_441041.1_4 Forward -116 -97 -13.4719 0.288
NP_441369.1_1 Forward -56 -37 38.7419 0.000000157
NP_441369.1_2 Forward -26 -7 38.9385 0.0000000955
NP_441369.1_3 Forward -73 -59 28.5156 0.00021
NP_442004.1_6 Forward -370 -356 5.01447 0.199
NP_439966.1_7 Forward -89 -79 5.78111 0.209
NP_442012.1_5 Forward -329 -310 0.196116 0.288
NP_442288.1_5 Forward -58 -44 16.7159 0.12
NP_441556.1_6 Forward -54 -36 12.4797 0.296
NP_442215.1_2 Forward -337 -321 -2.98973 0.207
NP_442215.1_2 Reverse -311 -327 -3.38305 0.214
NP_442215.1_2 Forward -324 -308 -5.93965 0.262
NP_442029.1_6 Forward -187 -168 8.65258 0.204
NP_442247.1_5 Reverse -29 -43 14.4865 0.234
NP_442671.1_2 Forward -48 -29 24.6829 0.000359
NP_442554.1_8 Forward -328 -318 3.02829 0.245
NP_442970.1_1 Forward -46 -32 9.56081 0.269
NP_442142.1_4 Reverse -110 -123 11.8184 0.0518
NP_442142.1_4 Reverse -352 -365 4.93527 0.206
NP_442142.1_4 Reverse -116 -129 2.18201 0.299
NP_442076.1_5 Forward -52 -33 9.93088 0.186
NP_440379.1_5 Forward -317 -298 -8.45701 0.252
NP_440464.1_8 Reverse -233 -246 20.0782 0.155
NP_441020.2_7 Forward -93 -74 9.14342 0.26
NP_441015.1_10 Forward -181 -162 -4.32711 0.202
NP_441015.1_10 Forward -127 -108 -11.4069 0.296
NP_441731.1_3 Forward -318 -299 0.786102 0.24
NP_441826.1_2 Forward -370 -356 -2.16369 0.267
NP_441826.1_2 Forward -93 -79 -3.04867 0.282
NP_441056.1_1 Forward -329 -310 -7.96535 0.282
NP_442227.1_2 Reverse -163 -182 0.982764 0.252
NP_440871.1_3 Reverse -52 -66 15.905 0.166
NP_442113.1_10 Reverse -160 -179 -4.32711 0.224
NP_440558.1_2 Reverse -310 -329 -0.787193 0.204
NP_440558.1_2 Reverse -316 -335 -3.54046 0.236
NP_440558.1_2 Reverse -87 -106 -4.13045 0.243
NP_442792.1_6 Forward -178 -159 11.0125 0.187
NP_441878.1_6 Forward -365 -355 -0.118297 0.167
NP_442183.1_9 Forward -173 -163 9.41981 0.296
NP_442135.1_3 Reverse -271 -290 6.88262 0.254
NP_439980.1_1 Reverse -188 -207 14.8577 0.286
NP_441574.1_1 Reverse -187 -206 -7.08038 0.283
NP_440276.1_2 Forward -222 -203 10.7772 0.245
NP_441549.1_1 Reverse -303 -322 18.8781 0.187
NP_442347.1_2 Forward -86 -77 13.4711 0.056
NP_442347.1_2 Reverse -257 -266 2.94966 0.292
NP_442738.1_7 Forward -179 -160 19.764 0.111
NP_442590.1_10 Forward -122 -103 14.6508 0.12
NP_442998.1_5 Forward -25 -15 8.53483 0.261
NP_440899.1_8 Forward -156 -137 -3.24547 0.231
NP_440899.1_8 Reverse -33 -52 -9.14533 0.258
NP_440640.1_6 Forward -128 -109 12.5858 0.137
NP_440640.1_6 Reverse -314 -333 -1.37718 0.3
NP_441362.1_2 Forward -50 -31 5.55684 0.243
NP_440915.1_5 Forward -175 -156 14.7136 0.283
NP_441704.1_8 Forward -76 -57 6.1935 0.262
NP_440748.1_5 Reverse -316 -335 20.649 0.0713
NP_440537.1_7 Forward -72 -53 16.6629 0.0599
NP_440537.1_7 Reverse -64 -83 11.1244 0.263
NP_441464.1_8 Reverse -296 -310 9.2427 0.192
NP_440702.1_2 Forward -124 -105 -6.88371 0.265
NP_440695.1_6 Reverse -335 -349 11.7688 0.265
NP_442993.1_1 Forward -328 -312 -13.7078 0.294
NP_442386.1_9 Reverse -319 -328 5.21086 0.262
NP_440327.1_6 Forward -181 -162 3.44104 0.285
NP_440192.1_5 Forward -123 -104 17.2074 0.116
NP_440192.1_5 Forward -254 -235 6.09597 0.227
NP_440027.1_3 Reverse -221 -239 1.69003 0.299
NP_439937.1_9 Reverse -262 -279 -14.3181 0.287
NP_440408.1_7 Forward -335 -316 10.8159 0.24
NP_440372.1_3 Forward -45 -31 15.0039 0.165
NP_441181.1_6 Reverse -79 -97 7.19731 0.219
NP_441018.1_7 Forward -245 -226 6.19431 0.297
NP_442262.1_10 Reverse -275 -282 8.20058 0.25
NP_440163.1_9 Reverse -378 -397 11.3075 0.285
NP_440344.1_10 Forward -94 -77 -9.49926 0.147
NP_440282.1_10 Forward -206 -187 -9.14533 0.272
NP_440531.1_8 Forward -290 -271 1.76941 0.298
NP_442750.1_3 Reverse -203 -222 -3.83545 0.204
NP_442129.1_6 Forward -47 -28 13.9464 0.246
NP_440999.1_9 Reverse -238 -252 -1.8687 0.252
NP_440888.1_2 Reverse -161 -175 8.3571 0.163
NP_440888.1_2 Reverse -263 -277 7.76712 0.184
NP_440888.1_4 Forward -322 -308 14.9725 0.253
NP_442033.1_10 Reverse -262 -281 -10.3253 0.233
NP_440575.1_8 Forward -344 -325 -4.72043 0.268
NP_442845.1_2 Forward -176 -162 4.81781 0.251
NP_441178.1_6 Reverse -97 -116 10.2251 0.226
NP_442710.1_7 Forward -49 -30 -7.22274 0.294
NP_442337.1_8 Forward -157 -138 10.4225 0.154
NP_442337.1_8 Forward -258 -239 0.786102 0.244
NP_442578.1_5 Forward -100 -81 7.27595 0.227
NP_441410.1_4 Forward -155 -136 11.2084 0.248
NP_442204.1_1 Forward -126 -115 6.74518 0.152
NP_442872.1_1 Reverse -108 -127 -10.522 0.241
NP_440673.1_3 Forward -213 -206 6.72562 0.277
NP_441052.1_2 Reverse -113 -123 1.35667 0.248
NP_441052.1_2 Reverse -355 -365 1.25834 0.249
NP_440041.1_2 Forward -366 -347 -5.9004 0.296
NP_442907.1_9 Reverse -356 -375 -0.295539 0.222
NP_441004.1_5 Reverse -310 -324 10.816 0.241
NP_442813.1_2 Forward -348 -329 1.37609 0.25
NP_442813.1_5 Forward -240 -221 10.2259 0.146
NP_442366.1_3 Forward -330 -312 -1.55415 0.215
NP_442694.1_8 Reverse -32 -50 12.3105 0.191
NP_442854.1_6 Reverse -355 -374 2.65439 0.272
NP_442312.1_1 Reverse -194 -213 10.8159 0.275
NP_441396.1_5 Forward -121 -112 8.35786 0.224
NP_441982.1_6 Forward -225 -216 14.3952 0.274
NP_441982.1_10 Reverse -4 -23 8.55343 0.143
NP_442689.1_8 Reverse -32 -49 -8.61428 0.294
NP_441124.1_5 Forward -53 -43 12.7217 0.215
NP_441124.1_5 Reverse -331 -341 10.6209 0.286
NP_440588.1_3 Forward -345 -326 20.4523 0.093
NP_442006.1_3 Forward -316 -298 -5.58572 0.298
NP_441663.1_8 Forward -316 -297 4.12936 0.169
NP_441432.1_8 Forward -329 -320 2.75299 0.287
NP_441732.1_2 Reverse -103 -119 -17.7394 0.292
NP_440497.1_2 Reverse -302 -321 4.32602 0.293
NP_440760.1_1 Forward -370 -351 -22.9117 0.274
NP_442274.1_8 Forward -222 -204 12.9971 0.297
NP_440578.1_10 Reverse -207 -226 11.1109 0.259
NP_443011.1_4 Forward -126 -107 7.57094 0.266
NP_440281.1_4 Reverse -101 -120 14.7483 0.297
NP_440713.1_4 Forward -126 -107 2.0644 0.273
NP_442489.1_2 Forward -127 -108 0.786102 0.297
NP_441659.2_8 Reverse -107 -117 0.275027 0.27
NP_442346.1_5 Reverse -205 -215 7.15819 0.178
NP_441943.1_8 Reverse -304 -323 -5.9004 0.261
NP_442311.1_5 Forward -122 -103 2.65439 0.251
NP_442603.1_7 Reverse -107 -121 6.68548 0.232
NP_440946.1_4 Forward -262 -243 9.3409 0.229
NP_441948.1_4 Reverse -249 -267 -5.88071 0.279
NP_441313.1_6 Forward -334 -315 5.30933 0.186
NP_440772.1_8 Reverse -221 -240 10.7175 0.253
NP_442723.1_1 Reverse -154 -173 1.37531 0.298
NP_441813.1_7 Reverse -107 -121 9.04542 0.264
NP_440590.1_4 Forward -328 -315 2.87088 0.0788
NP_440400.1_1 Reverse -163 -182 -1.47628 0.285
NP_441892.1_1 Reverse -346 -363 -2.91109 0.23
NP_441541.1_1 Forward -36 -18 -3.43572 0.264
NP_440462.1_4 Forward -126 -112 5.21113 0.29
NP_440462.1_6 Reverse -272 -282 1.84832 0.294
NP_441249.1_8 Reverse -187 -206 3.53937 0.275
NP_441474.1_1 Reverse -163 -182 -2.26292 0.273
NP_442402.1_2 Reverse -262 -276 15.4369 0.263
NP_441701.1_3 Forward -251 -234 14.2968 0.191
NP_441959.1_8 Forward -46 -33 8.61288 0.286
NP_441011.1_8 Reverse -257 -266 5.50626 0.256
NP_442533.1_1 Forward -179 -160 -5.80207 0.155
NP_442533.1_1 Forward -185 -166 -12.7836 0.236
NP_442533.1_1 Forward -125 -106 -14.0619 0.239
NP_442533.1_1 Forward -119 -100 -15.8318 0.257
NP_442533.1_6 Reverse -355 -364 11.3078 0.0442
NP_442533.1_6 Reverse -320 -329 3.24465 0.219
NP_442533.1_6 Reverse -107 -116 2.65466 0.246
NP_442541.1_10 Reverse -355 -369 1.76896 0.279
NP_442232.1_3 Forward -291 -272 -14.1602 0.288
NP_441028.1_6 Reverse -340 -350 5.78111 0.243
NP_441527.1_4 Reverse -142 -161 -12.2711 0.285
NP_440007.1_9 Reverse -316 -330 11.996 0.163
NP_440007.1_9 Forward -91 -77 1.17956 0.29
NP_440480.1_2 Forward -90 -76 19.1735 0.299
NP_441930.1_2 Forward -323 -313 11.2881 0.298
NP_440886.1_7 Reverse -106 -116 4.89613 0.213
NP_440886.1_7 Reverse -166 -176 4.10949 0.253
NP_439940.1_1 Forward -74 -55 31.957 0.00000438
NP_442614.1_2 Forward -170 -156 7.07942 0.275
NP_441651.1_4 Forward -362 -343 18.7807 0.214
NP_442963.1_7 Forward -301 -282 12.5858 0.204
NP_441808.1_8 Forward -128 -109 6.58763 0.285
NP_442264.1_5 Forward -105 -91 13.9626 0.232
NP_441463.1_3 Forward -225 -206 -7.17871 0.255
NP_442238.1_1 Forward -334 -315 29.3021 0.000261
NP_442238.1_3 Forward -247 -228 6.39097 0.245
NP_442467.1_4 Forward -196 -177 6.58763 0.282
NP_441431.1_1 Reverse -31 -49 5.06306 0.245
NP_440293.1_9 Forward -151 -137 15.9827 0.159
NP_440766.1_5 Reverse -329 -341 6.50989 0.299
NP_439988.1_3 Forward -246 -232 12.291 0.199
NP_441237.1_9 Forward -322 -312 11.3864 0.184
NP_441246.1_7 Forward -247 -228 17.3057 0.0753
NP_441246.1_9 Reverse -308 -325 11.4452 0.15
NP_441133.1_1 Forward -248 -229 13.5691 0.243
NP_440457.1_1 Forward -287 -275 -1.23932 0.3
NP_441801.1_6 Forward -96 -77 12.7816 0.157
NP_441332.1_6 Reverse -232 -242 12.3244 0.234
NP_442509.1_9 Reverse -256 -266 9.51767 0.192
NP_441489.1_3 Forward -226 -212 12.903 0.198
NP_440524.1_2 Forward -327 -308 -4.42544 0.276
NP_441159.1_1 Reverse -179 -198 -2.16383 0.226
NP_442341.1_7 Forward -330 -316 2.94952 0.239
NP_442341.1_9 Forward -331 -317 11.012 0.133
NP_440191.1_6 Reverse -31 -45 13.1895 0.294
NP_442354.1_2 Forward -277 -258 2.3594 0.299
NP_442451.1_7 Forward -51 -32 12.9791 0.113
NP_441122.1_1 Forward -234 -219 3.12649 0.285
NP_440175.1_7 Forward -338 -320 8.77756 0.288
NP_442373.1_2 Forward -254 -235 -11.9969 0.298
NP_440249.1_2 Reverse -287 -297 14.3359 0.284
NP_441226.1_7 Reverse -234 -241 5.34865 0.289
NP_442252.1_4 Forward -116 -97 13.5691 0.263
NP_442116.1_6 Reverse -30 -47 7.50051 0.254
NP_441974.1_3 Forward -353 -336 15.9593 0.257
NP_442154.1_1 Forward -127 -109 -0.472507 0.114
NP_440261.1_5 Forward -321 -308 -12.3704 0.284
NP_440988.1_10 Reverse -159 -173 7.12552 0.221
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATCCCCTCCACCGTAGTAACCTTAGAGCAGAGGATGGTCCTGGCCTAGTACGGGTGGAAATTTCTGACACTGGCATCGGCATTGACCCAGAGGATCAGGCGGCCATTTTTGAGCGGTTCTATCGGGTGGAAAACCGGGTTCACACTTTGGAGGGTACTGGGTTGGGGCTTTCCATTGTCAAAAATATCATTGCCAAACATCAAAGCCAAATCCATTTAGTCAGTGAGGTGGGGGTGGGTACTACTTTTTGGTTTGATCTGGCCGTGTATCAATCCATGTTGATGGTGGTGGGCTAGGTTTCGCTTTGACAACCCTGATCCCAAAGTATAGTCATTTCAATTAACGATGAGAGAATTTAATGTAAAATTATGGAGTGTACAAAATGAACAGGTTTAAACA

CDS

ATGGCTTACAGTTTAGATTTAAGGCAAAGGGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAACAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGCCGTATATTACGCATTAAAGAAAATGAAAATAAACAGAAAAAAAAAGAACTACGTTATCGAGAAAGAAACCGGGAGGAACGAGTTAAGTACTATAGAATGTTAA

Protein

MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKNYVIEKETGRNELSTIEC