Your browser is old and dusty. Try Google Chrome!

Details for sll0651

ORF sll0651
Accession NP_440284.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY100j: 421739 - 422684]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_4 Reverse -320 -339 9.63507 0.278
NP_441418.1_1 Forward -85 -66 10.074 0.205
NP_441480.1_1 Reverse -314 -333 -0.787193 0.287
NP_440897.1_6 Forward -206 -187 3.9319 0.14
NP_442151.1_1 Forward -369 -350 4.42435 0.287
NP_440226.1_9 Forward -263 -244 12.1925 0.215
NP_441098.1_3 Forward -243 -224 -6.50185 0.28
NP_440996.1_1 Forward -255 -236 18.6308 0.0234
NP_440996.1_2 Forward -299 -290 14.8477 0.248
NP_441812.1_4 Forward -196 -178 11.9172 0.253
NP_441470.1_4 Forward -126 -107 27.5321 0.0000116
NP_441470.1_5 Forward -64 -45 29.2979 0.00000912
NP_441470.1_6 Forward -269 -250 28.2204 0.0000759
NP_441470.1_7 Forward -170 -151 27.2371 0.000139
NP_442861.1_4 Reverse -53 -72 -1.77127 0.297
NP_442972.1_2 Forward -281 -267 15.2402 0.136
NP_442268.1_3 Reverse -192 -211 12.9783 0.284
NP_441781.1_7 Forward -381 -362 5.01433 0.186
NP_441492.1_1 Forward -374 -355 11.1109 0.148
NP_441365.1_5 Forward -374 -355 37.5619 0.000000115
NP_441434.1_1 Reverse -223 -237 10.0383 0.233
NP_441434.1_1 Forward -237 -223 7.93745 0.26
NP_440178.1_7 Reverse -199 -218 -15.0452 0.156
NP_442973.1_5 Forward -366 -347 9.93088 0.287
NP_441014.1_10 Reverse -17 -36 2.9486 0.215
NP_441014.1_10 Reverse -68 -87 2.16195 0.216
NP_442730.1_8 Reverse -320 -339 8.16011 0.185
NP_442687.1_7 Forward -325 -315 4.20827 0.262
NP_442720.1_8 Reverse -66 -84 10.0489 0.297
NP_442720.1_8 Reverse -143 -161 7.59063 0.297
NP_442658.1_1 Forward -359 -349 6.37109 0.231
NP_442496.1_5 Forward -307 -289 4.83737 0.288
NP_441317.1_4 Reverse -55 -69 16.2438 0.136
NP_440950.1_8 Forward -67 -48 13.3077 0.148
NP_442816.1_7 Reverse -53 -72 17.4269 0.0347
NP_442816.1_7 Reverse -52 -71 7.30471 0.238
NP_440200.1_7 Forward -311 -292 6.22677 0.204
NP_441913.1_1 Forward -198 -182 13.6262 0.246
NP_442598.1_2 Reverse -164 -173 14.2577 0.252
NP_441000.1_1 Forward -375 -357 13.3937 0.184
NP_441369.1_2 Forward -379 -360 38.9385 0.0000000955
NP_441079.1_3 Forward -355 -336 13.4708 0.166
NP_441566.1_3 Forward -311 -292 14.5524 0.198
NP_440437.1_1 Forward -215 -196 -5.80207 0.292
NP_442247.1_5 Reverse -382 -396 14.4865 0.234
NP_442933.1_1 Reverse -56 -75 7.68668 0.253
NP_442933.1_1 Reverse -258 -277 7.11373 0.253
NP_442933.1_2 Forward -77 -59 7.64134 0.257
NP_442933.1_2 Forward -67 -49 7.64134 0.257
NP_442554.1_9 Reverse -47 -66 12.4065 0.279
NP_442970.1_1 Forward -399 -385 9.56081 0.269
NP_440405.1_6 Forward -243 -225 2.18243 0.26
NP_440881.1_10 Reverse -192 -205 11.3273 0.249
NP_440183.1_1 Reverse -130 -149 8.25926 0.244
NP_441826.1_2 Forward -206 -192 -0.197071 0.204
NP_441826.1_6 Forward -245 -231 20.5508 0.0182
NP_441612.1_2 Forward -301 -291 11.5505 0.21
NP_442227.1_2 Reverse -8 -27 -0.39387 0.253
NP_441911.1_10 Forward -76 -57 7.40211 0.274
NP_442775.1_6 Reverse -124 -143 10.5209 0.277
NP_442903.1_2 Forward -77 -58 6.92274 0.165
NP_440274.1_2 Reverse -105 -119 12.3887 0.236
NP_441036.1_7 Forward -305 -295 16.7941 0.0578
NP_441445.1_1 Reverse -182 -201 1.17943 0.259
NP_440084.1_5 Reverse -117 -136 13.7658 0.124
NP_441116.1_10 Reverse -293 -312 4.71934 0.257
NP_442047.1_2 Reverse -179 -193 15.4376 0.161
NP_441633.1_6 Reverse -280 -299 8.75091 0.182
NP_440136.1_1 Reverse -246 -262 9.69426 0.238
NP_442998.1_5 Forward -378 -368 8.53483 0.261
NP_440899.1_8 Reverse -55 -74 -6.68705 0.231
NP_441118.1_2 Forward -338 -319 24.4839 0.000875
NP_441118.1_10 Forward -206 -188 24.0119 0.000829
NP_441296.1_6 Reverse -214 -233 0.982764 0.299
NP_440306.1_3 Forward -242 -223 4.71934 0.295
NP_440306.1_5 Forward -72 -53 5.99764 0.121
NP_441340.1_5 Forward -199 -192 8.8889 0.084
NP_442484.1_2 Reverse -25 -44 1.76941 0.226
NP_441248.1_10 Forward -122 -112 14.9073 0.277
NP_440192.1_4 Forward -123 -104 12.6963 0.169
NP_440372.1_3 Forward -398 -384 15.0039 0.165
NP_441138.1_5 Reverse -57 -70 20.879 0.0216
NP_441293.1_6 Reverse -107 -126 16.09 0.1
NP_442114.1_8 Forward -72 -58 6.98048 0.234
NP_441018.1_3 Reverse -200 -219 10.52 0.286
NP_440530.1_6 Reverse -207 -221 15.7664 0.201
NP_442910.1_1 Forward -188 -169 -7.57203 0.254
NP_440562.1_5 Reverse -142 -161 3.04771 0.261
NP_440350.1_5 Reverse -46 -65 6.88262 0.134
NP_440350.1_5 Reverse -153 -172 1.57275 0.158
NP_440350.1_5 Reverse -52 -71 0.982764 0.158
NP_440350.1_5 Reverse -61 -80 -4.32711 0.273
NP_442129.1_6 Forward -400 -381 13.9464 0.246
NP_440888.1_2 Reverse -322 -336 6.19383 0.243
NP_441771.1_4 Forward -302 -283 -4.42544 0.292
NP_440663.1_6 Reverse -192 -211 14.4541 0.0249
NP_442277.1_7 Forward -72 -56 1.05721 0.205
NP_442277.1_7 Forward -78 -62 -1.61656 0.278
NP_442845.1_2 Forward -206 -192 3.93283 0.272
NP_442710.1_6 Forward -292 -273 6.39097 0.204
NP_439907.1_10 Forward -208 -189 11.0117 0.273
NP_441929.1_6 Forward -73 -54 4.32602 0.294
NP_440519.1_6 Reverse -317 -331 9.43936 0.29
NP_440544.1_5 Reverse -151 -158 13.8024 0.28
NP_440454.1_2 Forward -66 -52 13.285 0.227
NP_440454.1_2 Forward -70 -56 9.94278 0.291
NP_441052.1_2 Forward -45 -35 1.94665 0.221
NP_442139.1_10 Reverse -122 -141 12.1917 0.188
NP_442026.1_3 Forward -380 -361 3.04771 0.192
NP_441396.1_2 Reverse -59 -76 7.21627 0.107
NP_441982.1_10 Reverse -357 -376 8.55343 0.143
NP_440005.1_3 Forward -239 -220 21.2407 0.00993
NP_441661.1_3 Forward -164 -147 -3.99273 0.226
NP_441409.1_8 Forward -72 -53 11.0656 0.209
NP_440431.1_3 Forward -207 -188 -10.7186 0.276
NP_440431.1_4 Forward -80 -61 6.34979 0.07
NP_440431.1_4 Forward -69 -50 -4.34531 0.224
NP_440040.1_8 Forward -83 -64 7.87766 0.203
NP_440943.1_5 Forward -360 -346 14.1593 0.22
NP_442348.1_2 Reverse -146 -155 11.7994 0.225
NP_442906.1_9 Reverse -281 -300 4.32602 0.207
NP_441432.1_8 Forward -332 -323 2.85133 0.281
NP_441333.1_1 Reverse -67 -77 13.0198 0.217
NP_441333.1_1 Reverse -56 -66 12.9245 0.217
NP_442400.1_10 Forward -71 -58 13.8126 0.173
NP_441706.1_1 Reverse -57 -76 4.52268 0.081
NP_440284.1_8 Forward -368 -349 29.6945 0.000000161
NP_440284.1_9 Forward -300 -281 28.8104 0.00000727
NP_440336.1_1 Forward -276 -257 10.5209 0.286
NP_441653.1_2 Forward -34 -15 3.43298 0.264
NP_441329.1_1 Reverse -295 -314 5.29938 0.265
NP_441329.1_6 Forward -170 -151 12.0793 0.106
NP_441329.1_6 Forward -75 -56 11.2199 0.106
NP_441329.1_6 Forward -71 -52 10.265 0.109
NP_441329.1_6 Forward -69 -50 1.76618 0.231
NP_441329.1_6 Forward -172 -153 -2.14899 0.293
NP_441329.1_6 Forward -73 -54 -2.91293 0.294
NP_442436.1_4 Reverse -257 -271 12.3893 0.218
NP_442028.1_1 Reverse -47 -60 12.4757 0.251
NP_440227.1_2 Forward -229 -213 8.41667 0.29
NP_442568.1_8 Forward -170 -156 10.7177 0.257
NP_440833.1_4 Reverse -141 -159 14.3755 0.0722
NP_440212.1_9 Reverse -39 -58 9.01884 0.14
NP_441607.1_1 Forward -26 -7 19.9867 0.0245
NP_442499.1_4 Forward -202 -188 11.0127 0.226
NP_442840.1_7 Forward -298 -279 13.5691 0.064
NP_440341.1_7 Reverse -172 -186 12.6843 0.2
NP_441848.1_4 Forward -223 -207 7.74165 0.288
NP_439948.1_2 Forward -70 -52 13.5618 0.259
NP_441811.1_8 Forward -117 -103 5.80112 0.289
NP_442679.1_1 Forward -75 -56 4.42435 0.147
NP_442679.1_1 Forward -277 -258 3.83436 0.147
NP_442679.1_1 Forward -68 -49 -2.26216 0.24
NP_442679.1_1 Forward -74 -55 -2.45882 0.24
NP_441959.1_8 Forward -399 -386 8.61288 0.286
NP_442456.1_5 Forward -335 -317 6.80398 0.26
NP_442532.1_1 Forward -85 -71 11.5713 0.215
NP_442203.1_1 Forward -82 -68 14.8129 0.228
NP_441028.1_6 Reverse -294 -304 14.6309 0.158
NP_440116.1_8 Forward -44 -25 -5.70374 0.194
NP_441527.1_4 Forward -68 -49 13.9891 0.0458
NP_441527.1_4 Forward -65 -46 12.6523 0.0458
NP_441527.1_4 Forward -72 -53 9.97848 0.0593
NP_441527.1_4 Forward -71 -52 5.49036 0.106
NP_441527.1_4 Forward -78 -59 3.77151 0.111
NP_441527.1_4 Forward -69 -50 1.76618 0.131
NP_441527.1_4 Forward -171 -152 -1.09858 0.146
NP_441527.1_4 Forward -172 -153 -1.28956 0.146
NP_441527.1_4 Forward -169 -150 -1.67153 0.148
NP_441527.1_4 Forward -75 -56 -3.29489 0.164
NP_441527.1_4 Forward -168 -149 -4.15432 0.179
NP_441527.1_4 Forward -80 -61 -4.72727 0.188
NP_441527.1_4 Forward -74 -55 -7.59203 0.235
NP_441527.1_4 Forward -81 -62 -9.88384 0.262
NP_441527.1_4 Forward -170 -151 -11.5072 0.282
NP_441527.1_4 Forward -67 -48 -11.7937 0.284
NP_441527.1_4 Forward -309 -290 -12.1756 0.285
NP_441527.1_4 Forward -70 -51 -12.3666 0.285
NP_441527.1_4 Forward -84 -65 -12.7486 0.293
NP_441527.1_4 Forward -66 -47 -13.1306 0.298
NP_439965.1_1 Reverse -137 -156 -10.4236 0.3
NP_442673.1_5 Reverse -275 -293 11.4255 0.272
NP_441106.1_7 Forward -138 -119 13.0766 0.205
NP_441825.1_4 Reverse -146 -156 12.5664 0.249
NP_442463.1_3 Reverse -316 -335 10.0292 0.275
NP_440404.1_9 Forward -84 -65 10.265 0.209
NP_442842.1_10 Reverse -49 -68 1.63036 0.254
NP_442842.1_10 Reverse -64 -83 0.950819 0.254
NP_441460.1_1 Forward -71 -52 14.4492 0.228
NP_441401.1_4 Forward -60 -47 16.2439 0.131
NP_440855.1_3 Reverse -165 -184 9.63507 0.185
NP_440082.1_5 Reverse -53 -72 15.3242 0.256
NP_442805.1_6 Forward -338 -319 1.86774 0.292
NP_440114.1_10 Forward -357 -343 7.37441 0.236
NP_442357.1_8 Forward -37 -18 5.60432 0.241
NP_442324.1_7 Forward -369 -350 6.24429 0.268
NP_440766.1_5 Forward -303 -291 7.65579 0.288
NP_440278.1_1 Forward -145 -126 9.53756 0.155
NP_440213.1_4 Reverse -275 -294 15.6421 0.217
NP_442680.1_5 Forward -232 -213 1.73297 0.237
NP_441436.1_8 Forward -182 -163 7.07928 0.293
NP_441496.1_1 Reverse -285 -299 14.3354 0.265
NP_440185.1_9 Forward -115 -98 11.9369 0.264
NP_440628.1_1 Forward -66 -56 14.6456 0.248
NP_442703.1_9 Forward -70 -52 4.73903 0.244
NP_442341.1_5 Forward -224 -205 15.0441 0.182
NP_440191.1_6 Reverse -384 -398 13.1895 0.294
NP_443046.1_9 Forward -41 -23 6.99988 0.168
NP_441397.1_8 Forward -303 -290 15.8179 0.142
NP_441902.1_3 Forward -303 -293 13.0789 0.23
NP_442451.1_7 Forward -273 -254 8.65258 0.26
NP_441190.1_2 Forward -295 -276 4.03102 0.17
NP_441207.1_7 Forward -78 -64 15.0642 0.179
NP_441207.1_7 Forward -63 -49 11.5789 0.241
NP_440175.1_4 Forward -113 -94 -11.9969 0.215
NP_440216.1_9 Forward -198 -189 5.50626 0.292
NP_441064.1_4 Reverse -177 -196 7.07928 0.276
NP_440117.1_7 Forward -262 -248 17.9942 0.0592
NP_442116.1_6 Forward -178 -161 12.5616 0.172
NP_442116.1_6 Reverse -383 -400 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTTAATGTAAAATTATGGGGTGTACAAAATGAACAGGTTTAAACAATGGCTTACAGTTTAGATTTAAGGCAAAGGGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAACAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGTCGTATATTACGCATTAAAGAAAATGAAAATAAACAGAAAAAAAAAGAACTACGTTATCGAGAAAGAAACCGGGAGGAACGAGTTAAGTACTATAGA

CDS

ATGTTAAGAGAACTAATCAAGCTCTATGGTAGTCAAGCTATAGTTTACATAGATGAATCTGGATTCGAAGCAATCCAGGCTTGTATTTATGCCTGGTCAAAAAAAGGAAAAAAAGTTTATGGAGATAGACAAGGAAAAAGGGGAGTCAGAGAAAATCTAGTAGCAGGGAGAAGAAAAGGAAAAAAAGATTTGATTGCACCGATGGTTTTTACTGGGAGTTTGAATGCAGAAGGCTTTGAAGGATGGTTAAAATTATATTTACTACCCTCCCTCGACATTCCATCAATATTAATAATGGATAATGCTCCTATTCATCGTAAAACTGCCATTAAAGAATTGGCTAAAGAAGCAGGTCATGAAGTTCTTTTTTTGCCGAAATATTCTCCTGATTTAAATGATATTGAGCATGACTTTAGTGCCTTGAAACGAGCTAGAATGTACGCTCCTATTGACACGTCTCTTGATGAAATTATCCGTTCTTACTGTGGCGTTTAG

Protein

MLRELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQGKRGVRENLVAGRRKGKKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNAPIHRKTAIKELAKEAGHEVLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRSYCGV