Your browser is old and dusty. Try Google Chrome!

Details for sll0670

ORF sll0670
Accession NP_442675.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442291.1_5 Reverse -109 -125 2.12349 0.133
NP_442272.1_2 Reverse -73 -92 11.2199 0.232
NP_441818.1_7 Reverse -103 -122 20.9431 0.141
NP_441098.1_3 Forward -60 -41 5.36543 0.25
NP_441098.1_3 Reverse -87 -106 -0.376802 0.25
NP_441098.1_3 Reverse -35 -54 -0.472506 0.25
NP_441098.1_3 Reverse -67 -86 -3.15222 0.28
NP_441098.1_3 Forward -153 -134 -5.83193 0.28
NP_441098.1_3 Forward -102 -83 -6.88467 0.285
NP_442752.1_4 Forward -376 -369 5.84064 0.166
NP_441675.1_4 Forward -217 -198 2.65439 0.287
NP_441054.1_4 Reverse -347 -365 -1.94747 0.214
NP_442062.1_8 Forward -376 -366 3.91327 0.243
NP_442062.1_8 Reverse -357 -367 3.61828 0.26
NP_441859.1_5 Forward -134 -115 8.16093 0.249
NP_440044.1_8 Reverse -111 -130 0.58944 0.195
NP_441581.1_4 Forward -393 -374 4.62101 0.272
NP_442602.1_3 Reverse -117 -136 1.17943 0.197
NP_441200.1_6 Reverse -373 -390 9.57695 0.285
NP_441594.1_6 Forward -397 -378 12.5858 0.109
NP_441925.1_5 Forward -176 -162 16.7159 0.124
NP_440856.1_7 Forward -394 -375 1.37609 0.161
NP_439957.1_9 Reverse -70 -89 7.30471 0.3
NP_441434.1_1 Forward -92 -78 10.4202 0.233
NP_441434.1_1 Reverse -128 -142 10.3247 0.233
NP_441434.1_1 Forward -50 -36 9.27434 0.24
NP_441738.1_2 Reverse -369 -376 8.20023 0.181
NP_442889.1_10 Forward -41 -22 12.0622 0.215
NP_442675.1_1 Forward -135 -116 22.9106 0.00667
NP_442675.1_2 Forward -371 -352 26.4505 0.000449
NP_440747.1_1 Forward -390 -372 6.80398 0.253
NP_442145.1_4 Reverse -82 -101 14.5621 0.0959
NP_440470.1_5 Reverse -85 -104 7.11373 0.279
NP_440403.1_4 Forward -128 -109 -10.1286 0.295
NP_442848.1_1 Forward -372 -358 3.93283 0.118
NP_441634.1_8 Forward -396 -382 -0.000409212 0.243
NP_441634.1_9 Forward -389 -370 9.93006 0.266
NP_440376.1_1 Forward -322 -313 1.76968 0.242
NP_440266.1_3 Forward -238 -222 12.6742 0.29
NP_441077.1_6 Forward -96 -80 3.09109 0.272
NP_440360.1_9 Reverse -82 -101 9.14423 0.243
NP_442836.1_5 Forward -125 -106 8.06259 0.147
NP_440203.1_5 Reverse -360 -370 9.71433 0.245
NP_442816.1_7 Forward -85 -66 5.58586 0.244
NP_439905.1_5 Reverse -72 -86 13.3726 0.288
NP_442690.1_1 Reverse -20 -39 -3.3438 0.142
NP_442690.1_1 Reverse -84 -103 -13.0786 0.254
NP_442911.1_1 Reverse -168 -181 14.1946 0.291
NP_442064.1_10 Forward -146 -127 13.0775 0.272
NP_442236.1_3 Forward -382 -363 8.45592 0.248
NP_441712.1_1 Forward -55 -36 11.0671 0.251
NP_442996.1_1 Reverse -75 -94 5.96782 0.246
NP_441514.1_4 Forward -148 -129 12.9884 0.272
NP_441079.1_7 Reverse -75 -94 -1.96793 0.212
NP_441079.1_7 Forward -90 -71 -3.73788 0.238
NP_442172.1_1 Forward -91 -72 14.0175 0.229
NP_442049.1_4 Forward -399 -380 -7.17871 0.298
NP_442215.1_2 Reverse -368 -384 -5.74299 0.256
NP_442029.1_1 Forward -387 -368 -13.6686 0.268
NP_442933.1_2 Reverse -71 -89 10.7926 0.257
NP_440382.1_2 Reverse -72 -91 5.70185 0.264
NP_442970.1_3 Forward -84 -66 15.3133 0.168
NP_442970.1_3 Forward -90 -72 12.8662 0.224
NP_442142.1_4 Reverse -373 -386 4.24695 0.227
NP_442476.1_1 Reverse -73 -92 12.5568 0.225
NP_440620.1_4 Reverse -127 -141 13.7625 0.281
NP_441448.1_1 Forward -396 -377 11.6025 0.178
NP_441448.1_1 Reverse -108 -127 6.58763 0.249
NP_440379.1_5 Forward -394 -375 -10.227 0.276
NP_441015.1_10 Forward -393 -374 -9.93197 0.282
NP_441876.1_9 Reverse -160 -170 12.4676 0.267
NP_441911.1_10 Reverse -244 -263 12.5117 0.21
NP_441849.1_2 Forward -86 -67 0.238307 0.277
NP_442050.1_5 Forward -33 -23 6.86274 0.28
NP_442903.1_2 Forward -45 -26 3.96249 0.24
NP_442789.1_4 Forward -393 -374 -3.73712 0.252
NP_441518.1_3 Forward -129 -110 -15.2418 0.288
NP_441739.1_2 Reverse -126 -142 9.98926 0.174
NP_441458.1_8 Reverse -125 -144 3.25322 0.276
NP_441458.1_10 Reverse -101 -120 1.57275 0.288
NP_442183.1_1 Reverse -357 -371 7.07942 0.149
NP_442347.1_2 Reverse -368 -377 5.99792 0.201
NP_442158.1_4 Forward -329 -319 10.4031 0.297
NP_440695.1_6 Forward -145 -131 9.63569 0.279
NP_442993.1_1 Forward -322 -306 -13.6095 0.293
NP_442327.1_3 Forward -94 -75 8.16414 0.227
NP_443028.1_4 Reverse -68 -87 10.077 0.293
NP_440161.1_3 Forward -238 -219 8.55425 0.269
NP_442959.1_5 Forward -145 -126 7.47261 0.231
NP_441262.1_3 Forward -119 -112 5.34899 0.181
NP_442339.1_3 Forward -53 -35 12.1139 0.297
NP_441877.1_9 Forward -241 -224 1.41547 0.297
NP_441877.1_9 Reverse -123 -140 1.31714 0.299
NP_442262.1_10 Reverse -358 -365 7.6106 0.274
NP_441689.1_4 Forward -154 -135 11.7928 0.257
NP_440350.1_5 Reverse -201 -220 -5.70374 0.292
NP_440894.1_7 Reverse -118 -137 9.14342 0.245
NP_440894.1_10 Reverse -374 -393 8.35759 0.178
NP_442454.1_2 Reverse -72 -91 8.25963 0.291
NP_442454.1_2 Forward -101 -82 7.68668 0.291
NP_442454.1_2 Forward -92 -73 6.2543 0.298
NP_442277.1_7 Reverse -66 -82 -1.61656 0.278
NP_440575.1_8 Reverse -324 -343 -6.1954 0.279
NP_442710.1_7 Reverse -72 -91 5.55986 0.129
NP_442710.1_7 Reverse -76 -95 -0.975606 0.213
NP_442710.1_7 Forward -93 -74 -4.62778 0.272
NP_442710.1_7 Forward -216 -197 -4.82 0.272
NP_441469.1_8 Reverse -109 -118 5.01461 0.297
NP_442315.1_1 Forward -381 -363 5.32902 0.256
NP_442315.1_2 Forward -327 -315 8.39711 0.294
NP_440710.1_2 Forward -131 -112 12.5858 0.237
NP_442204.1_5 Forward -175 -156 6.78429 0.142
NP_442780.1_1 Forward -98 -79 8.06259 0.279
NP_441443.1_1 Forward -322 -303 0.196116 0.225
NP_440673.1_2 Forward -129 -110 8.73121 0.263
NP_442219.1_9 Reverse -368 -377 2.06468 0.289
NP_441884.1_9 Reverse -364 -383 -22.3217 0.277
NP_441004.1_1 Forward -394 -375 -12.1936 0.245
NP_441034.1_2 Reverse -346 -365 16.8563 0.215
NP_441851.1_10 Forward -377 -367 9.22315 0.114
NP_441157.1_1 Forward -99 -85 6.19383 0.226
NP_442689.1_8 Reverse -24 -41 2.59545 0.18
NP_440874.1_2 Forward -83 -64 15.6504 0.0813
NP_440431.1_3 Forward -65 -46 -7.57203 0.208
NP_440431.1_4 Reverse -66 -85 -8.92892 0.275
NP_440431.1_4 Reverse -72 -91 -9.1199 0.275
NP_440431.1_4 Reverse -73 -92 -9.50187 0.287
NP_441031.1_1 Reverse -79 -98 5.66585 0.282
NP_441570.1_1 Forward -391 -373 -11.5839 0.198
NP_441570.1_1 Reverse -110 -128 -17.5821 0.283
NP_440793.1_1 Forward -76 -62 10.9137 0.279
NP_441432.1_9 Reverse -39 -52 16.9367 0.0855
NP_441432.1_9 Forward -85 -72 11.2162 0.235
NP_441732.1_2 Reverse -353 -369 -16.0677 0.164
NP_440760.1_7 Reverse -171 -190 5.01354 0.211
NP_440199.1_10 Reverse -360 -370 6.56821 0.296
NP_441057.1_3 Reverse -283 -302 -5.11376 0.205
NP_442489.1_7 Reverse -357 -366 -1.86856 0.259
NP_441022.1_1 Reverse -206 -215 10.8747 0.284
NP_441833.1_4 Reverse -111 -118 4.66067 0.22
NP_441329.1_1 Reverse -80 -99 10.3605 0.194
NP_441329.1_6 Reverse -245 -264 12.8432 0.106
NP_441329.1_6 Reverse -246 -265 -1.76702 0.293
NP_440671.1_1 Reverse -40 -59 6.51388 0.238
NP_442140.1_3 Forward -118 -108 6.17489 0.184
NP_440594.1_8 Forward -365 -352 13.3917 0.152
NP_442028.1_1 Forward -85 -72 9.99293 0.251
NP_440567.1_1 Reverse -368 -382 -0.688726 0.298
NP_440219.1_1 Forward -86 -67 13.7963 0.235
NP_441541.1_1 Reverse -82 -100 6.59093 0.153
NP_440212.1_9 Reverse -74 -93 6.23167 0.169
NP_442479.1_9 Forward -136 -117 -10.522 0.27
NP_441269.1_4 Reverse -355 -374 12.9791 0.29
NP_442402.1_4 Reverse -361 -380 -10.031 0.296
NP_442402.1_10 Reverse -370 -380 10.6976 0.282
NP_441848.1_4 Forward -143 -127 9.26952 0.287
NP_442923.1_6 Reverse -71 -85 12.0436 0.219
NP_442039.1_7 Reverse -57 -67 7.15819 0.279
NP_441811.1_8 Forward -378 -364 7.27608 0.251
NP_442679.1_1 Reverse -255 -274 2.0644 0.167
NP_442679.1_1 Reverse -69 -88 -5.50708 0.293
NP_440351.1_8 Forward -29 -11 5.52568 0.271
NP_442532.1_1 Forward -152 -138 12.543 0.215
NP_442532.1_1 Forward -96 -82 8.75312 0.294
NP_442174.1_9 Forward -33 -14 8.25926 0.233
NP_440914.1_1 Forward -372 -362 8.90788 0.186
NP_442533.1_6 Reverse -313 -322 4.52295 0.179
NP_442203.1_3 Reverse -71 -90 3.45038 0.291
NP_441697.1_5 Forward -93 -74 -6.63711 0.232
NP_441697.1_5 Forward -95 -76 -9.40638 0.268
NP_441028.1_6 Reverse -160 -170 3.51951 0.292
NP_441527.1_4 Reverse -246 -265 -1.57604 0.148
NP_441527.1_4 Reverse -249 -268 -2.0535 0.153
NP_441527.1_4 Reverse -65 -84 -6.15965 0.215
NP_441527.1_4 Reverse -66 -85 -8.45146 0.244
NP_441527.1_4 Reverse -63 -82 -9.59736 0.26
NP_441527.1_4 Reverse -64 -83 -11.8892 0.284
NP_440115.1_6 Forward -122 -112 6.07655 0.204
NP_442674.1_3 Forward -173 -154 2.35861 0.3
NP_441930.1_3 Reverse -72 -91 4.40654 0.269
NP_441930.1_3 Reverse -345 -364 3.15712 0.288
NP_440083.1_5 Forward -22 -3 13.1855 0.155
NP_441427.1_2 Forward -257 -238 15.3391 0.0644
NP_442125.1_2 Reverse -245 -264 15.6341 0.0292
NP_442842.1_10 Forward -259 -240 -0.408261 0.285
NP_442238.1_7 Reverse -290 -309 9.43841 0.224
NP_441401.1_5 Forward -174 -155 10.3605 0.297
NP_441962.1_4 Reverse -102 -121 -7.96535 0.195
NP_440387.1_1 Reverse -357 -373 1.33684 0.106
NP_440387.1_1 Forward -322 -306 -5.05468 0.212
NP_441836.1_2 Forward -122 -103 -4.91709 0.268
NP_441272.1_4 Forward -397 -378 6.09597 0.189
NP_440766.1_5 Reverse -267 -279 6.98735 0.29
NP_442680.1_5 Forward -224 -205 -0.611604 0.288
NP_441489.1_3 Reverse -58 -72 9.7518 0.232
NP_441489.1_3 Forward -60 -46 8.79688 0.232
NP_440081.1_1 Forward -377 -358 19.469 0.122
NP_441159.1_8 Forward -86 -67 1.17865 0.236
NP_441173.1_9 Forward -67 -59 10.9338 0.242
NP_441173.1_9 Forward -274 -266 9.75379 0.284
NP_440423.1_10 Forward -383 -364 10.8159 0.259
NP_440552.1_8 Forward -199 -182 12.7526 0.226
NP_440552.1_8 Forward -66 -49 10.5563 0.262
NP_441561.1_4 Forward -364 -345 5.80098 0.254
NP_440275.1_3 Forward -121 -111 7.15819 0.0872
NP_440312.1_8 Reverse -82 -101 15.9823 0.271
NP_441902.1_3 Reverse -253 -263 12.3986 0.253
NP_441207.1_7 Reverse -70 -84 8.57771 0.282
NP_441207.1_7 Reverse -65 -79 8.28727 0.29
NP_440149.1_8 Reverse -357 -376 -7.57203 0.288
NP_441730.1_3 Forward -142 -124 19.212 0.224
NP_440172.1_1 Forward -366 -356 2.83163 0.264
NP_442116.1_6 Reverse -129 -146 15.8083 0.129
NP_442116.1_6 Forward -59 -42 8.16895 0.254
NP_441974.1_3 Forward -363 -346 14.6194 0.259
NP_440988.1_10 Forward -396 -382 10.9012 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTATGGCAGTGGACACCATGGTGGGGAACGATGTCAATCTCCTGCAAATTTTCATTGAGCAGGCAATAAATTGTTCGGGGACGGACTTAATCCAATTCAGAAAACCCTGTGTGAAAGAGAAGTATTCTCCCAGTCTTTCTTCCTCATTTTATTCTAGATGGCAAAGATTTCTTAGATTAATAAAAAGTCTATGAAGTGATTAATCATTAGTGAGAAATAGAAATCTTACTAGGGGTTAAGGCAGTATTATGAAGTTAATTTTAGGAAATTTCCAAAGGTTGCGACCGTAGATACTGCAATTTACAAAAAGTTAATTTATTTATTTTTACTTTTCAGCCAATGTTATAAAAATTGACTTAAAATGGAAGCAAAACGCATTAGTAGTAGGATTATTACTC

CDS

ATGTTATGGCCCCTTGTTCGATATTGGGGAAGTGGATTAATGATTGCGGGAATATGCCTAACTCAACTGATTGGAGTTGATCTATTTATCCCTATGGTTTCTGCCCAGACCTATCAGGATACTCTCAATCAAAAAATGGCTATTCTCAAAAAGTCTGAAGAACGTTGGATTGAAGTTAATCTCTCCACACAACGTTTGATTGCTTGGGAAGGGAACAAACCAGTCTATGCCATTATTATTTCCACGGGAAAGAAGGGTACCCCAACAATTCCAGGTATATTTACCATTCAAAGCAAACGAAGCATTGATCGGATGAGAGGAGCAGATTATGATATTGACGATGTTCCCTATGCCCAATATTACAGCGGCGGTTACGCAATTCATGGAGCCTATTGGCATAACAAATTTGGCACACCAGTTAGTCATGGTTGCATTAATCTAGCGGTTGATCATGCAAAATGGTTATTTAATTGGTCGGAAATAAGCACTCCTTTGGTTATTCATTATTAA

Protein

MLWPLVRYWGSGLMIAGICLTQLIGVDLFIPMVSAQTYQDTLNQKMAILKKSEERWIEVNLSTQRLIAWEGNKPVYAIIISTGKKGTPTIPGIFTIQSKRSIDRMRGADYDIDDVPYAQYYSGGYAIHGAYWHNKFGTPVSHGCINLAVDHAKWLFNWSEISTPLVIHY