Your browser is old and dusty. Try Google Chrome!

Details for sll0669

ORF sll0669
Accession NP_442676.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -222 -208 12.586 0.209
NP_442711.1_1 Forward -232 -218 12.0943 0.222
NP_441061.1_2 Reverse -224 -238 23.304 0.00309
NP_441061.1_2 Reverse -230 -244 1.27789 0.192
NP_441061.1_2 Forward -231 -217 1.17956 0.193
NP_441061.1_2 Forward -280 -266 -1.77037 0.272
NP_440557.1_1 Forward -231 -212 6.4893 0.153
NP_440557.1_1 Reverse -224 -243 0.58944 0.265
NP_440795.1_7 Forward -231 -224 14.6904 0.0123
NP_440795.1_7 Reverse -224 -231 14.6904 0.0123
NP_441418.1_6 Reverse -223 -242 -11.4069 0.0496
NP_441418.1_6 Forward -232 -213 -12.6852 0.0683
NP_441418.1_6 Forward -238 -219 -21.3384 0.147
NP_441418.1_6 Forward -160 -141 -21.9284 0.163
NP_442291.1_5 Reverse -222 -238 5.76173 0.0737
NP_441453.1_4 Reverse -223 -231 16.539 0.00633
NP_441453.1_4 Forward -232 -224 16.539 0.00633
NP_442151.1_6 Reverse -223 -237 16.5192 0.0145
NP_442151.1_6 Forward -232 -218 12.4876 0.0722
NP_442151.1_6 Reverse -229 -243 10.0294 0.133
NP_441818.1_1 Reverse -224 -235 18.8393 0.00301
NP_440226.1_1 Forward -232 -213 14.4541 0.0305
NP_440226.1_1 Reverse -223 -242 3.73603 0.215
NP_440150.1_2 Reverse -225 -244 5.40686 0.269
NP_442173.1_1 Forward -231 -223 15.4574 0.00633
NP_442173.1_1 Reverse -224 -232 15.4574 0.00633
NP_442173.1_5 Forward -352 -342 16.7867 0.221
NP_442752.1_4 Forward -232 -225 13.8055 0.0199
NP_442752.1_4 Reverse -223 -230 13.8055 0.0199
NP_442752.1_4 Forward -379 -372 10.5605 0.1
NP_442752.1_4 Reverse -199 -206 10.5605 0.1
NP_443027.1_4 Forward -234 -224 14.0414 0.0452
NP_443027.1_4 Reverse -221 -231 13.943 0.0452
NP_442975.1_10 Reverse -219 -233 21.6317 0.000774
NP_442975.1_10 Forward -236 -222 5.01387 0.234
NP_442975.1_10 Forward -152 -138 2.8506 0.269
NP_442975.1_10 Reverse -328 -342 2.45727 0.274
NP_440784.1_7 Forward -231 -224 15.9687 0.0123
NP_440784.1_7 Reverse -224 -231 15.9687 0.0123
NP_442909.1_7 Reverse -224 -238 13.5686 0.12
NP_442289.1_4 Reverse -144 -160 13.8249 0.203
NP_441145.1_1 Reverse -141 -160 9.14423 0.254
NP_441476.1_5 Reverse -218 -237 -0.590531 0.2
NP_441476.1_5 Forward -237 -218 -7.96535 0.295
NP_442062.1_8 Forward -232 -222 19.4496 0.000558
NP_442062.1_8 Reverse -223 -233 17.3846 0.00193
NP_440761.1_4 Forward -243 -224 -12.0953 0.226
NP_441859.1_3 Reverse -222 -241 1.96529 0.269
NP_440304.1_4 Forward -240 -230 16.008 0.027
NP_440304.1_4 Forward -234 -224 10.8948 0.051
NP_440304.1_4 Reverse -221 -231 9.91146 0.051
NP_442242.1_4 Forward -231 -224 14.3954 0.0124
NP_442242.1_4 Reverse -224 -231 14.3954 0.0124
NP_441781.1_7 Reverse -223 -242 9.14423 0.139
NP_441581.1_6 Forward -156 -137 12.686 0.283
NP_441208.1_9 Forward -153 -139 8.25939 0.219
NP_441208.1_9 Forward -235 -221 5.01447 0.282
NP_441594.1_6 Forward -241 -222 11.3075 0.116
NP_441594.1_6 Reverse -220 -239 1.76941 0.262
NP_442110.1_7 Reverse -223 -237 18.6825 0.0142
NP_442110.1_7 Forward -232 -218 10.226 0.0684
NP_440856.1_7 Reverse -151 -170 -2.85214 0.192
NP_441083.1_5 Reverse -223 -233 20.3345 0.00053
NP_441083.1_5 Forward -232 -222 11.3864 0.0159
NP_441083.1_5 Forward -281 -271 4.40493 0.146
NP_442827.1_8 Reverse -215 -234 3.83357 0.143
NP_442827.1_8 Forward -240 -221 3.14526 0.151
NP_442827.1_8 Reverse -221 -240 -2.06626 0.267
NP_441434.1_7 Forward -230 -216 5.30946 0.225
NP_441738.1_2 Forward -230 -223 15.28 0.0102
NP_441738.1_2 Reverse -225 -232 15.28 0.0102
NP_441738.1_2 Reverse -53 -60 8.29857 0.176
NP_441558.1_5 Forward -234 -215 22.7139 0.00172
NP_441558.1_5 Reverse -221 -240 7.07928 0.195
NP_441558.1_7 Forward -325 -306 14.2574 0.156
NP_440209.1_1 Reverse -223 -231 18.1123 0.00295
NP_440209.1_1 Forward -232 -224 18.1123 0.00295
NP_442889.1_8 Reverse -220 -234 20.6484 0.00372
NP_441770.1_4 Reverse -306 -325 -10.227 0.271
NP_440178.1_7 Forward -233 -214 -12.8819 0.127
NP_440178.1_7 Reverse -222 -241 -14.8485 0.156
NP_442570.1_3 Reverse -227 -246 -4.22878 0.228
NP_442570.1_3 Reverse -221 -240 -6.1954 0.257
NP_442570.1_3 Reverse -255 -274 -7.08038 0.265
NP_441792.1_5 Reverse -285 -301 12.1532 0.19
NP_441716.1_1 Reverse -223 -237 5.99778 0.208
NP_441716.1_1 Forward -238 -224 3.53951 0.261
NP_442111.1_4 Forward -233 -219 12.586 0.0422
NP_440343.1_1 Forward -327 -308 10.9142 0.218
NP_440906.1_5 Forward -231 -224 15.8704 0.0124
NP_440906.1_5 Reverse -224 -231 15.8704 0.0124
NP_440747.1_10 Forward -235 -223 7.51213 0.00286
NP_440747.1_10 Reverse -220 -232 -2.02597 0.0196
NP_441130.1_10 Forward -234 -220 17.3058 0.0167
NP_441130.1_10 Reverse -221 -235 10.3243 0.114
NP_441486.1_1 Forward -235 -221 12.8809 0.00979
NP_441486.1_1 Reverse -220 -234 11.701 0.0149
NP_442850.1_1 Forward -234 -215 16.3545 0.253
NP_440944.1_2 Forward -244 -225 1.67108 0.25
NP_442634.1_4 Reverse -221 -235 -3.63866 0.161
NP_442634.1_4 Reverse -197 -211 -5.70361 0.271
NP_440403.1_4 Reverse -230 -249 -9.63698 0.279
NP_442848.1_1 Forward -238 -224 15.3392 0.015
NP_442848.1_1 Reverse -217 -231 6.29277 0.0791
NP_442848.1_5 Reverse -294 -312 0.805796 0.276
NP_442848.1_9 Forward -238 -219 6.4893 0.189
NP_441012.1_4 Reverse -144 -157 13.4906 0.214
NP_443018.1_3 Forward -231 -224 14.8871 0.0123
NP_443018.1_3 Reverse -224 -231 14.8871 0.0123
NP_443018.1_3 Reverse -230 -237 10.7572 0.0907
NP_443018.1_3 Forward -237 -230 4.56234 0.241
NP_441634.1_8 Forward -234 -220 21.7307 0.0101
NP_441634.1_8 Forward -162 -148 1.76955 0.181
NP_440376.1_1 Forward -232 -223 19.4693 0.000692
NP_440376.1_1 Reverse -223 -232 19.4693 0.000692
NP_441857.1_5 Reverse -216 -234 1.39578 0.297
NP_441588.1_4 Reverse -225 -235 8.63316 0.14
NP_441588.1_4 Forward -230 -220 6.96153 0.178
NP_442687.1_7 Reverse -222 -232 15.8113 0.0125
NP_442687.1_7 Forward -233 -223 8.92815 0.0994
NP_442687.1_7 Forward -246 -236 5.38824 0.206
NP_442191.1_4 Forward -231 -217 14.1927 0.112
NP_442485.1_3 Reverse -218 -237 -1.08219 0.255
NP_442485.1_3 Forward -268 -249 -4.91709 0.286
NP_441080.1_7 Forward -340 -322 7.49153 0.238
NP_441080.1_7 Reverse -314 -332 5.72158 0.296
NP_441422.1_7 Reverse -221 -238 -2.41943 0.213
NP_441950.1_7 Forward -166 -147 -5.60541 0.233
NP_441763.1_10 Reverse -212 -231 11.6017 0.143
NP_441763.1_10 Forward -243 -224 6.78348 0.266
NP_442658.1_1 Reverse -221 -231 18.7607 0.00222
NP_442658.1_1 Forward -240 -230 10.5993 0.114
NP_442658.1_1 Forward -234 -224 6.76441 0.214
NP_441414.1_9 Forward -232 -213 -5.11376 0.169
NP_441487.1_9 Reverse -141 -160 3.53937 0.155
NP_442937.1_5 Reverse -218 -237 8.25926 0.229
NP_442937.1_5 Forward -168 -149 7.7676 0.241
NP_442937.1_5 Forward -237 -218 7.66927 0.244
NP_441958.1_5 Forward -233 -223 12.2714 0.00183
NP_441958.1_5 Reverse -222 -232 12.2714 0.00183
NP_441127.1_1 Forward -238 -224 9.83269 0.267
NP_442057.1_5 Reverse -62 -80 15.0916 0.22
NP_442836.1_5 Reverse -217 -236 4.22769 0.213
NP_442816.1_7 Reverse -170 -189 8.25963 0.238
NP_439905.1_1 Forward -150 -137 8.37742 0.234
NP_440984.1_7 Reverse -218 -232 10.6193 0.122
NP_440984.1_7 Forward -165 -151 6.78443 0.2
NP_440984.1_7 Reverse -137 -151 6.19444 0.224
NP_439990.1_5 Forward -237 -224 10.049 0.128
NP_442911.1_2 Reverse -213 -232 13.2741 0.0118
NP_442911.1_2 Forward -242 -223 4.916 0.0361
NP_442911.1_2 Forward -171 -152 -11.0136 0.296
NP_441580.1_6 Reverse -212 -231 -0.0988766 0.153
NP_440153.1_5 Forward -231 -217 12.586 0.0645
NP_441591.1_10 Forward -250 -231 6.68596 0.281
NP_440858.1_1 Forward -275 -256 4.03102 0.111
NP_443055.1_3 Forward -159 -140 11.3136 0.26
NP_440993.1_2 Reverse -218 -234 2.8118 0.262
NP_440993.1_2 Forward -237 -221 1.92682 0.272
NP_440827.1_3 Reverse -218 -237 14.0608 0.214
NP_440850.1_2 Forward -273 -254 3.44104 0.299
NP_441099.1_5 Forward -242 -223 7.57094 0.0426
NP_442002.1_9 Reverse -222 -229 10.7572 0.185
NP_441294.1_7 Reverse -219 -233 17.2177 0.0101
NP_441646.1_1 Reverse -216 -235 0.392778 0.251
NP_442438.1_10 Reverse -218 -232 17.7975 0.0179
NP_442438.1_10 Forward -237 -223 15.4376 0.0262
NP_441000.1_6 Forward -233 -219 -3.44199 0.221
NP_441000.1_6 Forward -162 -148 -4.62196 0.248
NP_441000.1_6 Reverse -222 -236 -4.91696 0.254
NP_442771.1_1 Reverse -221 -239 -6.66736 0.168
NP_440147.1_4 Forward -234 -221 10.2457 0.0355
NP_440147.1_4 Reverse -330 -343 4.05085 0.173
NP_440147.1_4 Reverse -221 -234 3.36254 0.188
NP_441550.1_8 Forward -234 -224 12.3692 0.0336
NP_441550.1_8 Reverse -221 -231 10.501 0.066
NP_441550.1_8 Forward -283 -273 6.37109 0.212
NP_441916.1_7 Forward -232 -222 18.4663 0.00144
NP_441916.1_7 Reverse -223 -233 10.3048 0.0261
NP_441916.1_10 Forward -240 -221 13.1758 0.122
NP_440345.1_3 Reverse -114 -128 11.4707 0.248
NP_441041.1_4 Reverse -223 -242 7.47261 0.0387
NP_441041.1_4 Forward -232 -213 -9.93197 0.226
NP_441041.1_4 Forward -244 -225 -12.3902 0.265
NP_441041.1_7 Reverse -220 -232 19.5648 0.00277
NP_442396.1_5 Forward -216 -203 9.45906 0.129
NP_441547.1_2 Forward -243 -225 3.55906 0.281
NP_442004.1_6 Reverse -223 -237 11.6026 0.115
NP_441725.1_5 Reverse -224 -234 11.2881 0.0247
NP_441725.1_5 Forward -231 -221 9.02648 0.0553
NP_441725.1_5 Reverse -230 -240 7.05986 0.106
NP_441725.1_5 Forward -280 -270 -1.10161 0.288
NP_439966.1_7 Reverse -221 -231 17.4824 0.00636
NP_439966.1_7 Forward -234 -224 15.8108 0.0124
NP_439966.1_9 Reverse -221 -230 10.7178 0.0863
NP_442941.1_3 Reverse -224 -234 19.9412 0.00262
NP_442941.1_3 Forward -231 -221 2.53664 0.14
NP_442941.1_3 Reverse -230 -240 0.275027 0.222
NP_440289.1_2 Reverse -220 -233 19.6855 0.00426
NP_440289.1_2 Forward -235 -222 6.60746 0.0591
NP_440289.1_2 Forward -284 -271 -4.30728 0.286
NP_442281.1_1 Reverse -218 -232 17.6985 0.00542
NP_442281.1_1 Forward -237 -223 15.5352 0.0117
NP_441334.1_7 Reverse -368 -387 -21.24 0.293
NP_440437.1_1 Reverse -217 -236 4.03102 0.112
NP_440437.1_1 Forward -238 -219 -4.42544 0.258
NP_441457.1_7 Forward -240 -221 -0.983855 0.293
NP_441556.1_4 Reverse -263 -282 11.0656 0.257
NP_441556.1_10 Reverse -224 -238 9.92981 0.281
NP_442982.1_5 Reverse -213 -232 -3.54046 0.299
NP_441644.1_6 Reverse -223 -233 17.3841 0.00127
NP_441644.1_6 Reverse -229 -239 10.6976 0.0628
NP_441644.1_6 Forward -232 -222 10.1076 0.0628
NP_443049.1_6 Reverse -385 -395 13.3976 0.182
NP_440867.1_10 Forward -281 -262 0.786102 0.299
NP_442215.1_2 Reverse -221 -237 12.0549 0.0342
NP_442215.1_2 Forward -234 -218 0.746852 0.148
NP_442215.1_2 Forward -247 -231 -4.36636 0.232
NP_442029.1_6 Forward -314 -295 3.73603 0.277
NP_440253.1_2 Forward -232 -214 10.9339 0.0356
NP_440253.1_2 Reverse -2 -20 4.14905 0.106
NP_440253.1_2 Reverse -223 -241 0.707465 0.179
NP_440929.1_8 Forward -232 -223 19.2726 0.000701
NP_440929.1_8 Reverse -223 -232 19.2726 0.000701
NP_442933.1_10 Forward -232 -223 17.601 0.00325
NP_442933.1_10 Reverse -223 -232 17.601 0.00325
NP_442933.1_10 Forward -379 -370 6.98123 0.116
NP_442933.1_10 Reverse -74 -83 4.52295 0.24
NP_441751.2_8 Reverse -224 -238 14.0609 0.0132
NP_441751.2_8 Reverse -230 -244 -5.80194 0.239
NP_442554.1_8 Forward -231 -221 16.008 0.0065
NP_442554.1_8 Reverse -224 -234 15.9097 0.00747
NP_442554.1_8 Reverse -230 -240 6.66654 0.111
NP_441762.1_7 Forward -233 -221 12.4287 0.0142
NP_441762.1_7 Reverse -222 -234 2.30059 0.0676
NP_442142.1_4 Forward -235 -222 16.7349 0.0264
NP_442142.1_4 Reverse -220 -233 13.8833 0.0324
NP_442142.1_4 Forward -86 -73 6.80355 0.154
NP_442142.1_4 Reverse -226 -239 5.82024 0.182
NP_442292.1_1 Reverse -224 -233 18.486 0.00229
NP_442292.1_1 Forward -231 -222 9.63616 0.0183
NP_442292.1_1 Reverse -230 -239 4.71961 0.172
NP_442476.1_6 Forward -231 -217 4.81781 0.142
NP_442381.1_8 Reverse -220 -239 -14.8485 0.288
NP_441711.1_4 Reverse -214 -233 7.17762 0.144
NP_443009.1_5 Forward -233 -222 18.3477 0.00265
NP_443009.1_5 Reverse -79 -90 3.49977 0.292
NP_442741.1_7 Forward -211 -192 13.5691 0.196
NP_441715.1_4 Reverse -224 -234 14.828 0.0268
NP_441715.1_4 Forward -231 -221 9.32148 0.097
NP_440357.1_3 Reverse -149 -168 -0.983855 0.296
NP_440015.1_9 Reverse -223 -241 8.08229 0.111
NP_440183.1_9 Forward -393 -374 -20.3551 0.282
NP_441198.1_8 Forward -240 -230 11.3181 0.211
NP_441468.1_1 Forward -231 -224 15.8704 0.0124
NP_441468.1_1 Reverse -224 -231 15.8704 0.0124
NP_441468.1_1 Forward -237 -230 4.07068 0.263
NP_441618.1_7 Reverse -236 -255 19.4344 0.188
NP_441020.2_6 Forward -234 -217 11.2486 0.124
NP_441015.1_10 Forward -237 -218 -2.0655 0.178
NP_441673.1_1 Forward -232 -223 20.8459 0.000698
NP_441673.1_1 Reverse -223 -232 20.8459 0.000698
NP_441826.1_2 Reverse -217 -231 21.5341 0.00551
NP_441826.1_2 Forward -238 -224 15.5359 0.0196
NP_441826.1_2 Reverse -223 -237 9.2427 0.0617
NP_441826.1_5 Forward -231 -212 2.26107 0.276
NP_442868.1_6 Forward -234 -224 9.91146 0.038
NP_442868.1_6 Reverse -221 -231 8.53483 0.0555
NP_442719.1_2 Forward -20 -2 -1.45654 0.175
NP_441056.1_1 Reverse -223 -242 12.2908 0.0454
NP_441056.1_1 Forward -238 -219 -8.06369 0.282
NP_441612.1_2 Reverse -223 -233 8.54929 0.21
NP_442361.1_3 Forward -238 -225 8.9674 0.285
NP_442808.1_1 Reverse -222 -232 18.4657 0.00201
NP_442808.1_1 Reverse -298 -308 9.616 0.0481
NP_442808.1_1 Forward -233 -223 8.63269 0.0481
NP_442808.1_1 Forward -101 -91 6.27276 0.121
NP_442808.1_1 Reverse -150 -160 1.84789 0.281
NP_442775.1_6 Reverse -218 -237 12.5858 0.277
NP_442775.1_6 Forward -237 -218 10.7175 0.277
NP_442542.1_2 Reverse -221 -234 21.0621 0.00555
NP_442542.1_2 Reverse -270 -283 6.1158 0.234
NP_442050.1_5 Forward -234 -224 16.4991 0.00812
NP_442050.1_5 Reverse -221 -231 8.23937 0.234
NP_442342.1_9 Reverse -221 -237 13.3332 0.0994
NP_440558.1_2 Reverse -226 -245 1.86774 0.175
NP_440558.1_2 Reverse -148 -167 -6.58872 0.277
NP_440111.2_2 Reverse -261 -280 0.196116 0.212
NP_442593.1_9 Forward -339 -320 19.8661 0.226
NP_441878.1_6 Forward -233 -223 10.4031 0.0176
NP_441878.1_6 Reverse -222 -232 10.4031 0.0176
NP_441878.1_6 Reverse -141 -151 -7.19813 0.21
NP_441878.1_6 Forward -239 -229 -7.39479 0.222
NP_441878.1_6 Forward -151 -141 -7.39479 0.222
NP_441036.1_8 Reverse -222 -232 17.7779 0.000554
NP_441036.1_8 Forward -233 -223 8.33817 0.174
NP_442650.1_2 Reverse -223 -237 6.88276 0.13
NP_441557.1_5 Forward -232 -223 19.9609 0.000699
NP_441557.1_5 Reverse -223 -232 19.9609 0.000699
NP_441445.1_1 Forward -241 -222 4.52268 0.193
NP_441445.1_1 Forward -163 -144 1.67108 0.248
NP_442066.2_4 Forward -232 -213 -7.86702 0.289
NP_442066.2_9 Reverse -219 -232 8.37742 0.185
NP_441308.1_8 Reverse -221 -231 9.22315 0.226
NP_440101.1_3 Reverse -218 -237 8.75091 0.154
NP_442183.1_1 Reverse -223 -237 16.1259 0.0162
NP_442183.1_1 Forward -232 -218 11.406 0.0702
NP_442397.1_9 Reverse -223 -242 6.39097 0.246
NP_442347.1_2 Reverse -224 -233 12.4878 0.056
NP_442347.1_2 Forward -231 -222 11.1111 0.056
NP_442645.1_2 Forward -240 -221 2.75272 0.0359
NP_442645.1_2 Reverse -221 -240 -11.9969 0.144
NP_442645.1_2 Forward -91 -72 -18.2901 0.27
NP_442888.1_6 Reverse -212 -231 14.5524 0.148
NP_441037.1_4 Reverse -221 -231 16.2838 0.0168
NP_442594.1_8 Reverse -62 -81 5.80098 0.239
NP_442317.1_6 Reverse -44 -63 2.3594 0.285
NP_441633.1_3 Forward -234 -221 11.1307 0.0286
NP_441633.1_3 Reverse -221 -234 -3.81562 0.177
NP_441633.1_3 Reverse -150 -163 -4.79893 0.212
NP_440136.1_2 Forward -231 -224 15.9687 0.0123
NP_440136.1_2 Reverse -224 -231 15.9687 0.0123
NP_442590.1_9 Forward -282 -263 13.4708 0.223
NP_442590.1_9 Forward -167 -148 5.99764 0.267
NP_442590.1_10 Reverse -223 -242 15.3391 0.113
NP_442590.1_10 Forward -251 -232 4.916 0.27
NP_442590.1_10 Forward -238 -219 3.14605 0.295
NP_442998.1_10 Forward -230 -223 15.5754 0.0102
NP_442998.1_10 Reverse -225 -232 15.5754 0.0102
NP_440731.1_2 Forward -244 -225 5.99764 0.293
NP_440299.1_1 Forward -236 -223 14.08 0.0259
NP_440299.1_1 Reverse -219 -232 11.4251 0.0489
NP_441799.1_1 Forward -236 -222 5.99717 0.187
NP_440640.1_6 Forward -244 -225 -1.37718 0.3
NP_441007.1_5 Reverse -188 -207 14.8474 0.173
NP_441007.1_10 Reverse -218 -231 3.46087 0.182
NP_441007.1_10 Forward -237 -224 2.67422 0.183
NP_440256.1_1 Forward -235 -216 9.3409 0.0206
NP_440256.1_1 Reverse -367 -386 -6.98204 0.225
NP_440256.1_1 Forward -302 -283 -10.3253 0.299
NP_440087.1_1 Forward -160 -141 -1.96717 0.197
NP_441559.1_8 Forward -94 -80 9.5377 0.0639
NP_441559.1_8 Reverse -147 -161 4.12949 0.132
NP_441559.1_8 Reverse -86 -100 -3.04867 0.197
NP_441559.1_8 Reverse -295 -309 -4.62196 0.231
NP_441559.1_8 Reverse -218 -232 -6.29359 0.276
NP_441559.1_8 Forward -155 -141 -7.37523 0.291
NP_440915.1_6 Reverse -219 -233 15.9292 0.0183
NP_440915.1_6 Forward -236 -222 4.52282 0.0953
NP_442785.1_7 Reverse -140 -154 10.9143 0.228
NP_442069.1_8 Reverse -187 -206 6.39097 0.235
NP_440702.1_8 Reverse -283 -302 11.1109 0.25
NP_441113.1_3 Forward -247 -233 14.5519 0.27
NP_441939.1_3 Forward -231 -212 11.0125 0.118
NP_441199.1_6 Reverse -219 -238 -1.18052 0.287
NP_442993.1_1 Reverse -223 -239 0.845183 0.0609
NP_442993.1_1 Reverse -229 -245 -9.67623 0.19
NP_442386.1_9 Reverse -222 -231 15.7322 0.0144
NP_442386.1_9 Forward -233 -224 13.8639 0.0289
NP_442386.1_9 Reverse -247 -256 9.43907 0.161
NP_442386.1_9 Forward -100 -91 7.57079 0.219
NP_442386.1_9 Reverse -299 -308 6.58748 0.219
NP_442386.1_9 Reverse -228 -237 4.81753 0.282
NP_441340.1_5 Forward -231 -224 15.6737 0.0124
NP_441340.1_5 Reverse -224 -231 15.6737 0.0124
NP_441340.1_5 Reverse -230 -237 3.97235 0.274
NP_441947.1_10 Reverse -227 -245 1.10079 0.276
NP_441947.1_10 Reverse -221 -239 -0.570838 0.276
NP_442484.1_2 Reverse -231 -250 0.982764 0.24
NP_442791.1_5 Forward -387 -368 -9.44032 0.279
NP_440168.1_9 Forward -152 -133 -2.45882 0.28
NP_442240.1_2 Forward -231 -212 -4.52377 0.0843
NP_440586.1_8 Forward -231 -224 13.2151 0.026
NP_440586.1_8 Reverse -224 -231 13.2151 0.026
NP_442251.1_6 Forward -231 -224 15.2804 0.0124
NP_442251.1_6 Reverse -224 -231 15.2804 0.0124
NP_440684.1_9 Forward -238 -224 15.1426 0.0988
NP_440684.1_9 Forward -160 -146 8.25939 0.233
NP_441262.1_3 Reverse -223 -230 14.7888 0.0223
NP_441262.1_3 Forward -232 -225 14.7888 0.0223
NP_440027.1_3 Reverse -213 -231 2.96833 0.282
NP_440027.1_3 Reverse -142 -160 2.47668 0.289
NP_440027.1_8 Reverse -220 -239 4.42355 0.287
NP_443051.1_1 Reverse -222 -231 10.4228 0.00754
NP_443051.1_1 Forward -233 -224 10.4228 0.00754
NP_443051.1_1 Forward -239 -230 0.0980582 0.226
NP_440408.1_3 Reverse -217 -236 0.687771 0.204
NP_440408.1_10 Forward -238 -219 9.53756 0.176
NP_440439.1_1 Reverse -220 -233 2.47756 0.133
NP_440439.1_1 Forward -235 -222 0.117615 0.202
NP_440372.1_2 Forward -231 -224 16.3621 0.0124
NP_440372.1_2 Reverse -224 -231 16.3621 0.0124
NP_440316.1_10 Forward -239 -229 15.2213 0.171
NP_440316.1_10 Reverse -271 -281 7.55152 0.246
NP_441803.1_2 Forward -237 -218 20.5506 0.0223
NP_441803.1_2 Reverse -218 -237 3.44104 0.191
NP_439977.1_5 Reverse -217 -236 12.8808 0.0531
NP_439977.1_5 Forward -238 -219 -2.65548 0.287
NP_440139.1_1 Forward -238 -219 4.22689 0.189
NP_441572.1_7 Reverse -217 -236 -3.63879 0.217
NP_442384.1_10 Reverse -223 -236 10.049 0.047
NP_442384.1_10 Forward -232 -219 2.2809 0.23
NP_442339.1_3 Reverse -218 -236 15.0638 0.157
NP_442114.1_4 Forward -232 -221 12.1534 0.107
NP_441018.1_7 Reverse -219 -238 10.7175 0.199
NP_441018.1_7 Forward -303 -284 7.96426 0.259
NP_441018.1_7 Forward -313 -294 6.68596 0.283
NP_442262.1_10 Forward -231 -224 14.1988 0.0123
NP_442262.1_10 Reverse -224 -231 14.1988 0.0123
NP_442262.1_10 Reverse -230 -237 9.87221 0.164
NP_441689.1_5 Forward -234 -224 15.3192 0.0403
NP_441689.1_5 Forward -240 -230 5.28945 0.273
NP_441814.1_8 Reverse -338 -357 19.2414 0.296
NP_440163.1_10 Forward -235 -225 11.3864 0.169
NP_440344.1_10 Reverse -216 -233 3.28376 0.0273
NP_440344.1_10 Forward -239 -222 1.90713 0.0294
NP_440282.1_10 Forward -249 -230 -7.27704 0.251
NP_440531.1_6 Reverse -134 -153 -1.7705 0.239
NP_441965.1_3 Forward -242 -223 -1.47551 0.285
NP_440297.1_9 Reverse -224 -234 9.32148 0.0917
NP_440297.1_9 Reverse -230 -240 6.96153 0.161
NP_440297.1_9 Forward -280 -270 -0.216628 0.282
NP_440297.1_9 Forward -231 -221 -0.216628 0.282
NP_441896.1_3 Reverse -214 -233 -0.197208 0.234
NP_441103.1_2 Reverse -212 -230 11.5231 0.156
NP_440894.1_10 Reverse -218 -237 21.4356 0.0278
NP_442129.1_6 Forward -329 -310 15.3038 0.246
NP_440999.1_9 Reverse -219 -233 23.6974 0.0055
NP_440888.1_2 Forward -232 -218 20.9434 0.000502
NP_440888.1_2 Reverse -223 -237 18.9768 0.00173
NP_440888.1_2 Reverse -229 -243 12.487 0.0442
NP_440888.1_2 Reverse -151 -165 8.84875 0.145
NP_440888.1_2 Forward -309 -295 6.68548 0.223
NP_440888.1_2 Reverse -80 -94 6.68548 0.223
NP_440491.1_1 Reverse -220 -239 16.2729 0.0697
NP_440491.1_1 Forward -235 -216 14.3238 0.111
NP_442277.1_2 Forward -396 -382 10.0294 0.294
NP_442277.1_4 Forward -217 -198 8.84842 0.12
NP_442033.1_10 Forward -102 -83 -9.63698 0.22
NP_441543.1_2 Forward -231 -222 18.486 0.00236
NP_441543.1_2 Reverse -224 -233 16.9127 0.00359
NP_441543.1_2 Reverse -230 -239 4.0313 0.293
NP_442845.1_2 Forward -238 -224 17.4042 0.0608
NP_442845.1_2 Reverse -223 -237 7.57108 0.195
NP_442845.1_2 Forward -244 -230 3.44117 0.29
NP_441304.1_10 Forward -62 -53 13.4711 0.241
NP_441918.1_7 Forward -233 -214 -1.47551 0.297
NP_441469.1_8 Reverse -222 -231 16.126 0.00797
NP_441469.1_8 Forward -233 -224 6.48957 0.227
NP_443064.1_6 Reverse -223 -233 12.5669 0.0796
NP_442578.1_7 Forward -231 -224 14.5921 0.026
NP_442578.1_7 Reverse -224 -231 14.5921 0.026
NP_441462.1_2 Forward -232 -222 11.5831 0.00406
NP_441462.1_2 Reverse -223 -233 11.5831 0.00406
NP_441621.1_7 Forward -234 -220 -3.34366 0.188
NP_441621.1_7 Reverse -221 -235 -3.34366 0.188
NP_443062.1_1 Forward -232 -214 5.91323 0.215
NP_443062.1_1 Forward -379 -361 5.13317 0.238
NP_443062.1_1 Reverse -223 -241 4.2556 0.268
NP_443062.1_1 Reverse -74 -92 3.47554 0.297
NP_443062.1_6 Forward -240 -221 9.0459 0.133
NP_442204.1_1 Reverse -195 -206 8.61347 0.0897
NP_442204.1_1 Forward -383 -372 8.02348 0.107
NP_442204.1_1 Forward -242 -231 1.14031 0.28
NP_442204.1_1 Forward -236 -225 0.353664 0.281
NP_442204.1_5 Forward -255 -236 1.47442 0.235
NP_441351.1_8 Reverse -221 -240 7.57094 0.192
NP_440516.1_8 Forward -232 -223 16.9127 0.00442
NP_440516.1_8 Reverse -223 -232 16.9127 0.00442
NP_440516.1_8 Reverse -272 -281 7.17789 0.0754
NP_440516.1_8 Forward -238 -229 -0.491928 0.262
NP_441785.1_1 Reverse -223 -237 16.8106 0.0943
NP_442428.1_4 Reverse -222 -241 10.9142 0.131
NP_442428.1_5 Forward -231 -224 15.8704 0.0124
NP_442428.1_5 Reverse -224 -231 15.8704 0.0124
NP_442428.1_5 Forward -237 -230 4.46401 0.267
NP_441790.1_3 Forward -231 -212 -5.21209 0.291
NP_442859.1_2 Forward -231 -212 4.22769 0.219
NP_442120.1_10 Reverse -223 -242 0.884433 0.156
NP_442120.1_10 Forward -238 -219 -7.08038 0.217
NP_442120.1_10 Forward -244 -225 -16.1268 0.296
NP_442120.1_10 Reverse -217 -236 -16.1268 0.296
NP_440673.1_3 Forward -230 -223 12.4288 0.0426
NP_440673.1_3 Reverse -225 -232 12.4288 0.0426
NP_440673.1_3 Reverse -231 -238 8.98723 0.203
NP_440673.1_7 Forward -243 -224 1.17943 0.253
NP_440865.1_9 Forward -238 -219 1.17943 0.125
NP_440865.1_10 Reverse -286 -300 17.0102 0.242
NP_441052.1_2 Reverse -223 -233 19.9412 0.00106
NP_441052.1_2 Forward -232 -222 10.5014 0.0285
NP_442219.1_8 Reverse -219 -238 16.4776 0.0805
NP_442219.1_9 Reverse -224 -233 17.7976 0.00718
NP_442219.1_9 Forward -231 -222 8.35786 0.0681
NP_442219.1_9 Forward -256 -247 2.94966 0.21
NP_440436.1_4 Forward -231 -222 18.1905 0.00233
NP_440436.1_4 Reverse -224 -233 17.2072 0.00233
NP_441884.1_9 Reverse -220 -239 -13.3736 0.138
NP_441884.1_9 Forward -235 -216 -22.715 0.284
NP_440314.1_9 Forward -340 -321 -6.39206 0.228
NP_441719.1_4 Forward -231 -224 16.3621 0.0124
NP_441719.1_4 Reverse -224 -231 16.3621 0.0124
NP_441733.1_10 Reverse -220 -233 10.639 0.106
NP_441733.1_10 Forward -235 -222 9.95071 0.106
NP_441004.1_1 Forward -238 -219 -11.8986 0.243
NP_441004.1_1 Forward -166 -147 -12.8819 0.251
NP_441004.1_5 Forward -164 -150 8.55439 0.274
NP_442813.1_4 Reverse -227 -246 -6.98204 0.299
NP_442366.1_3 Reverse -222 -240 13.7855 0.0244
NP_442873.1_9 Forward -242 -223 7.57013 0.236
NP_441115.1_4 Forward -233 -215 11.8181 0.127
NP_442694.1_3 Reverse -264 -282 -4.20908 0.268
NP_442694.1_4 Forward -134 -125 12.6844 0.248
NP_443054.1_2 Forward -234 -220 21.7307 0.00482
NP_441851.1_10 Reverse -222 -232 16.008 0.00552
NP_441851.1_10 Forward -233 -223 15.8113 0.00552
NP_441851.1_10 Forward -162 -152 10.4031 0.0935
NP_441668.1_4 Reverse -310 -329 -2.0655 0.286
NP_442515.1_1 Forward -233 -219 -2.36035 0.273
NP_440593.1_3 Reverse -218 -237 1.86774 0.183
NP_440593.1_3 Forward -237 -218 -4.42544 0.248
NP_440593.1_3 Reverse -237 -256 -7.17871 0.288
NP_441349.1_10 Reverse -121 -140 -6.39206 0.228
NP_440432.1_9 Forward -231 -216 5.48643 0.055
NP_442843.1_1 Forward -237 -218 -7.4737 0.248
NP_439960.1_10 Forward -239 -221 -4.70074 0.296
NP_442450.1_5 Forward -234 -224 9.32148 0.115
NP_440195.1_4 Reverse -211 -230 19.0757 0.0357
NP_440195.1_4 Forward -244 -225 11.6025 0.139
NP_442006.1_2 Reverse -263 -280 -8.90928 0.197
NP_441003.1_9 Reverse -254 -273 10.8159 0.213
NP_440483.1_1 Reverse -372 -391 -4.13045 0.218
NP_442243.1_1 Reverse -217 -235 1.29671 0.218
NP_441570.1_1 Reverse -223 -241 -9.32229 0.134
NP_441570.1_1 Forward -238 -220 -16.6971 0.252
NP_441078.1_4 Forward -232 -223 19.6659 0.0007
NP_441078.1_4 Reverse -223 -232 19.6659 0.0007
NP_441078.1_4 Forward -238 -229 -1.57357 0.266
NP_442729.1_8 Forward -236 -223 8.47575 0.125
NP_442729.1_8 Reverse -219 -232 8.47575 0.125
NP_442348.1_2 Forward -135 -126 13.5694 0.179
NP_442443.1_1 Forward -165 -146 -3.44213 0.267
NP_442443.1_4 Forward -269 -259 14.3359 0.227
NP_441091.1_5 Reverse -219 -238 6.68596 0.208
NP_440526.1_3 Forward -231 -220 11.7595 0.0646
NP_440526.1_3 Reverse -224 -235 10.1862 0.0646
NP_441432.1_8 Forward -233 -224 16.8143 0.00595
NP_441432.1_8 Forward -239 -230 15.0444 0.0182
NP_441432.1_8 Reverse -222 -231 8.25953 0.0755
NP_441432.1_8 Reverse -90 -99 2.65466 0.292
NP_442320.1_8 Reverse -217 -231 14.8476 0.0132
NP_442320.1_8 Forward -238 -224 14.2576 0.0136
NP_441732.1_2 Forward -236 -220 -6.52964 0.0495
NP_441732.1_2 Reverse -219 -235 -15.3794 0.145
NP_441732.1_2 Forward -242 -226 -15.7728 0.16
NP_440760.1_1 Forward -232 -213 -12.4886 0.0931
NP_440760.1_1 Reverse -223 -242 -12.7836 0.0947
NP_442797.1_7 Reverse -222 -240 -0.669169 0.284
NP_440199.1_10 Forward -235 -225 16.7946 0.0381
NP_440199.1_10 Forward -86 -76 6.76487 0.269
NP_442489.1_7 Forward -232 -223 20.1576 0.000695
NP_442489.1_7 Reverse -223 -232 20.1576 0.000695
NP_442489.1_7 Forward -238 -229 -1.57357 0.213
NP_442489.1_7 Reverse -229 -238 -2.06522 0.288
NP_440559.1_1 Reverse -224 -233 17.4043 0.00658
NP_440559.1_1 Forward -231 -222 8.75118 0.0586
NP_441659.2_8 Reverse -223 -233 18.1713 0.00133
NP_441659.2_8 Forward -232 -222 11.9764 0.0147
NP_442913.1_9 Forward -238 -219 11.2092 0.199
NP_442913.1_10 Reverse -214 -233 4.03102 0.0942
NP_441040.1_2 Forward -227 -208 -14.5535 0.286
NP_441040.1_2 Reverse -234 -253 -15.5368 0.286
NP_441040.1_5 Forward -249 -230 2.0644 0.294
NP_441040.1_9 Reverse -310 -329 9.3409 0.262
NP_441807.1_5 Forward -352 -333 20.8456 0.058
NP_442346.1_5 Forward -233 -223 16.6963 0.00248
NP_442346.1_5 Forward -380 -370 9.22315 0.118
NP_442346.1_5 Reverse -222 -232 9.02648 0.118
NP_442346.1_5 Forward -239 -229 4.3066 0.291
NP_442346.1_10 Forward -162 -143 0.982764 0.225
NP_440545.1_3 Forward -236 -219 -2.02611 0.179
NP_440545.1_3 Forward -212 -195 -5.95935 0.265
NP_440831.1_3 Reverse -263 -282 11.4352 0.163
NP_440459.1_2 Forward -234 -217 10.1669 0.207
NP_440459.1_2 Forward -241 -224 8.00365 0.272
NP_440459.1_2 Forward -247 -230 7.80699 0.278
NP_441653.1_2 Reverse -212 -231 7.10507 0.223
NP_440010.1_10 Reverse -260 -279 5.89931 0.226
NP_442603.1_7 Forward -281 -267 5.80051 0.273
NP_441585.1_5 Reverse -303 -322 1.96529 0.282
NP_441888.1_7 Reverse -218 -232 2.5562 0.225
NP_441888.1_7 Reverse -337 -351 2.16287 0.225
NP_440449.1_6 Reverse -215 -233 8.93668 0.191
NP_441948.1_4 Reverse -83 -101 -4.60241 0.235
NP_440170.1_3 Reverse -188 -207 5.01433 0.281
NP_441833.1_4 Forward -231 -224 15.9687 0.0124
NP_441833.1_4 Reverse -224 -231 15.9687 0.0124
NP_440751.1_8 Forward -147 -128 5.40766 0.233
NP_442162.1_9 Forward -231 -224 16.2637 0.0124
NP_442162.1_9 Reverse -224 -231 16.2637 0.0124
NP_440671.1_4 Forward -238 -224 19.8624 0.00827
NP_440671.1_4 Reverse -217 -231 8.06273 0.204
NP_440671.1_4 Forward -244 -230 5.99778 0.266
NP_441973.1_1 Reverse -233 -248 1.15987 0.235
NP_442140.1_3 Forward -231 -221 17.4829 0.0159
NP_442140.1_3 Reverse -224 -234 4.40493 0.243
NP_440875.1_9 Forward -230 -220 17.619 0.0104
NP_441813.1_5 Forward -234 -224 15.9097 0.01
NP_441813.1_5 Reverse -221 -231 10.0098 0.0208
NP_440590.1_4 Forward -231 -218 21.7504 0.00377
NP_440590.1_4 Reverse -224 -237 12.409 0.0141
NP_440567.1_1 Reverse -224 -238 12.8809 0.0215
NP_440567.1_1 Forward -231 -217 9.83269 0.0414
NP_442497.1_10 Forward -231 -222 10.4228 0.0087
NP_442497.1_10 Reverse -224 -233 10.4228 0.0087
NP_440821.1_4 Reverse -221 -231 18.7612 0.00422
NP_440821.1_4 Forward -234 -224 18.2696 0.00448
NP_441239.1_9 Reverse -221 -233 16.0669 0.0175
NP_441239.1_9 Forward -234 -222 6.92215 0.173
NP_441239.1_9 Forward -283 -271 4.5622 0.251
NP_441951.1_4 Forward -238 -219 10.4225 0.228
NP_440156.1_4 Reverse -312 -322 15.2208 0.176
NP_441892.1_1 Forward -388 -371 3.0871 0.131
NP_441892.1_1 Forward -247 -230 0.628827 0.165
NP_441892.1_1 Forward -241 -224 -1.82945 0.214
NP_441892.1_1 Reverse -214 -231 -3.00942 0.231
NP_441892.1_1 Reverse -220 -237 -4.38605 0.26
NP_442044.1_1 Forward -94 -75 -14.0619 0.283
NP_442044.1_9 Forward -232 -213 4.52268 0.226
NP_442193.1_8 Reverse -220 -239 10.2251 0.286
NP_441508.1_4 Reverse -209 -223 15.2903 0.244
NP_441017.1_6 Forward -236 -222 15.7319 0.0926
NP_441017.1_6 Forward -242 -228 13.8636 0.17
NP_442629.1_4 Reverse -303 -322 13.6675 0.263
NP_441874.1_1 Reverse -238 -252 9.34103 0.277
NP_442216.1_4 Reverse -52 -60 8.1805 0.255
NP_440354.1_7 Reverse -336 -354 5.91901 0.296
NP_441617.1_6 Reverse -313 -332 -0.983855 0.256
NP_441617.1_6 Forward -329 -310 -7.37537 0.292
NP_442138.1_9 Reverse -210 -229 11.6017 0.202
NP_440546.1_4 Forward -232 -222 11.8882 0.0679
NP_440546.1_4 Reverse -272 -282 11.7912 0.0712
NP_440546.1_4 Reverse -223 -233 10.046 0.109
NP_440546.1_4 Forward -281 -271 6.8464 0.276
NP_439974.1_4 Reverse -212 -231 9.14423 0.253
NP_441230.1_5 Reverse -218 -237 13.0775 0.0635
NP_440462.1_6 Reverse -221 -231 17.9746 0.00578
NP_440462.1_6 Forward -234 -224 7.74818 0.0699
NP_440868.1_4 Reverse -219 -231 2.98891 0.142
NP_440868.1_4 Forward -236 -224 -0.846001 0.282
NP_442479.1_9 Reverse -311 -330 -6.39206 0.266
NP_441848.1_9 Forward -209 -198 17.561 0.166
NP_441084.1_6 Reverse -214 -228 13.1254 0.145
NP_442460.1_3 Forward -322 -303 12.0942 0.246
NP_442039.1_4 Forward -231 -224 15.1821 0.0124
NP_442039.1_4 Reverse -224 -231 15.1821 0.0124
NP_441811.1_8 Forward -238 -224 7.57108 0.241
NP_441811.1_8 Reverse -74 -88 6.58777 0.267
NP_442829.1_2 Forward -184 -168 9.49396 0.287
NP_440008.1_9 Forward -238 -219 12.2908 0.187
NP_441926.1_3 Reverse -229 -245 7.13836 0.17
NP_441926.1_3 Reverse -223 -239 6.45005 0.17
NP_442837.1_3 Forward -231 -224 15.7721 0.0124
NP_442837.1_3 Reverse -224 -231 15.7721 0.0124
NP_439994.1_1 Reverse -74 -93 8.35759 0.271
NP_439994.1_3 Forward -90 -71 7.95079 0.296
NP_439994.1_3 Reverse -222 -241 7.75569 0.3
NP_442053.1_1 Forward -232 -223 18.3876 0.0007
NP_442053.1_1 Reverse -223 -232 18.3876 0.0007
NP_440505.1_3 Forward -234 -224 16.303 0.00696
NP_440505.1_3 Reverse -221 -231 14.1397 0.0235
NP_440505.1_3 Forward -240 -230 4.40493 0.292
NP_440505.1_7 Forward -154 -135 -0.983855 0.271
NP_441102.1_1 Forward -231 -212 4.62101 0.265
NP_441252.1_6 Forward -325 -318 11.6422 0.288
NP_442255.1_3 Forward -316 -297 7.96426 0.299
NP_442255.1_5 Reverse -115 -134 17.7974 0.195
NP_440914.1_1 Reverse -223 -233 17.5935 0.000537
NP_440914.1_1 Forward -238 -228 13.2019 0.0378
NP_440914.1_1 Forward -232 -222 8.6151 0.186
NP_440914.1_1 Forward -89 -79 8.41992 0.191
NP_440914.1_1 Reverse -300 -310 6.46809 0.279
NP_440914.1_4 Reverse -149 -165 11.5625 0.271
NP_441011.1_8 Forward -231 -222 16.9127 0.00602
NP_441011.1_8 Reverse -224 -233 8.25953 0.144
NP_442533.1_6 Forward -232 -223 17.2076 0.00137
NP_442533.1_6 Reverse -223 -232 17.2076 0.00137
NP_440263.1_5 Reverse -316 -330 14.0609 0.262
NP_441482.1_7 Forward -238 -224 0.786239 0.0554
NP_441482.1_7 Reverse -217 -231 -8.26021 0.193
NP_439944.1_9 Reverse -224 -234 19.0562 0.00329
NP_439944.1_9 Forward -231 -221 10.4031 0.0887
NP_442597.1_8 Forward -237 -218 20.059 0.131
NP_441028.1_6 Reverse -258 -268 5.19112 0.265
NP_440116.1_8 Forward -231 -212 -8.26035 0.25
NP_440007.1_9 Forward -242 -228 11.3077 0.163
NP_440007.1_9 Forward -236 -222 2.16287 0.281
NP_441680.1_4 Reverse -137 -156 -2.65548 0.27
NP_441602.1_3 Forward -237 -218 9.73422 0.117
NP_441602.1_3 Forward -314 -295 -3.63879 0.251
NP_441602.1_3 Forward -165 -146 -3.93378 0.256
NP_441106.1_1 Reverse -222 -231 18.191 0.0028
NP_441106.1_1 Forward -233 -224 9.63616 0.0311
NP_441106.1_1 Forward -239 -230 5.60459 0.141
NP_440429.1_2 Forward -237 -218 19.6656 0.0973
NP_439903.1_6 Reverse -220 -239 10.4217 0.106
NP_439903.1_6 Reverse -367 -386 6.58682 0.167
NP_439903.1_6 Forward -241 -222 4.12856 0.202
NP_440797.1_2 Forward -243 -224 12.4724 0.278
NP_441286.1_1 Forward -233 -221 14.7886 0.00418
NP_441286.1_1 Reverse -222 -234 11.8387 0.0114
NP_442674.1_3 Forward -280 -261 9.63507 0.174
NP_440670.1_8 Forward -232 -223 18.3876 0.000699
NP_440670.1_8 Reverse -223 -232 18.3876 0.000699
NP_441705.1_3 Reverse -336 -355 -5.21209 0.291
NP_440886.1_7 Reverse -222 -232 17.7774 0.0011
NP_440886.1_7 Forward -233 -223 7.94438 0.0805
NP_440886.1_7 Reverse -1 -11 3.22451 0.291
NP_442614.1_2 Reverse -272 -286 9.83269 0.242
NP_442072.1_9 Forward -233 -215 23.2253 0.00142
NP_442072.1_9 Reverse -222 -240 -3.32411 0.0355
NP_441753.1_10 Reverse -214 -233 4.12936 0.202
NP_442022.1_4 Forward -163 -144 5.80098 0.279
NP_440907.2_8 Forward -231 -221 17.4824 0.00685
NP_441021.1_1 Reverse -224 -243 14.9458 0.0264
NP_441021.1_8 Forward -237 -219 4.24738 0.223
NP_441463.1_3 Reverse -225 -244 -6.39206 0.245
NP_441463.1_3 Forward -242 -223 -10.227 0.291
NP_441463.1_6 Forward -240 -226 13.6635 0.18
NP_441463.1_6 Forward -234 -220 8.92841 0.25
NP_442842.1_4 Forward -231 -212 3.73603 0.257
NP_441626.1_2 Forward -231 -224 15.7721 0.0124
NP_441626.1_2 Reverse -224 -231 15.7721 0.0124
NP_442211.1_3 Forward -244 -225 10.2926 0.257
NP_440107.1_5 Forward -239 -220 -7.27704 0.281
NP_442794.1_1 Forward -236 -224 10.1671 0.0721
NP_442615.1_1 Reverse -214 -232 -4.99573 0.201
NP_441962.1_4 Forward -237 -218 9.73422 0.0549
NP_441962.1_4 Reverse -218 -237 -12.6852 0.263
NP_441962.1_4 Reverse -224 -243 -13.6686 0.277
NP_441742.1_7 Forward -154 -135 13.0775 0.27
NP_440387.1_1 Reverse -223 -239 14.5132 0.00649
NP_440387.1_1 Forward -232 -216 6.45005 0.0282
NP_440387.1_1 Forward -341 -325 -6.52964 0.292
NP_441431.1_2 Reverse -220 -234 8.75042 0.207
NP_441488.1_7 Reverse -193 -212 12.2908 0.112
NP_441488.1_8 Reverse -237 -251 8.55376 0.184
NP_441993.1_1 Forward -238 -219 16.4678 0.0603
NP_441993.1_1 Reverse -223 -242 5.84498 0.194
NP_441993.1_1 Forward -232 -213 4.09075 0.225
NP_441174.1_2 Forward -163 -149 12.291 0.258
NP_440114.1_10 Reverse -272 -286 11.701 0.106
NP_440114.1_10 Forward -281 -267 6.88276 0.253
NP_440114.1_10 Forward -232 -218 6.88276 0.253
NP_442323.1_7 Reverse -224 -243 4.22689 0.22
NP_440287.1_6 Reverse -214 -233 1.67108 0.266
NP_440293.1_3 Forward -168 -149 -6.78538 0.293
NP_440766.1_4 Forward -236 -222 17.7975 0.0255
NP_440766.1_4 Reverse -219 -233 8.45605 0.0871
NP_441979.1_5 Forward -238 -219 -12.5869 0.228
NP_442743.1_4 Reverse -236 -255 3.24438 0.158
NP_442743.1_5 Forward -237 -218 2.85105 0.285
NP_442635.1_8 Reverse -25 -43 16.3421 0.283
NP_439910.1_2 Reverse -215 -232 -3.8944 0.0691
NP_439910.1_2 Forward -240 -223 -12.0559 0.0788
NP_439910.1_2 Forward -19 -2 -22.5773 0.267
NP_440457.1_1 Forward -236 -224 7.02048 0.105
NP_440457.1_1 Reverse -219 -231 5.34885 0.141
NP_440457.1_1 Reverse -268 -280 1.51394 0.236
NP_440987.1_4 Reverse -311 -330 3.14605 0.288
NP_440798.1_6 Forward -231 -218 3.85419 0.147
NP_442680.1_5 Forward -191 -172 6.03134 0.213
NP_441984.1_3 Reverse -219 -237 5.62401 0.279
NP_441332.1_4 Reverse -300 -319 5.60432 0.261
NP_441332.1_6 Forward -282 -272 12.7117 0.22
NP_442509.1_9 Forward -232 -222 16.2041 0.00739
NP_442509.1_9 Reverse -223 -233 8.14104 0.192
NP_442509.1_9 Reverse -248 -258 7.25606 0.229
NP_440554.1_4 Forward -231 -221 13.943 0.0218
NP_440554.1_4 Reverse -224 -234 7.05986 0.106
NP_440554.1_4 Reverse -230 -240 3.32329 0.234
NP_441885.1_5 Reverse -223 -233 20.9245 0.000538
NP_441885.1_5 Forward -232 -222 11.4848 0.00668
NP_442341.1_7 Forward -233 -219 22.0257 0.00401
NP_442341.1_7 Reverse -222 -236 18.0925 0.0111
NP_442341.1_9 Reverse -221 -235 8.45543 0.17
NP_441756.1_5 Reverse -219 -238 2.65439 0.206
NP_440409.1_1 Forward -168 -149 -0.4922 0.216
NP_443000.1_7 Forward -234 -224 17.0896 0.00865
NP_443000.1_7 Reverse -221 -231 2.04498 0.226
NP_440507.2_3 Forward -241 -222 7.4718 0.278
NP_441842.1_10 Forward -386 -372 6.88276 0.271
NP_440275.1_3 Reverse -221 -231 17.9746 0.0082
NP_440275.1_3 Forward -234 -224 8.1415 0.0602
NP_440091.1_1 Reverse -219 -231 12.6253 0.0353
NP_440091.1_1 Forward -236 -224 8.88877 0.0567
NP_441307.1_4 Forward -388 -369 6.68596 0.177
NP_443010.1_10 Reverse -220 -237 8.37555 0.16
NP_442451.1_2 Forward -240 -221 -4.03212 0.202
NP_442451.1_2 Reverse -215 -234 -10.3253 0.267
NP_440175.1_7 Forward -303 -285 10.2414 0.262
NP_440149.1_8 Forward -238 -219 8.45592 0.0599
NP_440149.1_8 Reverse -223 -242 1.67108 0.121
NP_441105.1_3 Forward -243 -224 0.392778 0.125
NP_441105.1_3 Reverse -212 -231 -1.08219 0.145
NP_441105.1_3 Forward -249 -230 -4.03212 0.19
NP_440216.1_1 Forward -232 -218 8.25939 0.0061
NP_440216.1_1 Reverse -223 -237 -9.73518 0.145
NP_440216.1_1 Forward -161 -147 -11.3085 0.178
NP_440172.1_1 Reverse -223 -233 15.0247 0.00945
NP_440172.1_1 Forward -238 -228 10.0098 0.0572
NP_440172.1_1 Forward -232 -222 8.73149 0.0586
NP_440172.1_1 Reverse -272 -282 1.84832 0.294
NP_442015.1_10 Forward -236 -223 10.344 0.0391
NP_442015.1_10 Reverse -219 -232 3.95252 0.178
NP_441226.1_7 Forward -231 -224 14.4934 0.0123
NP_441226.1_7 Reverse -224 -231 14.4934 0.0123
NP_441226.1_7 Forward -280 -273 9.47853 0.147
NP_441111.1_7 Forward -231 -223 18.7023 0.00294
NP_441111.1_7 Reverse -224 -232 18.7023 0.00294
NP_442379.1_10 Forward -239 -222 6.23369 0.118
NP_441766.1_2 Forward -232 -223 17.5026 0.00297
NP_441766.1_2 Reverse -223 -232 17.5026 0.00297
NP_441766.1_9 Reverse -264 -283 -0.885524 0.261
NP_440416.1_9 Reverse -228 -247 -5.11376 0.0791
NP_440416.1_9 Forward -239 -220 -16.4218 0.215
NP_443052.1_8 Reverse -213 -232 -6.39206 0.143
NP_443052.1_9 Reverse -147 -166 -4.03212 0.254
NP_442116.1_6 Reverse -312 -329 12.2751 0.176
NP_442116.1_6 Forward -329 -312 5.2087 0.299
NP_440591.1_9 Forward -239 -221 13.6872 0.0931
NP_440261.1_5 Forward -231 -218 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCGGCTTCATAGCCCGCATAGGTGATGGTTTGTAAATTGAGAGCTTCCAACAATTGCTGGAGATAACTTAAATCTTCGGCAAAATCTTCTGGGGTTTCCTGGCGGTTTGATTTGTAAGCCCCATCGGCCTCATGGCGAAAAGTGGGTTCCCGACGGTCAAAGGCAATGGCGATCGCCGCTGGTTTTTGGGACTCCATCACCTGCATGAGGGAATTTAAAAATCCAAAACATACACTGGTGGGAATGCCGGCCGTTGTCCGCAGAGGGCCTTTTTTAGACAAACCAAAGGCATAGTAAGCCCGGAATGCCAGGGAATGACCATCAACTAACAATAACAAAGGGGATTTAGCAGACATAAACATGCACCAAGAAGCAAGCTAGATTATACCGCTGTTGCCG

CDS

ATGGCTGCCGATGTGCAATATTTTCTACCTATGGAAGAAGAACATTATGGCCTCGACCAAAACCGTCAAAGCTGGACAAACCCATCCCCGACCAGTGCGGAACGTGCTCCATTGCGGCGACAACTTTTTATGGCAGTGGACACCATGGTGGGGAACGATGTCAATCTCCTGCAAATTTTCATTGAGCAGGCAATAAATTGTTCGGGGACGGACTTAATCCAATTCAGAAAACCCTGTGTGAAAGAGAAGTATTCTCCCAGTCTTTCTTCCTCATTTTATTCTAGATGGCAAAGATTTCTTAGATTAATAAAAAGTCTATGA

Protein

MAADVQYFLPMEEEHYGLDQNRQSWTNPSPTSAERAPLRRQLFMAVDTMVGNDVNLLQIFIEQAINCSGTDLIQFRKPCVKEKYSPSLSSSFYSRWQRFLRLIKSL