Your browser is old and dusty. Try Google Chrome!

Details for sll0666

ORF sll0666
Accession NP_442681.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY523r: 3109761 - 3110626]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -47 -40 8.39725 0.213
NP_440694.1_6 Reverse -42 -61 4.52268 0.281
NP_440815.1_2 Forward -341 -327 17.8952 0.162
NP_441453.1_1 Reverse -32 -50 2.28001 0.299
NP_441453.1_4 Reverse -209 -217 5.32929 0.147
NP_441453.1_4 Forward -194 -186 4.34598 0.257
NP_441453.1_8 Forward -225 -208 12.5269 0.205
NP_440259.1_4 Reverse -306 -320 9.21432 0.278
NP_442752.1_4 Forward -218 -211 4.56234 0.265
NP_443027.1_4 Forward -196 -186 5.87989 0.294
NP_441675.1_4 Reverse -274 -293 3.34271 0.277
NP_441934.1_9 Forward -326 -307 13.5691 0.21
NP_441802.1_1 Reverse -232 -251 5.89931 0.269
NP_442097.1_2 Forward -318 -299 2.26107 0.259
NP_441594.1_6 Reverse -242 -261 4.81767 0.211
NP_441083.1_5 Reverse -209 -219 0.275027 0.237
NP_441738.1_2 Reverse -211 -218 11.7401 0.0647
NP_441770.1_5 Forward -125 -106 1.37609 0.238
NP_442570.1_3 Reverse -322 -341 -6.58872 0.258
NP_441025.1_5 Reverse -360 -374 15.6342 0.257
NP_440331.1_6 Forward -298 -279 1.47442 0.0602
NP_440747.1_10 Forward -251 -239 -12.4491 0.282
NP_441486.1_1 Forward -221 -207 3.04785 0.0689
NP_443018.1_3 Forward -193 -186 12.5271 0.0523
NP_443018.1_3 Reverse -186 -193 12.5271 0.0523
NP_441634.1_8 Forward -50 -36 -2.16369 0.295
NP_440376.1_1 Forward -259 -250 2.35967 0.224
NP_441002.1_6 Forward -252 -233 15.3382 0.122
NP_442687.1_7 Reverse -38 -48 7.45319 0.132
NP_442530.1_2 Forward -171 -161 11.6814 0.282
NP_440642.1_10 Reverse -307 -321 7.27547 0.221
NP_442658.1_1 Forward -196 -186 5.97777 0.242
NP_440662.1_2 Reverse -231 -250 11.0125 0.0553
NP_439959.1_6 Forward -47 -28 12.7825 0.146
NP_441958.1_5 Forward -219 -209 -0.708283 0.221
NP_440318.1_1 Reverse -347 -366 12.0942 0.103
NP_439905.1_1 Forward -193 -180 13.1956 0.177
NP_439905.1_1 Reverse -186 -199 7.00078 0.269
NP_440984.1_7 Reverse -180 -194 6.29277 0.219
NP_441294.1_7 Forward -379 -365 9.34661 0.249
NP_442438.1_10 Reverse -234 -248 9.73436 0.0602
NP_442438.1_10 Forward -188 -174 0.0979218 0.239
NP_441550.1_8 Reverse -207 -217 4.89613 0.281
NP_440206.1_4 Reverse -246 -265 1.27698 0.289
NP_440703.1_9 Forward -340 -327 4.73861 0.293
NP_441725.1_5 Forward -193 -183 -1.29827 0.299
NP_442941.1_3 Reverse -210 -220 0.57002 0.199
NP_442281.1_1 Reverse -368 -382 6.19383 0.133
NP_442500.1_9 Forward -336 -317 15.7324 0.212
NP_442982.1_3 Reverse -327 -346 17.2074 0.116
NP_441644.1_6 Forward -194 -184 7.45273 0.124
NP_441644.1_6 Reverse -209 -219 5.38779 0.194
NP_441751.2_8 Reverse -240 -254 -4.7203 0.179
NP_442554.1_8 Forward -193 -183 9.61647 0.0576
NP_442554.1_8 Reverse -186 -196 2.33998 0.274
NP_442313.1_5 Forward -361 -342 9.53756 0.191
NP_442142.1_4 Forward -385 -372 4.14862 0.231
NP_442476.1_6 Forward -193 -179 0.0979218 0.274
NP_442406.1_9 Forward -56 -37 -0.787193 0.3
NP_440357.1_3 Forward -248 -229 -0.885524 0.296
NP_441468.1_1 Reverse -186 -193 3.97235 0.277
NP_441468.1_1 Forward -193 -186 3.97235 0.277
NP_441020.2_6 Forward -262 -245 6.52869 0.262
NP_441020.2_6 Forward -220 -203 6.43035 0.262
NP_441731.1_7 Forward -202 -183 0.884433 0.298
NP_440286.1_1 Forward -58 -40 7.19731 0.276
NP_441826.1_2 Forward -368 -354 3.8345 0.105
NP_441826.1_5 Forward -108 -89 2.45773 0.276
NP_442868.1_6 Forward -250 -240 0.373358 0.234
NP_442719.1_2 Reverse -346 -364 0.608397 0.162
NP_442719.1_2 Reverse -19 -37 -8.92966 0.258
NP_441612.1_2 Reverse -195 -205 6.61303 0.283
NP_442227.1_2 Reverse -170 -189 -3.24547 0.29
NP_442808.1_1 Reverse -38 -48 5.09279 0.173
NP_442050.1_1 Forward -267 -248 10.2259 0.243
NP_442050.1_5 Reverse -207 -217 8.73102 0.217
NP_442050.1_6 Forward -144 -125 13.5691 0.222
NP_442739.1_3 Forward -344 -330 19.1735 0.115
NP_440558.1_2 Forward -257 -238 -4.81876 0.249
NP_442593.1_1 Reverse -366 -385 16.4207 0.193
NP_441878.1_6 Reverse -184 -194 0.57002 0.14
NP_441878.1_6 Forward -28 -18 -7.59145 0.245
NP_441557.1_5 Forward -218 -209 -0.491928 0.193
NP_441520.1_5 Reverse -271 -290 14.0608 0.148
NP_440744.1_2 Forward -55 -36 14.6251 0.285
NP_441458.1_10 Forward -203 -184 2.65439 0.269
NP_440276.1_8 Reverse -321 -340 10.2259 0.232
NP_440861.1_2 Reverse -271 -290 14.1593 0.187
NP_442347.1_2 Forward -374 -365 2.85133 0.299
NP_442645.1_2 Forward -256 -237 -19.6667 0.288
NP_440563.1_6 Forward -68 -55 21.4554 0.0582
NP_442590.1_10 Forward -375 -356 7.27595 0.23
NP_442998.1_5 Reverse -234 -244 10.5998 0.207
NP_442998.1_5 Forward -171 -161 9.91146 0.232
NP_442998.1_5 Reverse -270 -280 7.05986 0.3
NP_442998.1_10 Reverse -211 -218 6.0373 0.205
NP_440899.1_8 Reverse -305 -324 0.196116 0.184
NP_441799.1_1 Forward -386 -372 7.3738 0.144
NP_442334.1_2 Forward -372 -355 -7.33598 0.289
NP_442201.1_10 Reverse -235 -254 -13.6686 0.274
NP_440256.1_1 Forward -221 -202 -7.86702 0.247
NP_441559.1_8 Reverse -245 -259 -5.80194 0.27
NP_441179.1_9 Forward -196 -186 13.6475 0.246
NP_440748.1_5 Reverse -42 -61 5.99764 0.188
NP_441464.1_10 Reverse -327 -341 7.86607 0.287
NP_440695.1_6 Forward -119 -105 9.73265 0.276
NP_442386.1_9 Forward -195 -186 13.1756 0.0406
NP_441340.1_5 Reverse -186 -193 4.07068 0.239
NP_441340.1_5 Forward -217 -210 4.07068 0.239
NP_441340.1_5 Forward -193 -186 4.07068 0.239
NP_440586.1_8 Forward -193 -186 7.61025 0.227
NP_440586.1_8 Reverse -186 -193 7.61025 0.227
NP_441262.1_3 Forward -218 -211 5.34899 0.181
NP_440027.1_8 Forward -378 -359 9.53674 0.243
NP_439937.1_8 Reverse -231 -250 -4.81876 0.286
NP_442294.1_3 Reverse -46 -60 11.7003 0.298
NP_440926.1_5 Reverse -40 -59 10.1275 0.252
NP_440372.1_2 Forward -217 -210 4.36568 0.205
NP_440171.1_3 Forward -136 -117 6.98095 0.259
NP_440819.1_5 Forward -172 -164 7.98423 0.228
NP_440819.1_5 Forward -37 -29 7.68924 0.266
NP_441572.1_7 Reverse -367 -386 -0.39387 0.18
NP_442384.1_10 Reverse -373 -386 3.06754 0.203
NP_440476.1_2 Reverse -157 -176 11.995 0.284
NP_442262.1_10 Forward -193 -186 10.4622 0.145
NP_442262.1_10 Reverse -186 -193 10.4622 0.145
NP_440344.1_10 Reverse -32 -49 -8.22096 0.124
NP_440531.1_6 Reverse -177 -196 -3.14714 0.262
NP_441640.1_1 Forward -263 -244 -2.95047 0.287
NP_440297.1_9 Forward -193 -183 9.91146 0.0917
NP_440350.1_5 Reverse -315 -334 -3.04881 0.253
NP_442280.1_10 Reverse -321 -339 5.94143 0.28
NP_440894.1_4 Reverse -46 -65 2.65439 0.219
NP_441894.1_1 Forward -343 -324 -2.16383 0.155
NP_441894.1_2 Forward -386 -368 13.3922 0.0124
NP_440999.1_9 Reverse -35 -49 11.996 0.0427
NP_440888.1_2 Reverse -209 -223 11.4053 0.0681
NP_440888.1_2 Reverse -353 -367 6.78381 0.22
NP_440888.1_2 Forward -248 -234 5.70218 0.267
NP_440888.1_2 Forward -259 -245 5.30886 0.284
NP_442512.1_4 Reverse -270 -288 8.18062 0.278
NP_441469.1_8 Reverse -184 -193 11.3078 0.173
NP_441469.1_8 Forward -383 -374 9.73449 0.227
NP_441469.1_8 Forward -195 -186 5.60459 0.258
NP_441462.1_2 Forward -218 -208 8.33817 0.0374
NP_441929.1_6 Reverse -224 -243 12.1925 0.261
NP_443062.1_1 Reverse -185 -203 5.13317 0.238
NP_441560.1_8 Reverse -348 -367 11.5127 0.294
NP_440544.1_5 Reverse -313 -320 13.8024 0.28
NP_440516.1_8 Forward -218 -209 -0.000272808 0.156
NP_442428.1_5 Forward -193 -186 4.36568 0.271
NP_442428.1_5 Reverse -186 -193 4.36568 0.271
NP_441267.1_2 Forward -286 -267 10.1275 0.155
NP_442545.1_5 Forward -291 -272 16.3215 0.265
NP_440603.1_3 Forward -265 -246 5.89931 0.265
NP_440673.1_7 Forward -373 -354 4.52268 0.185
NP_441052.1_2 Reverse -39 -49 5.68323 0.107
NP_441052.1_2 Reverse -245 -255 -0.314959 0.273
NP_442219.1_9 Reverse -210 -219 5.01461 0.193
NP_440436.1_4 Reverse -186 -195 4.42421 0.265
NP_441884.1_2 Forward -169 -155 15.6723 0.239
NP_442577.1_9 Forward -344 -330 11.1104 0.255
NP_441086.1_8 Reverse -117 -130 18.7789 0.128
NP_441004.1_1 Reverse -332 -351 -12.1936 0.245
NP_442366.1_3 Forward -370 -352 -4.30741 0.268
NP_442176.1_1 Reverse -332 -351 2.26107 0.294
NP_440864.1_9 Reverse -321 -340 3.24438 0.119
NP_441851.1_10 Reverse -184 -194 5.78156 0.2
NP_441851.1_10 Forward -219 -209 4.79825 0.247
NP_442856.1_7 Reverse -364 -383 -4.22878 0.257
NP_441668.1_4 Forward -69 -50 4.03102 0.183
NP_442515.1_1 Reverse -194 -208 -2.85201 0.281
NP_440432.1_9 Forward -217 -202 -4.93665 0.228
NP_439960.1_8 Forward -194 -175 10.2259 0.264
NP_442729.1_7 Reverse -307 -325 9.65558 0.276
NP_442443.1_4 Forward -337 -327 13.4509 0.233
NP_442906.1_3 Reverse -177 -196 10.1275 0.157
NP_441432.1_8 Reverse -365 -374 9.73449 0.0754
NP_441432.1_8 Forward -49 -40 9.73449 0.0754
NP_441432.1_8 Reverse -279 -288 6.48957 0.114
NP_441432.1_8 Forward -363 -354 5.40793 0.158
NP_441432.1_8 Forward -219 -210 4.62128 0.201
NP_440760.1_1 Forward -362 -343 -14.4552 0.131
NP_440199.1_10 Forward -221 -211 7.35486 0.231
NP_440199.1_10 Reverse -363 -373 7.05986 0.242
NP_442010.1_9 Reverse -313 -327 13.9619 0.175
NP_442489.1_2 Forward -229 -210 12.8808 0.137
NP_440559.1_1 Forward -217 -208 5.21127 0.145
NP_441659.2_8 Reverse -209 -219 3.22496 0.169
NP_441659.2_8 Forward -194 -184 1.94665 0.22
NP_442849.1_1 Reverse -335 -349 8.94771 0.264
NP_441807.1_10 Reverse -244 -263 22.3206 0.013
NP_440779.1_5 Reverse -209 -226 -14.8091 0.274
NP_442346.1_5 Reverse -184 -194 6.07655 0.216
NP_440459.1_2 Reverse -351 -368 12.4285 0.149
NP_440459.1_2 Forward -196 -179 7.61033 0.285
NP_441329.1_6 Forward -133 -114 0.524783 0.253
NP_441895.1_1 Forward -270 -251 21.3373 0.0000809
NP_441895.1_2 Forward -339 -320 20.944 0.000214
NP_441895.1_3 Forward -385 -366 10.8159 0.00583
NP_441895.1_7 Forward -234 -215 29.7937 0.0000187
NP_441895.1_9 Forward -365 -346 10.5209 0.00427
NP_442162.1_9 Forward -217 -210 3.4807 0.246
NP_442162.1_9 Reverse -210 -217 3.38237 0.276
NP_442073.1_6 Reverse -30 -49 -2.16383 0.286
NP_442546.1_1 Forward -345 -326 12.7825 0.297
NP_442140.1_1 Reverse -30 -49 15.8669 0.201
NP_442140.1_3 Reverse -186 -196 9.12481 0.111
NP_442140.1_3 Forward -193 -183 7.74818 0.13
NP_441696.1_4 Reverse -332 -345 19.0955 0.125
NP_441813.1_5 Reverse -207 -217 2.63497 0.182
NP_442497.1_10 Forward -217 -208 -1.18024 0.256
NP_441239.1_9 Forward -196 -184 12.1337 0.0494
NP_441239.1_9 Reverse -183 -195 11.1504 0.0648
NP_441951.1_9 Forward -253 -234 -0.983855 0.283
NP_440863.1_1 Forward -323 -309 14.7737 0.236
NP_442052.1_3 Forward -150 -131 9.73422 0.265
NP_442349.1_9 Forward -252 -234 6.01734 0.112
NP_442499.1_4 Forward -371 -357 14.5526 0.226
NP_441879.1_1 Forward -393 -374 2.3594 0.237
NP_441249.1_1 Reverse -17 -36 1.47442 0.257
NP_442402.1_4 Reverse -306 -325 5.2102 0.144
NP_442402.1_4 Forward -239 -220 -9.14605 0.285
NP_441084.1_6 Reverse -183 -197 9.15021 0.292
NP_441843.2_9 Reverse -95 -113 9.71393 0.27
NP_442039.1_7 Forward -222 -212 9.32148 0.257
NP_442039.1_7 Forward -328 -318 7.45319 0.276
NP_442679.1_1 Forward -325 -306 -1.86883 0.24
NP_442053.1_1 Reverse -209 -218 3.83464 0.285
NP_440505.1_3 Forward -364 -354 10.3048 0.112
NP_440505.1_3 Forward -220 -210 5.28991 0.236
NP_441011.1_8 Forward -217 -208 8.55452 0.144
NP_441011.1_8 Reverse -186 -195 5.01461 0.289
NP_442533.1_1 Forward -263 -244 -10.817 0.235
NP_442533.1_6 Reverse -185 -194 4.62128 0.179
NP_442533.1_6 Forward -382 -373 3.14632 0.224
NP_442541.1_10 Reverse -57 -71 9.34041 0.205
NP_439944.1_9 Reverse -210 -220 6.76487 0.168
NP_441028.1_6 Reverse -31 -41 7.74772 0.218
NP_441028.1_6 Reverse -316 -326 7.64939 0.218
NP_441028.1_6 Reverse -317 -327 4.10949 0.278
NP_442202.1_10 Reverse -184 -198 4.62115 0.256
NP_441527.1_4 Forward -34 -15 -3.29489 0.164
NP_441527.1_4 Forward -328 -309 -10.0748 0.264
NP_441527.1_4 Forward -331 -312 -10.6478 0.272
NP_441059.1_2 Forward -334 -315 -4.22878 0.242
NP_441106.1_1 Forward -195 -186 4.32629 0.227
NP_440480.1_8 Forward -192 -179 15.7522 0.29
NP_441286.1_1 Forward -219 -207 -4.18925 0.152
NP_440767.1_7 Reverse -234 -253 11.7008 0.165
NP_441753.1_10 Reverse -227 -246 0.687771 0.287
NP_441021.1_1 Reverse -40 -59 -0.000545616 0.0949
NP_441463.1_3 Forward -269 -250 -7.17871 0.255
NP_441463.1_3 Reverse -368 -387 -10.522 0.296
NP_441626.1_6 Reverse -235 -253 6.1149 0.267
NP_441836.1_2 Reverse -233 -252 -1.37718 0.217
NP_441836.1_2 Forward -200 -181 -3.04881 0.233
NP_440358.1_8 Reverse -190 -209 -1.96717 0.29
NP_440814.1_8 Forward -323 -304 3.14605 0.269
NP_440467.1_5 Reverse -233 -252 18.879 0.144
NP_440114.1_10 Forward -194 -180 7.17775 0.243
NP_442090.1_2 Reverse -260 -279 16.4719 0.136
NP_442698.1_10 Reverse -232 -251 -1.27885 0.297
NP_441206.1_4 Reverse -35 -54 -7.08038 0.266
NP_440422.1_10 Reverse -299 -318 7.01583 0.24
NP_441246.1_9 Reverse -333 -350 8.69197 0.162
NP_439910.1_2 Reverse -201 -218 -22.0856 0.207
NP_442680.1_5 Forward -325 -306 14.2373 0.0823
NP_442680.1_5 Forward -324 -305 -0.611604 0.288
NP_442680.1_7 Forward -154 -135 -6.49039 0.265
NP_442784.1_3 Reverse -332 -351 12.7825 0.264
YP_003858595.1_2 Reverse -312 -329 5.93797 0.248
YP_003858595.1_5 Reverse -259 -278 24.4839 0.000768
NP_440756.1_1 Reverse -325 -344 14.0542 0.294
NP_440554.1_4 Reverse -186 -196 5.87989 0.129
NP_441885.1_5 Forward -362 -352 -1.59326 0.273
NP_441885.1_5 Forward -218 -208 -1.59326 0.273
NP_442310.1_5 Reverse -90 -109 10.3242 0.237
NP_442341.1_7 Reverse -365 -379 3.04785 0.237
NP_442341.1_7 Reverse -194 -208 1.86788 0.278
NP_441756.1_5 Reverse -35 -54 -3.63879 0.29
NP_441173.1_9 Forward -343 -335 13.1954 0.184
NP_441173.1_9 Reverse -349 -357 12.9004 0.206
NP_442932.1_9 Forward -324 -305 8.45592 0.241
NP_441397.1_8 Forward -324 -311 12.0938 0.278
NP_441207.1_7 Forward -169 -155 13.1279 0.229
NP_441207.1_7 Forward -170 -156 11.1917 0.245
NP_440175.1_4 Reverse -49 -68 -14.1602 0.273
NP_440149.1_8 Forward -54 -35 -0.787193 0.154
NP_440149.1_8 Reverse -360 -379 -0.983855 0.154
NP_442214.1_1 Reverse -253 -272 6.88262 0.298
NP_441105.1_3 Reverse -355 -374 -8.35868 0.272
NP_440216.1_1 Forward -259 -245 -12.2918 0.256
NP_440216.1_9 Forward -338 -329 7.37455 0.286
NP_440216.1_9 Forward -192 -183 5.89959 0.289
NP_442371.1_1 Forward -172 -162 17.0891 0.086
NP_442371.1_1 Forward -125 -115 16.5975 0.137
NP_441226.1_7 Forward -217 -210 9.77352 0.131
NP_442034.1_7 Forward -61 -43 9.36059 0.245
NP_441111.1_7 Reverse -210 -218 -0.668896 0.274
NP_441430.1_2 Reverse -164 -183 1.67108 0.14
NP_440261.1_5 Forward -193 -180 -4.50394 0.151
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGAGAATTTTACAGCACGGACATCACTGATAGCCAGTGGCAATTGGTAGAACCTCATTTACCCAAAGCAAAAACTGGGGGAAGAAAATGGAAAACTAGTCTGAGGGAGATACTCAATGCCATTTTTTACATGCTCAGAACGGGGTGTGCCTGGCGACTTCTGCCCCATGATTTTCCTAAATGGCGAACGGTCTATGGTTATTTCCAGCCATGGCACGAAGATGGTACCTGGAAAAAATTAAACCGTATCTTCCGTGAGAAAGTTCGGCTCAAAGCTGGAAGAAATACTCACCCTAGTGCCGGTTGTTTAGATTCACAGTCACTTAAAAAGGCTTGAACTGGCCAAGAAACTGGCTATGACGGCGGAAAAAAGGTCAATGGTCGTAAACGTACAATCCTC

CDS

GTGGATACCATGGGATTACTTCTCGATGTTGTCGGTGCCCATCGCTCTGACCATCAGGGTCTGATTCTACTTGGCACCTGGTTTGCTCCCCTTTGGCAGTGCCTGCAAGTTATATGGACTGACAGCACCTTTGGCGGAAAGGATTTTATTTTCTGGGTGGAGCATACTTTTGGTTGGACCTTGAATGTGGTCAGCAAAAAGCAGGGACAAAAAGGCTTTGAAGTCCTACCCCGCCGTTGGGTAGTCGAGCGCACTTTTGCTTGGTTTGGTCGTTATCGTCGTTTAAGCAAAGATTATGAATATTTACCTACCACCAGTGAGACAATGCTCTATGTTGCCATGGTTCATCTCATGCTTCAAAGGCTTTGCTTAAAACTTTTCAAACACTTTCTTAGAGGAGGTAAAGGAAAGAAGAATTAA

Protein

MDTMGLLLDVVGAHRSDHQGLILLGTWFAPLWQCLQVIWTDSTFGGKDFIFWVEHTFGWTLNVVSKKQGQKGFEVLPRRWVVERTFAWFGRYRRLSKDYEYLPTTSETMLYVAMVHLMLQRLCLKLFKHFLRGGKGKKN