Your browser is old and dusty. Try Google Chrome!

Details for sll0662

ORF sll0662
Accession NP_442688.1
Symbol
Category 4Fe-4S type iron-sulfur protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -260 -246 2.5562 0.174
NP_441061.1_2 Reverse -22 -36 -2.06536 0.281
NP_440795.1_7 Forward -68 -61 9.77388 0.169
NP_440694.1_7 Reverse -143 -162 15.9291 0.279
NP_441418.1_6 Forward -261 -242 -30.0898 0.256
NP_441818.1_9 Reverse -152 -171 -8.85033 0.283
NP_442173.1_1 Forward -30 -22 8.18089 0.111
NP_442752.1_4 Reverse -321 -328 7.90559 0.144
NP_441812.1_1 Forward -56 -42 14.0603 0.229
NP_440110.1_8 Forward -296 -277 14.0608 0.0878
NP_442062.1_8 Forward -271 -261 4.40493 0.217
NP_442062.1_8 Forward -246 -236 3.12662 0.285
NP_441900.1_2 Reverse -326 -344 -6.27474 0.293
NP_442268.1_3 Reverse -244 -263 15.9282 0.248
NP_439918.1_2 Forward -117 -98 -2.65548 0.248
NP_441935.1_1 Reverse -252 -271 10.5209 0.211
NP_441594.1_6 Forward -255 -236 3.14605 0.236
NP_441925.1_4 Reverse -8 -27 -14.4559 0.263
NP_441925.1_4 Reverse -58 -77 -17.0125 0.287
NP_441942.1_6 Forward -253 -234 13.2105 0.296
NP_442570.1_3 Forward -77 -58 -4.6221 0.233
NP_442570.1_10 Reverse -243 -262 11.7992 0.209
NP_440747.1_10 Forward -166 -154 -12.1541 0.227
NP_440403.1_4 Forward -172 -153 -3.3438 0.197
NP_441634.1_8 Reverse -195 -209 2.65453 0.166
NP_440376.1_1 Forward -163 -154 5.60459 0.125
NP_442687.1_7 Forward -262 -252 5.87989 0.183
NP_442687.1_7 Forward -164 -154 3.71661 0.292
NP_441950.1_7 Reverse -318 -337 -8.45701 0.287
NP_440141.1_8 Reverse -243 -262 6.68596 0.254
NP_442496.1_5 Forward -310 -292 10.2456 0.217
NP_443061.1_4 Reverse -291 -310 1.96607 0.254
NP_441487.1_9 Reverse -284 -303 2.45773 0.18
NP_441256.1_8 Forward -148 -129 4.81767 0.272
NP_439959.1_3 Forward -258 -239 10.7175 0.242
NP_442937.1_5 Reverse -316 -335 7.27595 0.258
NP_442836.1_5 Reverse -148 -167 13.9625 0.0588
NP_441754.1_2 Reverse -327 -346 11.3075 0.25
NP_439990.1_5 Forward -251 -238 5.82081 0.272
NP_442690.1_1 Forward -142 -123 -12.6852 0.247
NP_440153.1_8 Forward -297 -284 -3.02898 0.276
NP_442064.1_4 Reverse -242 -261 12.0933 0.166
NP_443055.1_6 Reverse -244 -262 -0.0799167 0.252
NP_441348.1_1 Reverse -104 -123 19.5673 0.299
NP_442438.1_3 Reverse -136 -155 9.43923 0.258
NP_442431.1_10 Reverse -149 -167 15.4571 0.0607
NP_442431.1_10 Forward -33 -15 -0.275845 0.287
NP_441000.1_6 Reverse -281 -295 -3.34366 0.221
NP_441916.1_7 Forward -163 -153 2.63497 0.246
NP_441041.1_7 Reverse -151 -163 8.00067 0.151
NP_440983.1_5 Forward -267 -248 -3.73712 0.24
NP_440260.1_8 Forward -294 -276 -7.15901 0.295
NP_442281.1_1 Reverse -17 -31 2.5556 0.263
NP_001035871.2_7 Forward -273 -263 13.5497 0.219
NP_440437.1_1 Reverse -279 -298 -0.0988766 0.174
NP_441556.1_4 Forward -264 -245 13.0901 0.201
NP_443030.1_4 Forward -176 -157 -5.9004 0.272
NP_442215.1_2 Forward -248 -232 -0.531451 0.168
NP_442247.1_6 Forward -261 -242 13.4708 0.145
NP_440929.1_1 Forward -199 -189 15.8188 0.27
NP_442554.1_4 Forward -170 -151 15.6341 0.122
NP_442554.1_9 Reverse -40 -59 12.1205 0.29
NP_442970.1_1 Forward -138 -124 9.08335 0.287
NP_442142.1_4 Reverse -279 -292 7.98351 0.125
NP_442142.1_4 Forward -333 -320 5.0336 0.204
NP_442142.1_4 Reverse -240 -253 3.55864 0.251
NP_442476.1_5 Forward -146 -127 11.5042 0.256
NP_442999.1_1 Reverse -321 -340 15.2408 0.0377
NP_443009.1_5 Reverse -196 -207 6.94134 0.144
NP_440357.1_3 Forward -313 -294 -0.688862 0.296
NP_440379.1_5 Reverse -243 -262 -10.1286 0.276
NP_441764.1_4 Reverse -87 -104 10.5546 0.251
NP_442868.1_6 Forward -165 -155 6.8632 0.0956
NP_442719.1_2 Reverse -124 -142 -7.55303 0.235
NP_442808.1_1 Forward -262 -252 13.4509 0.0481
NP_442808.1_1 Reverse -20 -30 1.45457 0.285
NP_442808.1_1 Reverse -260 -270 0.864583 0.3
NP_442542.1_2 Reverse -152 -165 17.1289 0.0495
NP_442113.1_6 Reverse -147 -166 12.5858 0.296
NP_442113.1_10 Forward -334 -315 -8.45701 0.282
NP_440630.1_1 Reverse -243 -262 3.44104 0.263
NP_442789.1_4 Forward -296 -277 3.73603 0.162
NP_441518.1_3 Forward -256 -237 -12.4886 0.263
NP_442688.1_1 Forward -221 -202 25.7622 0.00518
NP_442688.1_2 Forward -191 -172 26.5488 0.0047
NP_442688.1_3 Forward -128 -109 26.2538 0.00532
NP_442688.1_4 Forward -74 -55 21.8289 0.0442
NP_442688.1_5 Forward -281 -262 17.7974 0.136
NP_442688.1_6 Forward -23 -4 31.8587 0.0000117
NP_442688.1_7 Forward -380 -361 35.4969 0.0000166
NP_442688.1_8 Forward -164 -145 27.7288 0.00104
NP_442688.1_9 Forward -44 -25 19.6656 0.226
NP_442688.1_10 Forward -254 -235 26.2538 0.00115
NP_441878.1_6 Reverse -153 -163 -6.11649 0.191
NP_441878.1_6 Reverse -281 -291 -7.19813 0.21
NP_441445.1_1 Reverse -276 -295 4.42435 0.195
NP_441445.1_1 Reverse -145 -164 0.491109 0.275
NP_441458.1_10 Forward -383 -364 1.27776 0.292
NP_442347.1_2 Forward -266 -257 5.11294 0.238
NP_442645.1_2 Forward -77 -58 -21.4367 0.29
NP_442645.1_2 Forward -299 -280 -22.42 0.291
NP_440547.1_1 Reverse -241 -260 16.1249 0.109
NP_442317.1_6 Forward -168 -149 3.53937 0.262
NP_441633.1_3 Forward -165 -152 2.47756 0.0954
NP_442590.1_10 Forward -298 -279 4.03102 0.282
NP_441559.1_8 Forward -275 -261 -5.60527 0.267
NP_440717.1_1 Forward -296 -277 5.80098 0.27
NP_442866.1_1 Reverse -219 -238 -6.78538 0.26
NP_441464.1_8 Forward -163 -149 10.9143 0.178
NP_441464.1_8 Reverse -285 -299 4.81781 0.263
NP_441494.1_6 Reverse -219 -232 5.62415 0.298
NP_442386.1_9 Forward -262 -253 4.7192 0.289
NP_440570.1_5 Reverse -242 -261 -0.000545616 0.259
NP_441750.1_1 Forward -195 -176 -12.5869 0.3
NP_442186.1_7 Reverse -319 -338 8.45592 0.254
NP_440211.1_4 Forward -181 -171 14.0414 0.29
NP_440027.1_3 Forward -301 -283 4.24662 0.262
NP_439996.1_2 Forward -260 -241 2.65439 0.27
NP_439937.1_9 Forward -272 -255 -10.3849 0.227
NP_439937.1_9 Forward -143 -126 -13.4331 0.286
NP_439937.1_9 Reverse -250 -267 -14.0231 0.287
NP_439937.1_9 Reverse -9 -26 -14.9081 0.287
NP_442239.1_8 Forward -37 -18 7.17762 0.258
NP_440316.1_10 Reverse -251 -261 6.8632 0.251
NP_440210.1_2 Reverse -58 -77 21.7306 0.0616
NP_441572.1_7 Reverse -276 -295 8.25926 0.0743
NP_440948.1_3 Forward -145 -131 18.3875 0.282
NP_441640.1_8 Forward -251 -232 0.982764 0.187
NP_442693.1_6 Forward -262 -243 -1.08219 0.297
NP_440990.1_10 Reverse -312 -331 15.7324 0.261
NP_440894.1_10 Reverse -232 -251 2.0644 0.298
NP_442067.1_3 Reverse -117 -136 17.109 0.224
NP_442067.1_4 Forward -42 -23 2.0644 0.299
NP_440999.1_8 Forward -383 -364 6.78429 0.28
NP_440999.1_9 Reverse -18 -32 -1.8687 0.252
NP_440491.1_1 Forward -270 -251 9.84073 0.206
NP_440052.1_5 Reverse -247 -266 -6.09707 0.3
NP_443064.1_8 Reverse -268 -278 14.7292 0.29
NP_442578.1_5 Reverse -18 -37 -0.39387 0.289
NP_442578.1_7 Reverse -259 -266 9.97054 0.112
NP_440148.1_3 Reverse -150 -164 19.1741 0.208
NP_441462.1_2 Forward -163 -153 -0.806614 0.254
NP_441621.1_7 Forward -263 -249 -6.29359 0.283
NP_441601.1_4 Forward -292 -273 -2.16383 0.293
NP_441601.1_4 Reverse -143 -162 -5.70374 0.294
NP_441351.1_8 Reverse -152 -171 -0.295539 0.297
NP_442537.1_3 Forward -111 -92 12.4875 0.257
NP_440673.1_3 Reverse -226 -233 8.29892 0.221
NP_441884.1_9 Forward -300 -281 -22.5183 0.281
NP_441004.1_1 Forward -25 -6 -15.1435 0.273
NP_441004.1_2 Forward -30 -11 1.37609 0.22
NP_441004.1_4 Forward -69 -59 11.6814 0.252
NP_441004.1_4 Reverse -249 -259 10.0098 0.258
NP_442694.1_3 Forward -35 -17 -4.8974 0.276
NP_443054.1_2 Forward -165 -151 7.9644 0.134
NP_442622.1_1 Reverse -242 -261 -12.8819 0.281
NP_441501.1_9 Reverse -244 -263 15.4366 0.214
NP_442515.1_1 Forward -164 -150 11.2093 0.0428
NP_442515.1_1 Reverse -257 -271 0.491246 0.19
NP_442515.1_1 Forward -337 -323 -2.45868 0.275
NP_441396.1_5 Reverse -319 -328 8.35786 0.224
NP_440463.1_8 Reverse -9 -28 9.53296 0.247
NP_440463.1_8 Reverse -242 -261 8.66165 0.261
NP_440940.1_7 Forward -240 -222 3.95163 0.267
NP_442843.1_1 Forward -162 -143 -6.68705 0.245
NP_439960.1_10 Forward -157 -139 -3.81576 0.282
NP_441031.1_1 Reverse -342 -361 3.93054 0.293
NP_442006.1_2 Forward -261 -244 1.51381 0.119
NP_442006.1_3 Forward -308 -290 -7.94566 0.298
NP_441003.1_9 Reverse -243 -262 6.88262 0.24
NP_441078.1_4 Reverse -154 -163 -0.68859 0.206
NP_441078.1_4 Forward -163 -154 -1.6719 0.266
NP_442729.1_8 Forward -284 -271 6.31247 0.203
NP_442348.1_2 Reverse -120 -129 7.17789 0.285
NP_440793.1_1 Forward -394 -380 12.9786 0.266
NP_441094.1_6 Reverse -147 -164 7.60959 0.277
NP_440760.1_1 Forward -267 -248 -18.5851 0.215
NP_442797.1_7 Reverse -278 -296 1.59244 0.257
NP_440461.1_3 Forward -70 -51 15.7324 0.212
NP_442489.1_7 Reverse -154 -163 -1.6719 0.235
NP_441659.2_8 Forward -291 -281 1.455 0.24
NP_441022.1_1 Reverse -68 -77 11.6421 0.274
NP_442913.1_10 Forward -276 -257 13.7658 0.0274
NP_440335.1_9 Forward -265 -247 9.75391 0.29
NP_442346.1_5 Forward -234 -224 7.05986 0.183
NP_440831.1_3 Forward -294 -275 6.5813 0.271
NP_441050.1_5 Forward -149 -131 -1.25915 0.262
NP_441948.1_4 Reverse -264 -282 -4.50408 0.231
NP_440671.1_4 Forward -37 -23 6.48943 0.245
NP_440772.1_6 Reverse -244 -263 10.2259 0.245
NP_442199.1_7 Forward -137 -118 2.55527 0.259
NP_441259.1_3 Forward -292 -273 9.14423 0.251
NP_441892.1_1 Reverse -145 -162 -3.5994 0.244
NP_441892.1_1 Reverse -26 -43 -5.1727 0.275
NP_440665.1_1 Reverse -273 -292 -16.4218 0.288
NP_442629.1_3 Forward -35 -16 -0.590531 0.294
NP_440949.1_7 Forward -260 -241 9.43841 0.264
NP_441617.1_6 Reverse -124 -143 -4.6221 0.265
NP_440675.1_3 Reverse -221 -240 9.0459 0.196
NP_441249.1_8 Forward -315 -296 12.8808 0.16
NP_441868.1_4 Forward -207 -193 12.9793 0.282
NP_440341.1_6 Forward -290 -272 17.2271 0.241
NP_442402.1_10 Reverse -99 -109 10.8943 0.275
NP_441848.1_4 Forward -381 -365 7.45517 0.288
NP_441848.1_9 Forward -331 -320 11.5629 0.268
NP_440753.1_8 Reverse -281 -300 17.6007 0.255
NP_442679.1_1 Forward -61 -42 8.65258 0.147
NP_442679.1_1 Forward -57 -38 -3.54046 0.259
NP_440160.1_2 Forward -296 -277 -8.65367 0.286
NP_440160.1_3 Reverse -18 -37 10.6184 0.209
NP_440505.1_3 Forward -165 -155 5.68323 0.217
NP_440505.1_7 Forward -274 -255 9.3409 0.162
NP_441252.1_6 Forward -22 -15 11.6422 0.288
NP_442533.1_1 Reverse -315 -334 -17.7001 0.293
NP_442533.1_6 Reverse -288 -297 9.4395 0.0624
NP_442533.1_6 Forward -295 -286 1.76968 0.289
NP_442541.1_10 Reverse -196 -210 2.8506 0.254
NP_442202.1_6 Forward -140 -121 -1.37718 0.272
NP_441527.1_4 Forward -58 -39 -5.39572 0.201
NP_441527.1_4 Reverse -375 -394 -9.69285 0.261
NP_441527.1_8 Forward -251 -232 1.76941 0.279
NP_441680.1_6 Reverse -235 -254 17.0099 0.162
NP_441972.1_5 Reverse -238 -257 -5.11376 0.215
NP_441972.1_5 Forward -128 -109 -8.35868 0.263
NP_441216.1_5 Reverse -241 -260 14.1583 0.188
NP_442588.1_8 Reverse -144 -163 5.70265 0.278
NP_441286.1_1 Forward -164 -152 -4.77924 0.175
NP_440886.1_7 Forward -292 -282 11.2876 0.0805
NP_442022.1_4 Reverse -249 -268 5.11266 0.293
NP_440326.1_5 Reverse -222 -235 15.8506 0.179
NP_440176.1_3 Reverse -295 -309 12.3887 0.274
NP_441589.1_5 Forward -32 -13 15.109 0.287
NP_440311.1_2 Reverse -360 -379 10.0292 0.299
NP_441272.1_7 Reverse -252 -262 14.9263 0.2
NP_441885.1_5 Reverse -154 -164 0.373358 0.164
NP_440898.1_5 Reverse -243 -262 19.764 0.0579
NP_442341.1_3 Forward -128 -109 0.884433 0.286
NP_442341.1_7 Reverse -236 -250 7.47274 0.105
NP_441756.1_5 Reverse -278 -297 -3.73712 0.29
NP_441173.1_9 Forward -136 -128 9.85212 0.275
NP_440750.1_6 Forward -151 -132 7.97315 0.296
NP_440423.1_6 Reverse -146 -165 -4.42544 0.131
NP_440076.1_5 Forward -262 -243 14.2566 0.237
NP_440091.1_1 Forward -234 -222 -0.256015 0.273
NP_442451.1_2 Forward -171 -152 0.786102 0.149
NP_441207.1_7 Forward -53 -39 14.1929 0.189
NP_439962.1_4 Forward -296 -277 -3.93378 0.262
NP_439962.1_4 Forward -295 -276 -4.42544 0.269
NP_442591.1_1 Reverse -19 -38 8.75091 0.256
NP_442379.1_10 Reverse -145 -162 -1.92778 0.224
NP_443052.1_8 Forward -304 -285 -6.88371 0.149
NP_443052.1_8 Forward -277 -258 -9.34199 0.189
NP_442116.1_6 Forward -371 -354 5.97264 0.289
NP_442154.1_1 Reverse -244 -262 -17.0904 0.249
NP_442154.1_1 Forward -38 -20 -18.2704 0.279
NP_442154.1_1 Reverse -313 -331 -18.3687 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTGTAATTTCCTATGTCTCACTTTAGCAATATCAAAACCAAGATTCGTAACCTTGATGTGTTGAAAACCACCCTCACCAACTTGGGTCTGGATTGGAAAGAAGGGCCGGCCACCGTGCGGGGCTACCAGGGTTTGACCGCCAAAGCCGCAGTGGTGATTGAACAGAGCAATGATTACGACCTAGGTTTTAGCTGGAATGGTCAGGAATATGAGTTGGTGACAGATTTACAGTACTGGCAACAGCCCCTTTCGGTGGAAGGATTTCTGCAAAAAATCACCCAGGGTTACGCTCTGGAAACCGTACTTAATGAATCGGCCAAACAAGGTTTTGCGGTGACGGAACAACAAAAAAATGAAGACGGCTCAGTGCGGTTGGTGGTGCAACGCTGGAGTGCCTG

CDS

ATGGTGATAGCTGATCTAAATTTTCCTCCCGATCACCGTTCTGGACTGGAACCGGAGTTGGGGGGAGATTGGCGTAATTTCGATGACCGTTCTGGTTTAGAGCCGGAATTGGGCGGAGAGTTACGGGAAAGGGGAGTCTATGTGGATGAAGTGACCTGCATTGGTTGCAAAAACTGTGCCCACGTGGCTCCCAATACTTTCACCATTGAGCAGGAGCATGGCCGCTCCCGGGCCTTTAGCCAAAATGGGGACGATGAAGCGGTTATCCAAGAGGCGATCGATACCTGTCCGGTGGACTGTATCCATTGGGTGCCCTACGACGAGCTGAAACATTTGGAAGAAAAAAGGAAGCATCAACAAATTCGTCCCCTGGGTTACCCGCAAATCAATCCCCATTTGTAA

Protein

MVIADLNFPPDHRSGLEPELGGDWRNFDDRSGLEPELGGELRERGVYVDEVTCIGCKNCAHVAPNTFTIEQEHGRSRAFSQNGDDEAVIQEAIDTCPVDCIHWVPYDELKHLEEKRKHQQIRPLGYPQINPHL