Your browser is old and dusty. Try Google Chrome!

Details for sll0661

ORF sll0661
Accession NP_442689.1
Symbol ycf35
Category hypothetical protein YCF35
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -202 -216 9.14437 0.0795
NP_440795.1_7 Reverse -211 -218 13.1171 0.0477
NP_441418.1_6 Forward -210 -191 -11.1119 0.0445
NP_441418.1_6 Reverse -325 -344 -21.4367 0.149
NP_441418.1_6 Reverse -201 -220 -23.1083 0.191
NP_441418.1_6 Forward -219 -200 -29.4998 0.228
NP_441418.1_6 Forward -362 -343 -30.3848 0.274
NP_441453.1_4 Forward -210 -202 6.80426 0.121
NP_441453.1_4 Forward -362 -354 4.14932 0.264
NP_442151.1_6 Forward -334 -320 6.09611 0.248
NP_441630.1_3 Forward -378 -359 -0.885524 0.29
NP_441098.1_3 Forward -60 -41 -5.35341 0.28
NP_440996.1_5 Forward -53 -44 16.8124 0.146
NP_442655.1_10 Forward -213 -194 -10.1286 0.22
NP_442173.1_1 Reverse -202 -210 5.72262 0.203
NP_442173.1_1 Reverse -113 -121 5.13263 0.226
NP_442752.1_4 Forward -210 -203 13.8055 0.0199
NP_443027.1_4 Forward -212 -202 10.1081 0.144
NP_442975.1_10 Reverse -197 -211 3.04726 0.263
NP_442975.1_10 Forward -44 -30 1.37564 0.299
NP_440784.1_7 Forward -209 -202 6.23397 0.241
NP_440784.1_7 Reverse -202 -209 6.13563 0.241
NP_440061.1_9 Forward -364 -350 4.91554 0.3
NP_441476.1_5 Forward -215 -196 -1.7705 0.205
NP_441476.1_5 Reverse -196 -215 -1.96717 0.214
NP_442062.1_8 Forward -362 -352 12.6647 0.0292
NP_442062.1_8 Forward -210 -200 8.73149 0.0721
NP_442062.1_8 Reverse -112 -122 4.60159 0.206
NP_441900.1_2 Reverse -251 -269 -6.66806 0.295
NP_441859.1_3 Reverse -200 -219 11.0117 0.114
NP_441859.1_3 Forward -211 -192 2.9486 0.253
NP_441043.1_10 Reverse -116 -130 11.701 0.296
NP_440735.1_10 Reverse -86 -100 14.0609 0.286
NP_440304.1_4 Reverse -351 -361 5.97822 0.185
NP_442242.1_4 Reverse -202 -209 10.8555 0.127
NP_441935.1_6 Reverse -344 -363 20.4523 0.176
NP_441208.1_9 Reverse -350 -364 6.58777 0.241
NP_441594.1_6 Forward -219 -200 11.5042 0.116
NP_441594.1_6 Reverse -204 -223 6.88262 0.182
NP_442110.1_2 Reverse -140 -153 15.483 0.196
NP_442110.1_7 Reverse -106 -120 1.57289 0.222
NP_441925.1_4 Reverse -354 -373 -1.18128 0.155
NP_440769.1_8 Forward -63 -44 8.84924 0.222
NP_441083.1_5 Reverse -201 -211 0.766681 0.218
NP_441083.1_5 Forward -362 -352 -0.314959 0.265
NP_442827.1_8 Reverse -193 -212 4.03023 0.14
NP_441434.1_3 Forward -192 -173 3.14605 0.194
NP_441434.1_7 Reverse -355 -369 8.25939 0.225
NP_442245.1_7 Forward -227 -209 13.3922 0.174
NP_441738.1_2 Reverse -203 -210 15.28 0.0102
NP_441738.1_2 Forward -119 -112 6.52862 0.261
NP_441955.1_8 Forward -216 -199 22.7533 0.0238
NP_440209.1_1 Reverse -201 -209 11.9175 0.0184
NP_440209.1_1 Forward -210 -202 8.57422 0.0425
NP_442136.1_1 Forward -60 -41 6.29264 0.296
NP_442889.1_1 Forward -368 -349 -1.47551 0.145
NP_442889.1_8 Forward -365 -351 3.53891 0.275
NP_441713.1_5 Forward -217 -198 9.24257 0.246
NP_442111.1_4 Reverse -200 -214 4.12949 0.219
NP_440906.1_5 Forward -209 -202 6.23397 0.234
NP_440906.1_5 Reverse -202 -209 6.13563 0.241
NP_440906.1_5 Reverse -335 -342 5.64398 0.292
NP_440747.1_10 Reverse -350 -362 -4.18925 0.0817
NP_440747.1_10 Forward -213 -201 -11.7607 0.142
NP_440747.1_10 Forward -365 -353 -12.4491 0.282
NP_441486.1_1 Reverse -109 -123 0.687908 0.129
NP_441486.1_1 Forward -242 -228 -6.39192 0.294
NP_441265.1_3 Reverse -195 -209 2.85119 0.181
NP_440057.1_4 Forward -206 -187 15.1618 0.188
NP_441695.1_4 Reverse -251 -269 9.95058 0.292
NP_441012.1_4 Reverse -203 -216 6.90245 0.276
NP_441012.1_4 Reverse -355 -368 5.72248 0.291
NP_443018.1_3 Forward -209 -202 12.6255 0.0471
NP_443018.1_3 Forward -361 -354 10.7572 0.0907
NP_443018.1_3 Reverse -202 -209 5.25066 0.214
NP_443018.1_3 Reverse -354 -361 4.56234 0.241
NP_441634.1_8 Forward -212 -198 3.34284 0.154
NP_441643.1_3 Forward -275 -256 9.14423 0.255
NP_440376.1_1 Reverse -353 -362 6.48957 0.0963
NP_440376.1_1 Forward -362 -353 6.19458 0.109
NP_440376.1_1 Forward -210 -201 0.0980582 0.285
NP_440376.1_1 Reverse -201 -210 -0.196935 0.285
NP_442687.1_7 Forward -253 -243 10.4031 0.0994
NP_442687.1_7 Reverse -352 -362 9.12481 0.0994
NP_442687.1_7 Forward -363 -353 4.60159 0.243
NP_440042.1_2 Reverse -191 -210 3.73603 0.191
NP_441422.1_7 Reverse -199 -216 -2.71443 0.221
NP_442296.1_9 Reverse -113 -132 -2.75381 0.236
NP_442658.1_1 Reverse -351 -361 12.3692 0.0569
NP_442658.1_1 Forward -123 -113 9.22267 0.165
NP_442658.1_1 Forward -212 -202 9.02601 0.169
NP_442658.1_1 Reverse -199 -209 6.96107 0.214
NP_442658.1_1 Reverse -235 -245 4.89613 0.292
NP_442658.1_9 Forward -380 -361 12.8808 0.28
NP_442599.1_6 Forward -209 -190 9.83255 0.246
NP_440141.1_8 Reverse -267 -286 5.211 0.277
NP_441855.2_4 Forward -218 -199 12.6081 0.187
NP_441958.1_5 Reverse -352 -362 1.06167 0.116
NP_441958.1_5 Forward -211 -201 -6.31315 0.28
NP_441127.1_1 Reverse -266 -280 8.35772 0.3
NP_440203.1_5 Forward -359 -349 11.9759 0.168
NP_439905.1_1 Reverse -354 -367 9.16406 0.221
NP_443001.1_5 Reverse -279 -298 15.4374 0.152
NP_441338.2_5 Reverse -266 -285 3.34271 0.299
NP_442376.1_2 Reverse -196 -215 -5.9004 0.286
NP_442690.1_1 Forward -67 -48 -10.0303 0.209
NP_442911.1_2 Forward -220 -201 3.44104 0.0436
NP_442536.1_4 Forward -375 -357 7.39397 0.299
NP_443055.1_3 Forward -370 -351 12.0775 0.231
NP_440993.1_2 Forward -215 -199 9.49831 0.119
NP_440993.1_2 Forward -224 -208 3.79511 0.256
NP_441099.1_5 Reverse -191 -210 -5.01543 0.148
NP_442002.1_1 Forward -199 -181 -3.52077 0.212
NP_442002.1_9 Forward -211 -204 10.7572 0.185
NP_442885.1_1 Reverse -199 -218 12.7825 0.282
NP_441000.1_6 Forward -276 -262 -5.70361 0.29
NP_440147.1_4 Reverse -351 -364 7.29578 0.0712
NP_441916.1_7 Reverse -201 -211 6.96153 0.0784
NP_441916.1_7 Reverse -353 -363 5.97822 0.111
NP_440465.1_4 Reverse -209 -228 10.8159 0.255
NP_440465.1_10 Forward -222 -203 7.57094 0.173
NP_440465.1_10 Reverse -198 -217 4.03102 0.237
NP_441041.1_4 Reverse -243 -262 -11.6036 0.25
NP_441041.1_7 Forward -213 -201 5.6684 0.245
NP_441041.1_7 Reverse -350 -362 4.79381 0.295
NP_441725.1_4 Forward -215 -201 1.96562 0.3
NP_441725.1_5 Forward -361 -351 7.64985 0.0904
NP_441725.1_5 Reverse -202 -212 -0.806614 0.271
NP_439966.1_7 Reverse -199 -209 15.9091 0.0124
NP_439966.1_7 Forward -212 -202 7.74772 0.15
NP_439966.1_7 Forward -364 -354 4.50281 0.269
NP_439966.1_9 Forward -212 -203 10.7178 0.0863
NP_439966.1_9 Reverse -199 -208 9.83282 0.215
NP_439966.1_9 Reverse -110 -119 3.7363 0.253
NP_439966.1_9 Reverse -208 -217 0.491382 0.288
NP_442281.1_1 Reverse -348 -362 15.3386 0.0129
NP_442281.1_1 Forward -215 -201 5.01387 0.172
NP_442281.1_1 Reverse -225 -239 4.32555 0.199
NP_441334.1_7 Reverse -199 -218 -21.1417 0.29
NP_441079.1_4 Reverse -194 -213 16.0771 0.219
NP_442012.1_1 Forward -216 -197 5.50599 0.152
NP_441556.1_4 Reverse -344 -363 12.9937 0.201
NP_441556.1_10 Reverse -196 -210 12.6552 0.195
NP_442068.1_4 Reverse -89 -108 4.81688 0.286
NP_441644.1_6 Forward -362 -352 10.0093 0.0649
NP_443049.1_6 Forward -211 -201 13.6904 0.149
NP_442215.1_2 Forward -364 -348 3.99177 0.0889
NP_442215.1_2 Forward -336 -320 -4.1697 0.228
NP_442215.1_2 Forward -188 -172 -6.43131 0.271
NP_440253.1_2 Forward -210 -192 1.98577 0.147
NP_440253.1_2 Reverse -201 -219 -3.71743 0.3
NP_442933.1_10 Reverse -201 -210 6.48957 0.119
NP_442933.1_10 Reverse -353 -362 4.52295 0.24
NP_441310.1_10 Reverse -270 -280 15.2073 0.204
NP_441751.2_8 Reverse -202 -216 5.89945 0.0407
NP_441751.2_8 Forward -342 -328 -4.13031 0.163
NP_442554.1_8 Reverse -202 -212 6.17489 0.125
NP_442554.1_8 Forward -361 -351 3.91327 0.203
NP_442554.1_8 Reverse -354 -364 3.91327 0.203
NP_441762.1_7 Forward -211 -199 13.9036 0.0142
NP_441762.1_7 Reverse -200 -212 4.26721 0.0518
NP_441762.1_7 Forward -220 -208 -3.00928 0.0879
NP_441762.1_7 Forward -122 -110 -5.86088 0.246
NP_442142.1_4 Forward -213 -200 10.4418 0.0724
NP_442142.1_4 Reverse -350 -363 4.34528 0.223
NP_442142.1_4 Reverse -207 -220 3.36198 0.258
NP_442142.1_4 Reverse -198 -211 2.67367 0.281
NP_442292.1_1 Reverse -202 -211 -0.196935 0.239
NP_443009.1_5 Reverse -352 -363 9.98959 0.0841
NP_443009.1_5 Forward -122 -111 4.18809 0.259
NP_440397.1_5 Reverse -360 -379 19.7187 0.0714
NP_440357.1_3 Forward -364 -345 1.17943 0.275
NP_440158.1_8 Forward -254 -235 8.94757 0.292
NP_440183.1_9 Forward -325 -306 -12.8819 0.26
NP_441198.1_8 Reverse -351 -361 10.6345 0.254
NP_441468.1_1 Forward -209 -202 6.13563 0.209
NP_441468.1_1 Reverse -202 -209 6.0373 0.223
NP_441468.1_1 Reverse -354 -361 4.07068 0.263
NP_441673.1_1 Reverse -353 -362 1.37636 0.114
NP_441673.1_1 Forward -210 -201 1.37636 0.114
NP_441673.1_1 Forward -362 -353 1.1797 0.163
NP_441673.1_1 Reverse -201 -210 1.1797 0.163
NP_441731.1_3 Forward -218 -199 -6.68705 0.296
NP_441826.1_2 Forward -216 -202 10.521 0.0471
NP_442490.1_9 Forward -222 -203 -0.39387 0.179
NP_442490.1_9 Reverse -198 -217 -8.26035 0.287
NP_442227.1_2 Reverse -251 -270 10.6192 0.166
NP_442808.1_1 Reverse -200 -210 17.5808 0.00507
NP_442808.1_1 Forward -363 -353 6.56775 0.107
NP_442808.1_1 Forward -276 -266 1.15957 0.292
NP_440031.1_10 Forward -275 -256 1.17943 0.274
NP_441114.1_3 Forward -360 -351 17.1093 0.113
NP_441878.1_6 Reverse -352 -362 12.0747 0.013
NP_441878.1_6 Forward -363 -353 1.16001 0.11
NP_441036.1_8 Reverse -225 -235 7.55152 0.195
NP_441036.1_8 Forward -211 -201 7.05986 0.21
NP_441036.1_8 Reverse -200 -210 6.07655 0.242
NP_441557.1_5 Forward -210 -201 1.08137 0.0794
NP_441557.1_5 Reverse -201 -210 0.589713 0.134
NP_441557.1_5 Reverse -353 -362 0.491382 0.144
NP_441557.1_5 Forward -362 -353 0.29472 0.174
NP_441445.1_1 Forward -261 -242 0.884433 0.266
NP_442066.2_9 Forward -366 -353 8.08242 0.193
NP_441433.1_8 Forward -103 -84 -2.65548 0.27
NP_442419.1_2 Reverse -196 -215 -2.75381 0.247
NP_442830.1_5 Forward -363 -349 4.03056 0.239
NP_442192.1_7 Forward -201 -183 13.9821 0.299
NP_442183.1_1 Forward -210 -196 5.01447 0.234
NP_442397.1_9 Forward -192 -173 8.06259 0.246
NP_441574.1_1 Forward -222 -203 -0.0988766 0.198
NP_441574.1_1 Forward -264 -245 -4.42544 0.252
NP_441574.1_1 Reverse -246 -265 -6.68705 0.277
NP_442347.1_2 Reverse -202 -211 10.9145 0.0571
NP_442645.1_2 Forward -370 -351 -6.78538 0.0946
NP_442645.1_2 Reverse -104 -123 -16.5201 0.235
NP_441037.1_4 Forward -212 -202 7.22024 0.237
NP_441037.1_4 Reverse -351 -361 6.44058 0.263
NP_440690.1_3 Forward -192 -173 21.4356 0.035
NP_442317.1_6 Reverse -205 -224 5.11266 0.24
NP_442738.1_5 Forward -330 -311 19.3707 0.0475
NP_441633.1_3 Forward -364 -351 -3.81562 0.177
NP_441633.1_3 Reverse -199 -212 -3.91395 0.177
NP_441633.1_3 Forward -212 -199 -6.07724 0.236
NP_440136.1_2 Reverse -113 -120 11.1505 0.0519
NP_440136.1_2 Forward -209 -202 6.23397 0.171
NP_440136.1_2 Reverse -202 -209 6.13563 0.193
NP_442998.1_10 Reverse -203 -210 15.5754 0.0102
NP_440899.1_1 Forward -264 -245 6.26042 0.287
NP_440299.1_1 Forward -214 -201 7.2952 0.116
NP_441799.1_1 Reverse -349 -363 10.2254 0.0778
NP_440977.1_4 Reverse -13 -32 -0.000545616 0.0225
NP_441007.1_5 Forward -361 -342 12.7825 0.203
NP_441007.1_10 Reverse -205 -218 -0.570702 0.287
NP_442334.1_2 Forward -220 -203 -13.9242 0.297
NP_441559.1_8 Reverse -358 -372 5.70279 0.0864
NP_441559.1_8 Forward -366 -352 -4.4253 0.223
NP_441559.1_8 Reverse -196 -210 -7.67023 0.297
NP_440915.1_6 Forward -214 -200 4.91614 0.0953
NP_442866.1_1 Forward -367 -348 -3.44213 0.221
NP_440787.1_5 Reverse -13 -27 9.34103 0.272
NP_441199.1_6 Reverse -197 -216 5.70265 0.147
NP_441494.1_6 Reverse -208 -221 6.50913 0.285
NP_442993.1_1 Reverse -353 -369 -12.5278 0.274
NP_440677.1_1 Reverse -344 -363 13.1758 0.134
NP_442386.1_9 Forward -122 -113 10.2257 0.136
NP_442386.1_9 Reverse -200 -209 7.96411 0.213
NP_442386.1_9 Forward -211 -202 5.9975 0.23
NP_442386.1_9 Forward -363 -354 4.7192 0.289
NP_441291.1_4 Forward -354 -335 18.3873 0.14
NP_441340.1_5 Forward -209 -202 6.23397 0.132
NP_441340.1_5 Reverse -202 -209 5.84064 0.208
NP_441340.1_5 Forward -361 -354 3.97235 0.274
NP_442791.1_5 Forward -335 -316 -10.9153 0.282
NP_440168.1_9 Reverse -199 -218 -5.70374 0.296
NP_442240.1_2 Reverse -202 -221 -16.8151 0.249
NP_440161.1_3 Forward -364 -345 16.8141 0.0774
NP_440586.1_1 Forward -229 -210 -5.70374 0.288
NP_440586.1_8 Forward -209 -202 14.69 0.026
NP_442251.1_6 Reverse -202 -209 12.0355 0.0627
NP_441262.1_3 Forward -210 -203 14.7888 0.0223
NP_440027.1_3 Reverse -353 -371 1.88669 0.295
NP_443051.1_1 Forward -211 -202 0.884706 0.125
NP_439937.1_8 Forward -212 -193 9.3409 0.19
NP_439937.1_8 Reverse -199 -218 1.37609 0.229
NP_439937.1_9 Forward -211 -194 -0.748498 0.122
NP_439937.1_9 Reverse -360 -377 -10.7782 0.233
NP_439937.1_9 Reverse -200 -217 -10.9749 0.237
NP_439937.1_9 Forward -373 -356 -12.1548 0.27
NP_439937.1_9 Forward -320 -303 -12.1548 0.27
NP_439937.1_9 Forward -163 -146 -12.4498 0.272
NP_441595.1_2 Reverse -6 -19 9.13351 0.278
NP_440836.1_6 Forward -162 -148 9.83269 0.257
NP_440439.1_1 Reverse -198 -211 -0.275709 0.211
NP_440439.1_1 Forward -213 -200 -0.767364 0.236
NP_440372.1_2 Forward -209 -202 6.82395 0.0854
NP_440372.1_2 Reverse -202 -209 6.52896 0.188
NP_442783.1_8 Reverse -85 -104 16.9115 0.183
NP_441181.1_6 Forward -218 -200 7.19731 0.219
NP_440316.1_10 Reverse -265 -275 11.0914 0.214
NP_440316.1_10 Reverse -352 -362 6.8632 0.251
NP_441803.1_2 Forward -215 -196 17.3057 0.0309
NP_441803.1_2 Reverse -267 -286 11.5042 0.0716
NP_441803.1_2 Forward -339 -320 3.14605 0.197
NP_441803.1_2 Reverse -205 -224 -0.39387 0.275
NP_439977.1_5 Reverse -195 -214 -1.67217 0.257
NP_442384.1_10 Reverse -353 -366 7.09911 0.0875
NP_442114.1_4 Reverse -201 -212 11.3667 0.129
NP_442114.1_8 Reverse -2 -16 10.422 0.234
NP_442790.1_4 Forward -219 -200 -5.70374 0.144
NP_442790.1_4 Forward -281 -262 -8.06369 0.164
NP_442262.1_10 Forward -209 -202 12.9205 0.0422
NP_442262.1_10 Forward -361 -354 9.87221 0.164
NP_442244.1_3 Forward -331 -312 5.11266 0.258
NP_440344.1_10 Reverse -194 -211 0.235503 0.0365
NP_440344.1_10 Reverse -223 -240 -10.7776 0.19
NP_440344.1_10 Forward -217 -200 -11.0726 0.2
NP_440282.1_10 Reverse -343 -362 -9.34199 0.277
NP_440531.1_6 Reverse -345 -364 -1.86883 0.241
NP_442910.1_1 Reverse -346 -365 2.85105 0.118
NP_440487.1_1 Forward -213 -194 -2.55715 0.214
NP_441965.1_10 Forward -365 -349 2.91013 0.28
NP_440297.1_9 Forward -361 -351 7.35486 0.126
NP_441896.1_3 Reverse -192 -211 16.0274 0.0408
NP_441896.1_3 Forward -371 -352 -3.04881 0.294
NP_441896.1_5 Reverse -143 -150 15.3787 0.268
NP_440894.1_10 Reverse -196 -215 19.469 0.0416
NP_440894.1_10 Forward -339 -320 2.94938 0.279
NP_440999.1_9 Reverse -209 -223 6.58777 0.0964
NP_440999.1_9 Reverse -197 -211 2.85119 0.142
NP_440888.1_2 Reverse -213 -227 5.30886 0.284
NP_439969.1_3 Reverse -196 -215 -1.57384 0.279
NP_442948.1_2 Forward -211 -192 17.699 0.0953
NP_442033.1_10 Forward -212 -193 -5.11376 0.179
NP_442033.1_10 Reverse -189 -208 -13.3736 0.287
NP_442033.1_10 Reverse -199 -218 -14.5535 0.299
NP_441543.1_2 Reverse -202 -211 8.65285 0.0968
NP_441543.1_2 Forward -209 -200 7.07956 0.131
NP_441469.1_8 Reverse -209 -218 10.4228 0.216
NP_441469.1_8 Reverse -352 -361 9.63616 0.227
NP_441469.1_8 Forward -211 -202 6.39124 0.227
NP_441469.1_8 Reverse -200 -209 5.60459 0.258
NP_441469.1_8 Forward -363 -354 5.50626 0.265
NP_441469.1_8 Forward -122 -113 5.3096 0.277
NP_442337.1_8 Forward -108 -89 11.1109 0.138
NP_442578.1_7 Forward -209 -202 14.6904 0.026
NP_442578.1_7 Reverse -211 -218 9.87221 0.122
NP_440710.1_1 Forward -370 -352 -1.75081 0.185
NP_440071.1_1 Forward -224 -207 9.37954 0.261
NP_441462.1_2 Forward -362 -352 0.471689 0.148
NP_441462.1_2 Forward -210 -200 -0.0199663 0.177
NP_441621.1_7 Reverse -199 -213 15.8309 0.0266
NP_441621.1_7 Forward -212 -198 7.66941 0.0675
NP_441621.1_7 Forward -221 -207 -0.983719 0.169
NP_443062.1_1 Reverse -201 -219 11.9587 0.0887
NP_443062.1_1 Forward -275 -257 8.15589 0.159
NP_443062.1_6 Reverse -345 -364 17.404 0.0578
NP_441601.1_10 Reverse -264 -283 3.93269 0.256
NP_442204.1_1 Forward -214 -203 2.41861 0.266
NP_440516.1_8 Forward -210 -201 10.5211 0.00816
NP_440516.1_8 Reverse -266 -275 -0.295266 0.232
NP_442080.1_7 Reverse -320 -339 -2.65548 0.287
NP_442428.1_5 Forward -209 -202 6.13563 0.209
NP_442428.1_5 Reverse -202 -209 6.0373 0.212
NP_442428.1_5 Reverse -354 -361 4.46401 0.267
NP_441032.1_6 Forward -275 -256 13.0775 0.0869
NP_442120.1_10 Forward -258 -239 -8.26035 0.23
NP_441835.1_3 Forward -210 -196 20.3541 0.031
NP_440673.1_3 Reverse -203 -210 12.4288 0.0426
NP_440673.1_3 Forward -360 -353 8.98723 0.203
NP_440865.1_9 Forward -216 -197 -0.39387 0.157
NP_441052.1_2 Reverse -201 -211 1.25834 0.249
NP_442219.1_8 Reverse -272 -291 7.87721 0.26
NP_440436.1_4 Forward -361 -352 9.73406 0.0871
NP_440436.1_4 Reverse -202 -211 8.55409 0.0997
NP_440436.1_4 Reverse -113 -122 3.93256 0.294
NP_441884.1_9 Forward -213 -194 -21.24 0.235
NP_442086.1_6 Forward -222 -203 9.43923 0.274
NP_441086.1_3 Forward -64 -45 10.1731 0.187
NP_441719.1_4 Forward -209 -202 13.5105 0.026
NP_441719.1_4 Reverse -202 -209 6.52896 0.188
NP_441733.1_10 Forward -213 -200 16.9322 0.0382
NP_441004.1_1 Reverse -127 -146 -17.8968 0.295
NP_441004.1_1 Forward -216 -197 -18.1918 0.298
NP_441004.1_2 Forward -200 -181 1.67108 0.217
NP_441004.1_4 Reverse -385 -395 10.0098 0.258
NP_441004.1_5 Reverse -349 -363 7.76774 0.284
NP_442366.1_3 Reverse -200 -218 -0.472507 0.191
NP_440129.1_10 Forward -217 -203 6.6861 0.177
NP_440129.1_10 Reverse -260 -274 4.03116 0.185
NP_440296.1_6 Forward -28 -10 13.6573 0.292
NP_441115.1_4 Forward -211 -193 15.063 0.0455
NP_442206.1_1 Forward -362 -343 -2.85214 0.156
NP_442430.1_6 Reverse -7 -26 10.6192 0.271
NP_441851.1_10 Reverse -111 -121 12.6647 0.046
NP_441851.1_10 Reverse -352 -362 6.27322 0.178
NP_441851.1_10 Forward -211 -201 4.60159 0.259
NP_441851.1_10 Forward -363 -353 4.50326 0.266
NP_442208.1_5 Forward -105 -86 -7.57203 0.274
NP_442515.1_1 Reverse -352 -366 1.76955 0.149
NP_441982.1_6 Reverse -148 -157 13.5358 0.274
NP_442689.1_1 Forward -281 -262 29.9904 0.000602
NP_442689.1_2 Forward -221 -202 30.0887 0.0000405
NP_442689.1_3 Forward -260 -241 22.6156 0.0498
NP_442689.1_4 Forward -301 -282 29.4987 0.000727
NP_442689.1_8 Forward -19 -2 -4.58271 0.267
NP_442843.1_1 Reverse -354 -373 -2.0655 0.202
NP_442843.1_1 Forward -326 -307 -8.35868 0.255
NP_440431.1_3 Forward -363 -344 -11.2103 0.284
NP_440588.1_2 Reverse -192 -211 -5.21209 0.243
NP_440943.1_4 Reverse -345 -357 14.887 0.227
NP_442006.1_2 Forward -328 -311 -17.3657 0.274
NP_442006.1_2 Forward -98 -81 -17.4641 0.276
NP_442006.1_3 Forward -216 -198 2.87075 0.238
NP_441570.1_1 Forward -252 -234 -11.9772 0.206
NP_441078.1_4 Reverse -353 -362 8.1612 0.039
NP_441078.1_4 Forward -362 -353 0.983037 0.151
NP_441078.1_4 Forward -210 -201 0.196389 0.205
NP_441078.1_4 Reverse -201 -210 -0.000272808 0.205
NP_440707.1_6 Reverse -355 -374 11.2084 0.274
NP_442443.1_1 Forward -378 -359 -3.14714 0.264
NP_441432.1_8 Reverse -352 -361 6.5879 0.112
NP_442320.1_8 Forward -216 -202 -3.73699 0.131
NP_441732.1_2 Forward -214 -198 -15.8711 0.163
NP_440503.1_10 Reverse -90 -109 16.2241 0.236
NP_440760.1_1 Reverse -353 -372 -20.5517 0.223
NP_440760.1_7 Forward -20 -1 3.73524 0.247
NP_442797.1_6 Reverse -245 -264 8.51591 0.265
NP_442797.1_7 Forward -211 -193 -0.0791831 0.281
NP_441805.1_6 Forward -215 -196 12.8808 0.19
NP_442407.1_6 Reverse -151 -170 11.0125 0.268
NP_442489.1_2 Forward -108 -89 0.58944 0.297
NP_442489.1_7 Reverse -353 -362 8.1612 0.0294
NP_442489.1_7 Forward -362 -353 7.76787 0.0518
NP_442489.1_7 Reverse -201 -210 7.47288 0.0613
NP_442489.1_7 Forward -210 -201 0.688044 0.152
NP_442079.1_7 Reverse -202 -221 3.73603 0.209
NP_441659.2_8 Forward -362 -352 7.45319 0.0601
NP_442346.1_5 Reverse -352 -362 14.4347 0.0134
NP_440545.1_3 Forward -214 -197 -0.354483 0.152
NP_440545.1_3 Reverse -197 -214 -1.14113 0.163
NP_440545.1_3 Forward -223 -206 -6.451 0.28
NP_440025.1_3 Forward -365 -351 13.5152 0.24
NP_440831.1_3 Reverse -266 -285 5.7076 0.28
NP_440010.1_4 Reverse -262 -281 -0.787962 0.262
NP_442551.1_4 Forward -364 -349 -0.905081 0.245
NP_440847.1_3 Reverse -311 -325 16.3219 0.139
NP_440847.1_3 Forward -283 -269 11.5037 0.263
NP_441888.1_7 Forward -215 -201 3.63784 0.225
NP_441888.1_7 Forward -367 -353 1.67122 0.241
NP_441047.1_2 Reverse -231 -250 2.0644 0.239
NP_441833.1_4 Reverse -202 -209 6.52896 0.0924
NP_441833.1_4 Forward -209 -202 6.23397 0.163
NP_441329.1_1 Reverse -39 -58 12.7478 0.175
NP_442699.1_8 Reverse -142 -161 -4.03212 0.238
NP_442162.1_9 Forward -209 -202 6.62729 0.142
NP_442162.1_9 Reverse -202 -209 6.52896 0.178
NP_440671.1_4 Forward -216 -202 9.93102 0.168
NP_442199.1_5 Reverse -310 -329 -5.40875 0.245
NP_442140.1_3 Forward -209 -199 10.0098 0.0949
NP_442140.1_3 Reverse -202 -212 7.94484 0.124
NP_442140.1_3 Reverse -354 -364 3.61828 0.288
NP_442021.1_6 Reverse -97 -116 4.32602 0.276
NP_440875.1_9 Reverse -203 -213 18.3004 0.0104
NP_440875.1_9 Forward -273 -263 7.98268 0.251
NP_440875.1_9 Reverse -91 -101 7.10665 0.283
NP_441813.1_5 Reverse -199 -209 0.373358 0.203
NP_441813.1_5 Forward -212 -202 0.275027 0.206
NP_441813.1_5 Forward -364 -354 -0.216628 0.237
NP_442254.1_1 Reverse -341 -360 -5.99873 0.297
NP_440590.1_4 Forward -209 -196 5.32916 0.0585
NP_440590.1_4 Reverse -202 -215 -3.22564 0.255
NP_440567.1_1 Reverse -202 -216 11.406 0.0286
NP_440567.1_1 Forward -209 -195 4.12949 0.129
NP_442497.1_10 Reverse -202 -211 0.589713 0.153
NP_442497.1_10 Forward -361 -352 0.196389 0.208
NP_440821.1_4 Forward -212 -202 9.02648 0.0364
NP_440821.1_4 Reverse -199 -209 6.56821 0.0853
NP_441239.1_9 Reverse -351 -363 10.9537 0.0695
NP_441239.1_9 Forward -364 -352 9.28209 0.11
NP_441239.1_9 Reverse -199 -211 8.9871 0.117
NP_441239.1_9 Forward -277 -265 4.26721 0.256
NP_441892.1_1 Forward -219 -202 0.825489 0.161
NP_441892.1_1 Reverse -316 -333 -1.14113 0.198
NP_441892.1_1 Reverse -221 -238 -4.87771 0.269
NP_442193.1_1 Forward -362 -344 7.19731 0.295
NP_440949.1_7 Forward -218 -199 8.65176 0.278
NP_442052.1_8 Reverse -351 -361 15.3197 0.253
NP_441230.1_5 Forward -367 -348 2.16274 0.223
NP_440055.1_2 Forward -323 -304 17.109 0.111
NP_440462.1_6 Forward -212 -202 14.7297 0.0186
NP_440462.1_6 Reverse -199 -209 7.35486 0.0803
NP_442611.1_1 Forward -215 -196 -0.39387 0.266
NP_440868.1_4 Reverse -197 -209 12.232 0.0245
NP_440868.1_4 Reverse -206 -218 1.12062 0.192
NP_440868.1_4 Forward -214 -202 0.432302 0.212
NP_442402.1_4 Forward -166 -147 -10.1294 0.297
NP_442402.1_10 Reverse -84 -94 13.8442 0.182
NP_441848.1_4 Reverse -4 -20 11.4658 0.224
NP_439948.1_2 Reverse -15 -33 15.2807 0.259
NP_440696.1_3 Forward -372 -354 4.24738 0.2
NP_442882.1_7 Forward -128 -114 18.0918 0.24
NP_440008.1_9 Forward -245 -226 16.2241 0.131
NP_442837.1_3 Reverse -202 -209 12.1338 0.0702
NP_442837.1_3 Forward -209 -202 6.0373 0.25
NP_442053.1_1 Reverse -201 -210 14.1594 0.0136
NP_442053.1_1 Forward -210 -201 7.86621 0.0863
NP_440505.1_3 Forward -212 -202 5.28991 0.236
NP_441252.1_6 Reverse -147 -154 14.3954 0.168
NP_442532.1_7 Forward -210 -196 6.19444 0.171
NP_440009.1_3 Reverse -258 -277 16.0274 0.101
NP_441011.1_8 Reverse -202 -211 7.07956 0.179
NP_441011.1_8 Forward -209 -200 5.70292 0.237
NP_442533.1_1 Forward -207 -188 -13.7669 0.238
NP_442533.1_1 Reverse -322 -341 -17.0118 0.279
NP_442533.1_6 Forward -362 -353 8.25953 0.0776
NP_442533.1_6 Reverse -353 -362 7.66954 0.0897
NP_442541.1_1 Reverse -341 -360 8.55425 0.288
NP_442541.1_10 Reverse -88 -102 2.65393 0.254
NP_442232.1_3 Forward -218 -199 -15.7335 0.296
NP_441482.1_7 Forward -216 -202 -10.5218 0.209
NP_441697.1_5 Reverse -35 -54 -7.21006 0.242
NP_442202.1_4 Reverse -199 -213 17.8771 0.104
NP_442202.1_10 Reverse -352 -366 5.01447 0.255
NP_441527.1_4 Reverse -11 -30 -4.72727 0.188
NP_441527.1_4 Reverse -1 -20 -12.9396 0.296
NP_440115.1_6 Forward -213 -203 10.5998 0.115
NP_440007.1_9 Reverse -263 -277 4.12949 0.267
NP_441680.1_4 Reverse -87 -106 -3.44213 0.296
NP_440608.1_1 Reverse -6 -25 6.10945 0.268
NP_441602.1_3 Forward -367 -348 -2.0655 0.232
NP_441602.1_3 Reverse -196 -215 -4.72043 0.272
NP_441106.1_1 Forward -211 -202 8.45619 0.0548
NP_441106.1_1 Forward -220 -211 5.01461 0.191
NP_442704.1_7 Reverse -139 -158 13.1758 0.181
NP_441286.1_1 Forward -211 -199 -5.17256 0.192
NP_442674.1_3 Reverse -317 -336 8.55343 0.194
NP_440670.1_8 Forward -362 -353 5.3096 0.167
NP_441930.1_2 Reverse -352 -362 15.9097 0.19
NP_440886.1_7 Reverse -200 -210 8.43603 0.0805
NP_440886.1_7 Forward -363 -353 7.64939 0.0865
NP_440886.1_7 Forward -211 -201 6.86274 0.113
NP_440886.1_7 Forward -276 -266 5.78111 0.163
NP_440907.2_8 Reverse -202 -212 8.04271 0.117
NP_440907.2_8 Forward -209 -199 5.09279 0.222
NP_442264.1_2 Forward -220 -203 8.10198 0.222
NP_441463.1_3 Reverse -203 -222 -9.047 0.276
NP_441626.1_2 Forward -209 -202 6.13563 0.177
NP_441626.1_2 Reverse -202 -209 5.93897 0.231
NP_441962.1_4 Reverse -196 -215 -1.7705 0.125
NP_440387.1_1 Forward -210 -194 -2.79306 0.15
NP_440387.1_1 Reverse -201 -217 -3.18639 0.156
NP_440387.1_1 Reverse -353 -369 -5.54633 0.238
NP_440855.1_1 Reverse -195 -214 2.45773 0.205
NP_441431.1_2 Forward -365 -351 8.94708 0.2
NP_441431.1_2 Reverse -198 -212 6.58715 0.266
NP_441431.1_2 Forward -213 -199 6.48882 0.269
NP_441488.1_7 Forward -216 -197 10.2259 0.113
NP_441174.1_2 Forward -213 -199 14.3559 0.166
NP_440082.1_5 Forward -27 -8 16.852 0.256
NP_440114.1_10 Reverse -353 -367 10.6193 0.142
NP_442437.1_8 Reverse -202 -221 2.85105 0.296
NP_440293.1_3 Reverse -345 -364 1.47442 0.207
NP_440293.1_3 Forward -271 -252 -2.0655 0.239
NP_440293.1_3 Forward -218 -199 -5.31042 0.275
NP_440766.1_4 Reverse -197 -211 14.8476 0.0283
NP_440766.1_4 Forward -214 -200 12.291 0.0556
NP_441237.1_9 Forward -361 -351 14.0414 0.0535
NP_439910.1_2 Reverse -193 -210 -22.184 0.215
NP_442867.1_8 Forward -335 -316 3.83436 0.297
NP_440457.1_1 Forward -214 -202 6.33216 0.123
NP_441801.1_4 Reverse -365 -375 3.12662 0.231
NP_440801.1_10 Forward -214 -195 6.29264 0.289
NP_441984.1_3 Reverse -342 -360 7.4923 0.246
NP_441489.1_2 Forward -121 -102 18.1033 0.155
NP_441489.1_3 Reverse -5 -19 17.0092 0.172
NP_441253.1_8 Reverse -348 -362 11.9241 0.227
NP_442514.1_5 Forward -104 -85 -5.31116 0.257
NP_440554.1_4 Reverse -202 -212 4.3066 0.195
NP_442341.1_7 Reverse -200 -214 11.8976 0.0502
NP_442341.1_7 Forward -211 -197 2.2612 0.263
NP_442341.1_7 Forward -363 -349 1.08123 0.299
NP_442341.1_9 Forward -364 -350 10.5204 0.133
NP_441173.1_9 Forward -156 -148 12.1137 0.21
NP_442395.2_4 Reverse -200 -219 3.53858 0.2
NP_440423.1_6 Forward -218 -199 -19.9617 0.248
NP_440507.2_3 Reverse -192 -211 10.1267 0.208
NP_440275.1_3 Forward -212 -202 8.4365 0.0602
NP_442275.1_1 Forward -371 -352 0.982764 0.284
NP_442275.1_1 Forward -372 -353 -0.295539 0.295
NP_441902.1_3 Reverse -147 -157 13.7591 0.226
NP_441207.1_7 Reverse -2 -16 11.0948 0.249
NP_441207.1_7 Reverse -12 -26 10.0299 0.269
NP_439962.1_4 Forward -218 -199 -7.37537 0.288
NP_440641.1_6 Reverse -171 -190 8.94757 0.272
NP_440804.1_4 Reverse -12 -21 16.716 0.145
NP_440149.1_8 Reverse -353 -372 -5.31042 0.223
NP_441105.1_3 Forward -221 -202 -9.44032 0.289
NP_440216.1_1 Forward -275 -261 -6.09693 0.138
NP_440216.1_1 Reverse -353 -367 -12.1934 0.247
NP_440172.1_1 Forward -362 -352 3.61828 0.222
NP_440172.1_1 Reverse -353 -363 2.7333 0.268
NP_441226.1_7 Reverse -267 -274 9.77352 0.131
NP_442446.1_3 Forward -222 -203 15.3391 0.199
NP_441111.1_7 Reverse -202 -210 8.86921 0.0589
NP_441766.1_2 Reverse -201 -210 8.55452 0.054
NP_441766.1_2 Reverse -210 -219 5.80125 0.104
NP_442417.1_5 Reverse -263 -277 5.89945 0.244
NP_440072.1_5 Forward -198 -180 2.77242 0.236
NP_442116.1_6 Reverse -46 -63 5.97264 0.289
NP_442403.1_9 Reverse -198 -217 6.4893 0.193
NP_440591.1_9 Forward -217 -199 12.7038 0.0931
NP_442564.1_2 Reverse -355 -374 7.17762 0.253
NP_440261.1_5 Forward -361 -348 -10.5021 0.201
NP_440261.1_5 Reverse -202 -215 -10.8955 0.221
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGACCCATCAGCCAAGATTAATTACTGGGGGAGTTCCGGCCATTGCCCAGATAGTGAACTATCACCTTGATCACCCATGGGAGGATTGACCGTGAATCTAGAAACTCTGGAATTCGTCATTTACCCCGACGGCCGGGTGAAGGAAACGGTAACCGGCATTGTGGGTCGCTCTTGTCAGGAAGTGACCGCGGCGATCGAGGCCGAACTAGGGGTAGTGCTTACCCAGCAGACTACTTCGGAGTTTTTTGCCCAAACCAGTCCGTTGAACCAATCAGTTCAGCAATCCCAGACTCTTTCTAGCTGGCCTGGGGGAAGTTAAATTCTCTCTGTATGAAAATCCTTGTTTAAAAGTTTTAAGAACCTGTCTCATCCATTCTTCTAATTTTTTTGTAATTTCCT

CDS

ATGTCTCACTTTAGCAATATCAAAACCAAGATTCGTAACCTTGATGTGTTGAAAACCACCCTCACCAACTTGGGTCTGGATTGGAAAGAAGGGCCGGCCACCGTGCGGGGCTACCAGGGTTTGACCGCCAAAGCCGCAGTGGTGATTGAACAGAGCAATGATTACGACCTAGGTTTTAGCTGGAATGGTCAGGAATATGAGTTGGTGACAGATTTACAGTACTGGCAACAGCCCCTTTCGGTGGAAGGATTTCTGCAAAAAATCACCCAGGGTTACGCTCTGGAAACCGTACTTAATGAATCGGCCAAACAAGGTTTTGCGGTGACGGAACAACAAAAAAATGAAGACGGCTCAGTGCGGTTGGTGGTGCAACGCTGGAGTGCCTGA

Protein

MSHFSNIKTKIRNLDVLKTTLTNLGLDWKEGPATVRGYQGLTAKAAVVIEQSNDYDLGFSWNGQEYELVTDLQYWQQPLSVEGFLQKITQGYALETVLNESAKQGFAVTEQQKNEDGSVRLVVQRWSA