Your browser is old and dusty. Try Google Chrome!

Details for sll0624

ORF sll0624
Accession NP_442870.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -328 -321 14.6904 0.0123
NP_440795.1_7 Reverse -321 -328 14.6904 0.0123
NP_442272.1_9 Reverse -133 -151 17.1279 0.0923
NP_441453.1_4 Reverse -320 -328 16.6374 0.00633
NP_441453.1_4 Forward -329 -321 16.539 0.00633
NP_441453.1_7 Reverse -339 -346 13.4121 0.23
NP_442151.1_6 Forward -204 -190 9.14437 0.157
NP_441818.1_1 Reverse -321 -332 14.0211 0.0577
NP_440226.1_1 Forward -329 -310 12.1925 0.0465
NP_440226.1_1 Reverse -320 -339 8.84924 0.0817
NP_441630.1_3 Forward -337 -318 6.58763 0.126
NP_441976.1_2 Reverse -271 -290 13.3716 0.257
NP_442173.1_1 Forward -328 -320 17.3257 0.00633
NP_442173.1_1 Reverse -321 -329 15.4574 0.00633
NP_442752.1_4 Forward -329 -322 13.8055 0.0199
NP_443027.1_4 Reverse -318 -328 16.303 0.0437
NP_443027.1_4 Forward -331 -321 6.46988 0.275
NP_439997.1_4 Forward -119 -100 10.0292 0.189
NP_441812.1_3 Forward -330 -316 7.76774 0.263
NP_442975.1_10 Reverse -316 -330 12.8803 0.0459
NP_442975.1_10 Forward -365 -351 1.67063 0.293
NP_441225.1_2 Reverse -40 -59 7.86593 0.152
NP_440784.1_7 Forward -328 -321 15.9687 0.0123
NP_440784.1_7 Reverse -321 -328 15.9687 0.0123
NP_442909.1_7 Reverse -321 -335 10.3237 0.14
NP_440061.1_9 Reverse -318 -332 17.8952 0.0117
NP_442062.1_8 Forward -329 -319 19.1546 0.00121
NP_442062.1_8 Reverse -320 -330 15.2213 0.00881
NP_441859.1_3 Reverse -319 -338 10.0284 0.121
NP_440304.1_4 Forward -331 -321 17.9746 0.00654
NP_442242.1_4 Forward -328 -321 14.3954 0.0124
NP_442242.1_4 Reverse -321 -328 14.3954 0.0124
NP_440044.1_8 Reverse -321 -340 -1.18052 0.238
NP_439918.1_2 Forward -66 -47 -3.14714 0.251
NP_441935.1_7 Forward -336 -317 7.07928 0.236
NP_441208.1_9 Forward -332 -318 4.62115 0.297
NP_442742.1_9 Reverse -94 -113 -11.3086 0.269
NP_442742.1_9 Reverse -95 -114 -12.5869 0.269
NP_442110.1_7 Reverse -320 -334 1.17956 0.236
NP_442896.1_7 Forward -161 -142 8.65258 0.0865
NP_441083.1_5 Reverse -320 -330 10.1081 0.0208
NP_441083.1_5 Forward -329 -319 1.55333 0.204
NP_442827.1_8 Forward -337 -318 3.63691 0.144
NP_442115.2_7 Reverse -321 -338 6.13536 0.24
NP_441434.1_7 Reverse -322 -336 5.99778 0.225
NP_441738.1_2 Reverse -322 -329 15.28 0.0102
NP_441738.1_2 Forward -327 -320 11.5435 0.084
NP_441738.1_2 Reverse -107 -114 8.29857 0.176
NP_441645.1_6 Forward -163 -149 11.897 0.241
NP_440209.1_1 Forward -329 -321 18.1123 0.00295
NP_440209.1_1 Reverse -320 -328 8.57422 0.0425
NP_441713.1_1 Forward -335 -316 -14.1602 0.257
NP_440178.1_7 Reverse -319 -338 -19.9617 0.182
NP_440178.1_7 Forward -330 -311 -22.6167 0.268
NP_440053.1_2 Forward -122 -103 10.0292 0.291
NP_440331.1_5 Reverse -76 -95 -8.85033 0.142
NP_440906.1_5 Forward -328 -321 15.8704 0.0124
NP_440906.1_5 Reverse -321 -328 15.8704 0.0124
NP_440747.1_10 Forward -332 -320 -11.7607 0.142
NP_440747.1_10 Reverse -317 -329 -11.7607 0.142
NP_441130.1_10 Reverse -318 -332 12.7826 0.0843
NP_441486.1_1 Reverse -317 -331 12.1926 0.0129
NP_441486.1_1 Forward -332 -318 3.34284 0.0619
NP_441880.2_10 Forward -328 -310 12.4089 0.128
NP_442634.1_4 Forward -331 -317 4.91614 0.0699
NP_441265.1_3 Forward -335 -321 2.65453 0.189
NP_441639.1_3 Reverse -319 -338 15.7324 0.0292
NP_442760.1_8 Reverse -311 -330 23.4022 0.0137
NP_442848.1_1 Forward -335 -321 -2.95034 0.263
NP_443018.1_3 Forward -328 -321 14.8871 0.0123
NP_443018.1_3 Reverse -321 -328 14.8871 0.0123
NP_440376.1_1 Reverse -320 -329 9.73449 0.0365
NP_440376.1_1 Forward -329 -320 9.63616 0.0385
NP_441857.1_5 Forward -336 -318 10.5406 0.185
NP_441857.1_5 Reverse -313 -331 2.47742 0.266
NP_441588.1_4 Forward -327 -317 7.64985 0.178
NP_442687.1_7 Forward -330 -320 17.5813 0.0089
NP_442687.1_7 Reverse -319 -329 6.27322 0.175
NP_441422.1_7 Reverse -318 -335 -1.82945 0.194
NP_440181.1_2 Reverse -139 -157 8.47561 0.297
NP_440533.1_9 Forward -329 -310 11.3075 0.114
NP_440667.1_4 Forward -274 -255 15.8307 0.202
NP_442658.1_1 Forward -331 -321 17.6791 0.00565
NP_442658.1_1 Reverse -318 -328 15.0242 0.0188
NP_442782.1_2 Forward -329 -315 1.17956 0.282
NP_440669.1_6 Reverse -331 -350 18.0924 0.129
NP_442205.1_9 Forward -335 -319 1.04184 0.255
NP_440656.1_8 Reverse -309 -328 3.83436 0.11
NP_441487.1_9 Forward -330 -311 8.55425 0.102
NP_441958.1_5 Forward -330 -320 19.2529 0.00183
NP_441958.1_5 Reverse -319 -329 2.53664 0.0409
NP_442836.1_5 Forward -335 -316 2.0644 0.269
NP_439905.1_1 Reverse -321 -334 9.85238 0.216
NP_443001.1_5 Reverse -35 -54 11.0125 0.252
NP_440984.1_7 Forward -334 -320 7.86607 0.161
NP_440984.1_7 Reverse -150 -164 4.91614 0.281
NP_441162.1_3 Forward -163 -144 11.5042 0.198
NP_441097.1_2 Reverse -145 -162 7.90532 0.238
NP_442690.1_1 Forward -318 -299 -15.4385 0.28
NP_442690.1_1 Forward -240 -221 -16.5201 0.289
NP_442911.1_2 Forward -339 -320 -8.16202 0.228
NP_442911.1_2 Forward -295 -276 -11.0136 0.296
NP_440153.1_8 Reverse -320 -333 3.5592 0.21
NP_442536.1_8 Forward -335 -316 12.6841 0.251
NP_443055.1_6 Forward -361 -343 -0.964891 0.271
NP_440993.1_2 Reverse -315 -331 3.00846 0.262
NP_440602.1_8 Forward -329 -315 10.6193 0.265
NP_443044.1_1 Forward -142 -123 2.75272 0.295
NP_442002.1_1 Reverse -145 -163 -0.570838 0.192
NP_442002.1_1 Forward -154 -136 -9.51896 0.281
NP_442002.1_9 Forward -330 -323 14.1004 0.074
NP_440809.1_9 Reverse -311 -329 -8.04399 0.225
NP_441294.1_7 Reverse -316 -330 9.25063 0.256
NP_441646.1_1 Forward -292 -273 0.786102 0.243
NP_442438.1_10 Reverse -315 -329 0.786239 0.213
NP_440377.1_1 Forward -132 -115 15.139 0.181
NP_442231.1_1 Forward -156 -137 7.47261 0.236
NP_441000.1_6 Forward -330 -316 13.9626 0.0396
NP_441000.1_6 Reverse -319 -333 -4.4253 0.243
NP_440605.1_6 Reverse -301 -320 18.6964 0.235
NP_442870.1_1 Forward -288 -269 21.8289 0.0306
NP_442870.1_2 Forward -361 -345 19.0364 0.297
NP_442870.1_3 Forward -338 -320 21.8486 0.0434
NP_442870.1_4 Forward -234 -220 14.5526 0.289
NP_442870.1_5 Forward -265 -246 25.7622 0.00515
NP_440147.1_4 Reverse -318 -331 11.0324 0.0341
NP_440147.1_4 Forward -331 -318 0.60927 0.249
NP_441550.1_8 Forward -331 -321 19.8424 0.00352
NP_441916.1_7 Reverse -320 -330 17.5813 0.00295
NP_441916.1_7 Forward -329 -319 16.4013 0.00539
NP_441041.1_7 Reverse -317 -329 10.0414 0.103
NP_441041.1_7 Forward -332 -320 9.26397 0.117
NP_442004.1_6 Reverse -320 -334 12.4876 0.104
NP_441725.1_5 Reverse -321 -331 18.7612 0.0119
NP_441725.1_5 Forward -328 -318 2.24165 0.115
NP_439966.1_7 Reverse -318 -328 10.206 0.0958
NP_439966.1_7 Forward -331 -321 8.14104 0.14
NP_439966.1_9 Forward -331 -322 0.983037 0.253
NP_439966.1_9 Reverse -318 -327 0.983037 0.253
NP_439966.1_9 Forward -254 -245 0.491382 0.288
NP_440736.1_3 Forward -331 -312 -1.08219 0.282
NP_442941.1_3 Forward -328 -318 8.92815 0.0326
NP_442941.1_3 Reverse -321 -331 2.43831 0.14
NP_440289.1_2 Reverse -317 -330 15.2606 0.0107
NP_440289.1_2 Forward -332 -319 -4.50394 0.288
NP_442281.1_1 Reverse -315 -329 12.5853 0.0358
NP_442281.1_1 Forward -334 -320 5.01387 0.172
NP_440437.1_1 Reverse -314 -333 9.43923 0.0507
NP_440498.1_1 Reverse -234 -252 -3.42244 0.261
NP_441644.1_6 Reverse -320 -330 13.3526 0.0203
NP_442029.1_10 Forward -162 -143 5.11266 0.287
NP_440253.1_2 Forward -329 -311 12.5072 0.0276
NP_440929.1_8 Reverse -320 -329 9.93116 0.0249
NP_440929.1_8 Forward -329 -320 9.83282 0.0254
NP_442933.1_10 Forward -329 -320 17.601 0.00325
NP_442933.1_10 Reverse -320 -329 17.601 0.00325
NP_441751.2_8 Reverse -321 -335 -5.21195 0.199
NP_442926.1_5 Forward -334 -315 14.5416 0.15
NP_442554.1_8 Reverse -321 -331 16.9913 0.0065
NP_442554.1_8 Forward -328 -318 4.20827 0.193
NP_442970.1_1 Forward -302 -288 9.46532 0.272
NP_441762.1_7 Reverse -319 -331 13.5103 0.0142
NP_441762.1_7 Forward -330 -318 3.97222 0.0602
NP_442142.1_4 Forward -332 -319 5.0336 0.204
NP_442142.1_4 Reverse -317 -330 2.28034 0.295
NP_442292.1_1 Reverse -321 -330 9.53783 0.0183
NP_442292.1_1 Forward -328 -319 0.688044 0.23
NP_442476.1_6 Reverse -321 -335 13.0776 0.0454
NP_442016.1_10 Reverse -144 -163 7.17762 0.259
NP_442381.1_8 Reverse -317 -336 -13.5702 0.276
NP_441711.1_4 Reverse -329 -348 5.50599 0.173
NP_443009.1_5 Forward -330 -319 19.5276 0.00172
NP_443009.1_5 Reverse -319 -330 5.07306 0.218
NP_441865.1_2 Forward -143 -126 17.2035 0.287
NP_442408.2_1 Reverse -320 -339 -6.09707 0.282
NP_441715.1_4 Forward -328 -318 15.0247 0.0268
NP_441198.1_8 Forward -331 -321 15.2245 0.0427
NP_441468.1_1 Forward -328 -321 15.8704 0.0124
NP_441468.1_1 Reverse -321 -328 15.8704 0.0124
NP_441673.1_1 Reverse -320 -329 11.1111 0.0121
NP_441673.1_1 Forward -329 -320 11.0128 0.018
NP_441876.1_9 Forward -169 -159 10.5993 0.287
NP_442868.1_6 Forward -331 -321 16.7946 0.0131
NP_442719.1_2 Reverse -126 -144 -10.6013 0.278
NP_441251.1_8 Reverse -206 -219 13.7171 0.254
NP_441612.1_2 Reverse -310 -320 8.25885 0.228
NP_442808.1_1 Reverse -319 -329 9.91099 0.0481
NP_442808.1_1 Forward -167 -157 5.78111 0.141
NP_440145.1_3 Reverse -310 -329 -1.67217 0.154
NP_442542.1_2 Forward -331 -318 11.9173 0.114
NP_442050.1_5 Forward -331 -321 14.9258 0.0175
NP_442050.1_5 Reverse -318 -328 8.23937 0.234
NP_440558.1_2 Forward -169 -150 -6.1954 0.272
NP_440111.2_1 Forward -342 -323 10.8159 0.15
NP_441518.1_3 Forward -339 -320 -12.7836 0.263
NP_441878.1_6 Forward -330 -320 10.4031 0.0176
NP_441878.1_6 Reverse -319 -329 0.668351 0.139
NP_441036.1_8 Reverse -319 -329 17.4829 0.0012
NP_441557.1_5 Forward -329 -320 18.6826 0.0015
NP_441557.1_5 Reverse -320 -329 10.5211 0.00695
NP_441557.1_8 Forward -163 -153 14.0409 0.201
NP_441557.1_8 Reverse -136 -146 11.9759 0.236
NP_441445.1_1 Forward -338 -319 5.30933 0.172
NP_441445.1_1 Reverse -311 -330 2.85105 0.226
NP_440762.1_9 Forward -176 -160 13.8249 0.239
NP_442183.1_1 Reverse -320 -334 11.8976 0.0663
NP_441238.1_10 Forward -154 -140 9.73436 0.292
NP_442347.1_2 Reverse -271 -280 3.83464 0.284
NP_442347.1_2 Reverse -321 -330 3.34298 0.284
NP_441037.1_4 Forward -331 -321 18.9151 0.00351
NP_442317.1_6 Reverse -315 -334 2.0644 0.293
NP_441633.1_3 Reverse -318 -331 8.08242 0.0398
NP_442764.1_3 Reverse -194 -204 15.5163 0.295
NP_440136.1_2 Forward -328 -321 15.9687 0.0123
NP_440136.1_2 Reverse -321 -328 15.9687 0.0123
NP_442998.1_10 Reverse -322 -329 15.5754 0.0102
NP_442998.1_10 Forward -327 -320 5.74231 0.255
NP_440299.1_1 Forward -333 -320 6.70522 0.133
NP_441799.1_1 Forward -333 -319 16.8135 0.0129
NP_442528.1_10 Reverse -185 -204 19.3707 0.156
NP_441007.1_10 Forward -334 -321 11.524 0.064
NP_440256.1_1 Reverse -317 -336 -6.39206 0.21
NP_440087.1_9 Forward -360 -341 16.3215 0.145
NP_440915.1_6 Reverse -316 -330 2.75286 0.112
NP_440915.1_6 Forward -289 -275 -1.37704 0.233
NP_442069.1_4 Reverse -309 -328 15.6341 0.192
NP_440134.1_2 Forward -307 -288 0.786102 0.298
NP_442866.1_1 Forward -257 -238 -5.31042 0.24
NP_441464.1_8 Reverse -320 -334 12.0943 0.177
NP_441939.1_3 Reverse -321 -340 11.5042 0.112
NP_441494.1_6 Forward -334 -321 11.7207 0.225
NP_442993.1_1 Forward -329 -313 21.888 0.00255
NP_442386.1_9 Reverse -319 -328 16.7155 0.0144
NP_442386.1_9 Forward -330 -321 6.39082 0.219
NP_442386.1_10 Reverse -155 -168 14.6706 0.107
NP_441340.1_5 Forward -328 -321 15.6737 0.0124
NP_441340.1_5 Reverse -321 -328 15.6737 0.0124
NP_441254.1_1 Forward -135 -122 18.4065 0.119
NP_440211.1_4 Forward -116 -106 13.5497 0.296
NP_440586.1_8 Forward -328 -321 13.2151 0.026
NP_440586.1_8 Reverse -321 -328 13.2151 0.026
NP_442251.1_6 Forward -328 -321 15.2804 0.0124
NP_442251.1_6 Reverse -321 -328 15.2804 0.0124
NP_441262.1_3 Forward -329 -322 14.7888 0.0223
NP_441262.1_3 Reverse -320 -327 13.9038 0.0336
NP_443051.1_1 Forward -330 -321 18.0926 0.00402
NP_443051.1_1 Reverse -319 -328 1.08137 0.123
NP_441232.1_10 Forward -340 -321 1.0811 0.289
NP_439984.1_7 Reverse -137 -155 -4.40575 0.292
NP_439937.1_9 Forward -167 -150 -1.04349 0.122
NP_439937.1_9 Reverse -319 -336 -6.35334 0.157
NP_439937.1_9 Forward -330 -313 -17.0714 0.291
NP_440398.1_6 Reverse -136 -155 3.04771 0.294
NP_440398.1_6 Reverse -105 -124 2.65439 0.294
NP_441665.1_2 Forward -40 -21 7.86593 0.265
NP_440439.1_1 Forward -332 -319 11.6223 0.032
NP_440439.1_1 Reverse -317 -330 0.60927 0.182
NP_440372.1_2 Forward -328 -321 16.3621 0.0124
NP_440372.1_2 Reverse -321 -328 16.3621 0.0124
NP_440316.1_10 Reverse -156 -166 8.53483 0.239
NP_439977.1_5 Reverse -314 -333 -2.85214 0.29
NP_440139.1_1 Forward -335 -316 4.22689 0.189
NP_442384.1_10 Reverse -320 -333 4.05085 0.17
NP_442114.1_4 Reverse -320 -331 10.1868 0.17
NP_442262.1_10 Forward -328 -321 14.1988 0.0123
NP_442262.1_10 Reverse -321 -328 14.1988 0.0123
NP_441689.1_5 Reverse -318 -328 10.796 0.132
NP_440163.1_10 Reverse -317 -327 11.3864 0.169
NP_440344.1_10 Forward -336 -319 -4.48438 0.097
NP_440344.1_10 Reverse -313 -330 -5.36936 0.106
NP_441335.1_8 Reverse -343 -362 8.06259 0.264
NP_440297.1_9 Reverse -321 -331 9.51814 0.0917
NP_440297.1_9 Forward -328 -318 0.766681 0.282
NP_440999.1_9 Reverse -316 -330 2.65453 0.146
NP_440888.1_2 Forward -329 -315 11.1104 0.0757
NP_440888.1_2 Reverse -320 -334 6.48882 0.232
NP_442892.1_9 Forward -217 -203 11.4053 0.296
NP_441543.1_2 Forward -328 -319 15.4377 0.00784
NP_441543.1_2 Reverse -321 -330 9.34117 0.0818
NP_441543.1_3 Forward -167 -153 12.3887 0.163
NP_441543.1_3 Reverse -101 -115 10.3237 0.212
NP_442845.1_2 Forward -335 -321 5.21113 0.24
NP_442845.1_4 Forward -331 -312 18.289 0.0929
NP_441551.1_5 Forward -333 -317 9.30094 0.21
NP_441469.1_8 Forward -330 -321 13.3727 0.073
NP_441469.1_8 Reverse -319 -328 8.06287 0.227
NP_441548.1_2 Reverse -307 -326 15.4374 0.212
NP_443064.1_3 Reverse -141 -160 8.16093 0.208
NP_443064.1_3 Reverse -140 -159 6.78429 0.259
NP_443064.1_6 Reverse -320 -330 11.0156 0.13
NP_443064.1_7 Forward -249 -230 19.0511 0.229
NP_442337.1_8 Forward -29 -10 -0.590531 0.276
NP_442578.1_7 Forward -328 -321 14.5921 0.026
NP_442578.1_7 Reverse -321 -328 14.5921 0.026
NP_441462.1_2 Forward -329 -319 10.5998 0.0068
NP_441462.1_2 Reverse -320 -330 10.4031 0.011
NP_441462.1_5 Reverse -342 -361 0.0977854 0.297
NP_441621.1_7 Forward -331 -317 -3.44199 0.188
NP_441621.1_7 Forward -254 -240 -5.90027 0.267
NP_443062.1_1 Forward -329 -311 10.0085 0.122
NP_441560.1_5 Reverse -307 -326 15.5357 0.216
NP_440516.1_6 Forward -261 -247 9.24208 0.238
NP_440516.1_8 Forward -329 -320 9.4395 0.0183
NP_440516.1_8 Reverse -320 -329 7.17789 0.0754
NP_442428.1_5 Forward -328 -321 15.8704 0.0124
NP_442428.1_5 Reverse -321 -328 15.8704 0.0124
NP_442120.1_2 Forward -84 -65 16.5191 0.274
NP_440673.1_3 Forward -327 -320 14.0021 0.0426
NP_440673.1_3 Reverse -322 -329 12.4288 0.0426
NP_440718.1_2 Forward -295 -276 11.2092 0.274
NP_440865.1_9 Reverse -314 -333 -2.55715 0.184
NP_440865.1_9 Forward -335 -316 -8.752 0.269
NP_441052.1_2 Reverse -320 -330 1.94665 0.221
NP_441052.1_2 Forward -329 -319 0.668351 0.256
NP_442219.1_9 Forward -328 -319 9.04618 0.0681
NP_442219.1_9 Reverse -321 -330 8.25953 0.0681
NP_440436.1_4 Forward -328 -319 16.9122 0.00357
NP_440436.1_4 Reverse -321 -330 15.9289 0.00508
NP_441884.1_9 Reverse -317 -336 -22.0267 0.275
NP_442907.1_2 Reverse -321 -339 14.9655 0.169
NP_441719.1_4 Forward -328 -321 16.3621 0.0124
NP_441719.1_4 Reverse -321 -328 16.3621 0.0124
NP_441733.1_10 Forward -332 -319 11.6223 0.106
NP_441733.1_10 Reverse -317 -330 6.60746 0.179
NP_441004.1_1 Forward -120 -101 -15.0452 0.271
NP_441004.1_4 Reverse -192 -202 8.82982 0.263
NP_441004.1_5 Reverse -151 -165 7.27608 0.292
NP_442813.1_4 Reverse -139 -158 -8.752 0.299
NP_442813.1_4 Reverse -138 -157 -9.047 0.299
NP_442366.1_3 Forward -330 -312 -1.55415 0.215
NP_443054.1_2 Reverse -318 -332 0.491246 0.262
NP_441851.1_10 Forward -330 -320 18.6629 0.0027
NP_441851.1_10 Reverse -319 -329 6.76487 0.156
NP_442622.1_8 Reverse -320 -338 -9.0273 0.138
NP_441668.1_5 Reverse -343 -362 9.63589 0.225
NP_442515.1_1 Reverse -319 -333 3.44117 0.119
NP_442689.1_8 Reverse -288 -305 -7.53264 0.292
NP_441349.1_10 Reverse -310 -329 -3.3438 0.139
NP_440155.1_3 Reverse -171 -190 8.84924 0.225
NP_440432.1_9 Reverse -321 -336 8.53469 0.0427
NP_442843.1_1 Forward -120 -101 -1.18052 0.192
NP_440474.1_8 Forward -328 -314 7.17714 0.207
NP_440474.1_8 Reverse -321 -335 5.99717 0.235
NP_440474.1_8 Reverse -382 -396 4.62054 0.271
NP_441124.1_5 Forward -309 -299 10.7163 0.286
NP_442450.1_5 Forward -331 -321 10.1081 0.115
NP_442168.1_5 Reverse -321 -340 0.884433 0.241
NP_439950.1_1 Forward -115 -106 16.0277 0.145
NP_442006.1_2 Forward -338 -321 -17.2674 0.271
NP_442006.1_2 Reverse -157 -174 -17.4641 0.276
NP_440483.1_1 Forward -157 -138 0.392778 0.193
NP_440483.1_1 Forward -126 -107 -2.75381 0.208
NP_441570.1_1 Reverse -320 -338 -16.6971 0.252
NP_441078.1_4 Reverse -320 -329 9.93116 0.0203
NP_441078.1_4 Forward -329 -320 9.83282 0.0226
NP_442348.1_2 Reverse -123 -132 7.47288 0.28
NP_441094.1_6 Reverse -313 -330 9.37954 0.261
NP_440526.1_3 Reverse -321 -332 11.3662 0.0646
NP_440526.1_3 Forward -360 -349 6.54802 0.195
NP_441432.1_8 Forward -330 -321 8.35786 0.0755
NP_442320.1_8 Reverse -314 -328 15.1426 0.011
NP_442320.1_8 Forward -335 -321 8.35772 0.0184
NP_441732.1_2 Reverse -316 -332 -16.2644 0.165
NP_440760.1_1 Reverse -320 -339 -4.72043 0.0465
NP_440760.1_7 Forward -142 -123 7.4718 0.192
NP_440760.1_7 Reverse -85 -104 2.6536 0.281
NP_441072.1_2 Forward -340 -321 5.50599 0.296
NP_442400.1_1 Forward -332 -313 -5.60541 0.299
NP_442400.1_10 Forward -304 -291 15.054 0.173
NP_440713.1_4 Forward -339 -320 2.16274 0.27
NP_442489.1_7 Reverse -320 -329 10.4228 0.0151
NP_442489.1_7 Forward -329 -320 10.3245 0.0193
NP_442079.1_7 Reverse -321 -340 1.37609 0.253
NP_440559.1_1 Reverse -321 -330 17.306 0.00658
NP_440559.1_1 Forward -328 -319 8.84951 0.0586
NP_441659.2_8 Reverse -320 -330 17.0896 0.00284
NP_441659.2_8 Forward -329 -319 2.33998 0.205
NP_440779.1_5 Reverse -320 -337 4.75873 0.0372
NP_442346.1_5 Forward -330 -320 17.4829 0.00248
NP_442346.1_5 Reverse -319 -329 6.8632 0.188
NP_442346.1_5 Reverse -194 -204 5.38824 0.248
NP_440545.1_3 Forward -333 -316 -3.5994 0.208
NP_442934.1_1 Reverse -47 -66 11.5042 0.267
NP_442934.1_9 Reverse -203 -221 12.9988 0.282
NP_441833.1_4 Forward -328 -321 15.9687 0.0124
NP_441833.1_4 Reverse -321 -328 15.9687 0.0124
NP_441329.1_6 Reverse -215 -234 -2.81744 0.294
NP_442162.1_9 Forward -328 -321 16.2637 0.0124
NP_442162.1_9 Reverse -321 -328 16.2637 0.0124
NP_440671.1_4 Reverse -314 -328 12.8809 0.0998
NP_442045.1_5 Forward -169 -150 -2.65548 0.294
NP_440204.1_2 Forward -308 -289 20.054 0.165
NP_442140.1_3 Reverse -321 -331 14.828 0.0433
NP_442140.1_3 Forward -328 -318 8.04317 0.124
NP_441813.1_5 Reverse -318 -328 16.4013 0.01
NP_441813.1_5 Forward -331 -321 8.92815 0.0347
NP_440590.1_4 Reverse -321 -334 3.16588 0.0756
NP_440590.1_4 Forward -328 -315 -4.60227 0.263
NP_440590.1_7 Forward -123 -109 15.3392 0.253
NP_440567.1_1 Reverse -321 -335 13.9626 0.0194
NP_440567.1_1 Forward -328 -314 1.47456 0.204
NP_442497.1_10 Reverse -321 -330 19.8626 0.00532
NP_442497.1_10 Forward -328 -319 8.55452 0.0294
NP_440821.1_4 Forward -331 -321 19.5479 0.00399
NP_440821.1_4 Reverse -318 -328 10.3048 0.0163
NP_440227.1_2 Forward -384 -368 11.7599 0.271
NP_441239.1_9 Reverse -318 -330 15.2803 0.0217
NP_441239.1_9 Forward -331 -319 12.9203 0.0402
NP_441239.1_9 Forward -168 -156 8.6921 0.125
NP_441727.1_3 Forward -336 -317 6.98095 0.238
NP_441892.1_1 Forward -338 -321 6.23369 0.0995
NP_442669.1_1 Forward -186 -167 9.73422 0.0338
NP_442669.1_1 Reverse -72 -91 9.53756 0.0355
NP_442643.1_3 Reverse -107 -126 -8.45701 0.295
NP_441017.1_6 Reverse -316 -330 13.4703 0.192
NP_440833.1_6 Forward -356 -342 7.07881 0.289
NP_442216.1_4 Reverse -106 -114 8.1805 0.255
NP_440546.1_4 Reverse -320 -330 13.6334 0.0459
NP_440546.1_4 Forward -329 -319 13.5365 0.0459
NP_440462.1_6 Reverse -318 -328 14.7297 0.0186
NP_440462.1_6 Forward -331 -321 10.4031 0.0396
NP_440868.1_4 Forward -333 -321 10.0687 0.0405
NP_440868.1_4 Reverse -316 -328 0.530633 0.21
NP_441868.1_4 Forward -286 -272 12.9793 0.282
NP_442402.1_4 Reverse -281 -300 -4.03287 0.22
NP_442402.1_4 Reverse -97 -116 -5.99948 0.249
NP_442882.1_8 Forward -116 -97 12.2908 0.145
NP_442039.1_4 Forward -328 -321 15.1821 0.0124
NP_442039.1_4 Reverse -321 -328 15.1821 0.0124
NP_440232.1_2 Forward -243 -224 5.70265 0.171
NP_442829.1_2 Reverse -207 -223 18.9641 0.12
NP_440825.1_7 Reverse -79 -89 12.5193 0.155
NP_442696.1_6 Forward -169 -150 6.39097 0.051
NP_442696.1_6 Reverse -99 -118 -11.7019 0.235
NP_442837.1_3 Forward -328 -321 15.7721 0.0124
NP_442837.1_3 Reverse -321 -328 15.7721 0.0124
NP_442053.1_1 Forward -329 -320 9.24284 0.068
NP_442053.1_1 Reverse -320 -329 8.94785 0.07
NP_440505.1_3 Forward -331 -321 7.84651 0.147
NP_440351.1_1 Forward -162 -143 4.42435 0.0788
NP_440351.1_1 Reverse -137 -156 -3.24547 0.263
NP_440351.1_8 Forward -131 -113 11.4255 0.162
NP_440914.1_1 Reverse -320 -330 7.24882 0.242
NP_441011.1_8 Forward -328 -319 18.191 0.00602
NP_441011.1_8 Reverse -321 -330 14.356 0.0249
NP_442533.1_1 Reverse -147 -166 -15.5368 0.256
NP_442533.1_1 Reverse -146 -165 -16.1268 0.263
NP_442533.1_6 Forward -329 -320 15.1427 0.00675
NP_442533.1_6 Reverse -320 -329 7.47288 0.0898
NP_442541.1_10 Reverse -275 -289 4.8172 0.248
NP_442232.1_3 Forward -337 -318 -11.6036 0.282
NP_441482.1_7 Forward -335 -321 -8.65353 0.193
NP_439944.1_9 Reverse -321 -331 17.4829 0.00423
NP_439944.1_9 Forward -328 -318 8.63316 0.105
NP_441028.1_6 Reverse -138 -148 8.3377 0.216
NP_441028.1_6 Reverse -98 -108 3.8145 0.281
NP_440116.1_8 Forward -328 -309 -1.7705 0.122
NP_440115.1_6 Forward -332 -322 18.2696 0.0139
NP_441972.1_5 Reverse -321 -340 12.7825 0.04
NP_441106.1_1 Reverse -319 -328 17.306 0.00607
NP_441106.1_1 Forward -330 -321 9.73449 0.0311
NP_442588.1_8 Forward -158 -139 6.4893 0.238
NP_442306.1_10 Reverse -315 -334 -20.2567 0.202
NP_441286.1_1 Reverse -319 -331 5.54551 0.0259
NP_441286.1_1 Forward -330 -318 -4.18925 0.152
NP_440670.1_8 Forward -329 -320 8.94785 0.0606
NP_440670.1_8 Reverse -320 -329 8.84951 0.0606
NP_440886.1_7 Reverse -319 -329 9.02601 0.0805
NP_440886.1_7 Forward -165 -155 4.30615 0.243
NP_440907.2_8 Reverse -321 -331 19.449 0.00351
NP_440907.2_8 Forward -328 -318 4.99446 0.228
NP_440907.2_8 Forward -163 -153 4.01116 0.283
NP_441021.1_1 Reverse -321 -340 -9.24366 0.212
NP_441021.1_8 Forward -334 -316 13.1955 0.0938
NP_441463.1_2 Reverse -79 -97 12.1922 0.138
NP_441463.1_3 Forward -339 -320 -10.6203 0.299
NP_441463.1_5 Forward -330 -316 10.3243 0.299
NP_441463.1_6 Reverse -318 -332 5.44959 0.287
NP_441626.1_2 Forward -328 -321 15.7721 0.0124
NP_441626.1_2 Reverse -321 -328 15.7721 0.0124
NP_441988.1_10 Forward -77 -65 18.9185 0.226
NP_442365.1_7 Reverse -272 -291 -6.58872 0.298
NP_442615.1_1 Reverse -311 -329 0.117479 0.107
NP_442615.1_1 Forward -338 -320 -5.38906 0.212
NP_441431.1_2 Forward -332 -318 9.24208 0.19
NP_441431.1_2 Reverse -317 -331 7.66879 0.237
NP_441993.1_1 Forward -335 -316 8.96362 0.136
NP_442805.1_5 Forward -173 -154 -6.49113 0.284
NP_440114.1_10 Reverse -320 -334 17.0108 0.0131
NP_440114.1_10 Forward -329 -315 11.6026 0.107
NP_441552.1_3 Forward -336 -317 19.2715 0.123
NP_440766.1_4 Forward -333 -319 9.2427 0.0871
NP_441237.1_9 Reverse -321 -331 17.2863 0.00348
NP_439910.1_2 Reverse -312 -329 16.1651 0.00114
NP_442867.1_8 Reverse -140 -159 6.88262 0.251
NP_440457.1_1 Forward -333 -321 10.0687 0.092
NP_440457.1_1 Reverse -153 -165 0.0389777 0.25
NP_440798.1_6 Reverse -321 -334 11.4257 0.0614
NP_440054.1_7 Reverse -240 -259 12.2908 0.244
NP_442509.1_9 Reverse -320 -330 7.84605 0.2
NP_442509.1_9 Forward -329 -319 6.86274 0.248
NP_440554.1_4 Forward -328 -318 16.6963 0.0189
NP_440554.1_4 Reverse -321 -331 6.27322 0.123
NP_441885.1_5 Forward -329 -319 10.2065 0.012
NP_441885.1_5 Reverse -320 -330 1.65166 0.106
NP_442341.1_5 Forward -379 -360 14.5524 0.19
NP_441173.1_9 Reverse -139 -147 10.1471 0.261
NP_440423.1_6 Forward -337 -318 -19.8634 0.247
NP_443000.1_7 Reverse -318 -328 8.04317 0.0553
NP_443000.1_7 Forward -331 -321 2.14332 0.226
NP_440507.2_3 Forward -338 -319 7.76679 0.27
NP_441842.1_10 Forward -336 -322 14.6509 0.0547
NP_440275.1_3 Forward -331 -321 19.5479 0.00756
NP_440091.1_1 Reverse -316 -328 20.5902 0.00953
NP_440091.1_1 Forward -333 -321 8.39711 0.0653
NP_440312.1_8 Forward -229 -210 10.4871 0.271
NP_441902.1_3 Forward -148 -138 12.9817 0.23
NP_443010.1_10 Reverse -317 -334 3.73713 0.252
NP_442451.1_2 Reverse -312 -331 -8.752 0.253
NP_441875.1_7 Reverse -121 -131 15.418 0.227
NP_441105.1_3 Forward -340 -321 -6.98204 0.243
NP_440216.1_1 Reverse -320 -334 -3.147 0.0729
NP_440216.1_1 Forward -329 -315 -3.44199 0.082
NP_440172.1_1 Forward -329 -319 10.9931 0.0445
NP_440172.1_1 Reverse -320 -330 6.56821 0.102
NP_441226.1_7 Forward -328 -321 14.4934 0.0123
NP_441226.1_7 Reverse -321 -328 14.4934 0.0123
NP_440305.1_1 Reverse -207 -221 17.3912 0.133
NP_441111.1_7 Reverse -321 -329 18.7023 0.00294
NP_441111.1_7 Forward -328 -320 8.86921 0.0589
NP_441766.1_2 Forward -329 -320 17.896 0.00297
NP_441766.1_2 Reverse -320 -329 9.4395 0.0285
NP_440416.1_1 Forward -329 -310 -11.7019 0.272
NP_443052.1_8 Reverse -310 -329 12.3892 0.0125
NP_443052.1_8 Forward -339 -320 -12.3902 0.254
NP_440261.1_5 Reverse -321 -334 7.00078 0.0316
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAAGTAAACTGCCTTTGATTTTAAGCCCAACTACAGTGAACTATCCCAACTTGCCCAGTGACTCTGAGGGGGCGATCGCTGTTTAACCCCTGATTAAATTTGATGATAAAGTGCTGGAATGGGCTTCAAACCGTACTCCACTCTTGCCGTGATAGAGTTGAGACTTATTGATATGAATTGTTTTCCAGTTTTTAATGTCATTACCCCAAGTCGTTAGAGTCTGTTTTAAATGCCCCCCTAGCCCCCCAAGTTTGGGGGGAAAGTATTAAAAGTCCCCCAGTATTGGGGGATTTAGGGGGCAAAATACAACTTTGCAAACAAGCTATTATTGCTGGATTAAGGTCTAGGCGTGGTAGTTCGTTTAGGTTACTTACCCTGGTTGGTACAGAGCAATTTGAC

CDS

ATGCACTTGTCAGTCCCTTTACTGCTCGAATACGAAGAAGTTTTACTACGGGAATTGCCGAACCTTTACTTGAGTTCTGAAGAAGTTGGTGAATTAATTGATTTCTACTGTGCAGTAGGAATACGACATGAAATTTTCTTTCTTTGGCGACCTTTCCTACGTGATCCCAAAGATGAAATGGTGTTAGAGCTTGCCGTCAAAGCGGGCTGTCAGACTATAATCACCTATAACGCTCGTGATTTTGTCGGCGTAGAGCAGTTTGGGTTAAATGTCCTGGAGCCTTCAGAGTTTTTACGCGTAATAGGAAAGTTGCCATGA

Protein

MHLSVPLLLEYEEVLLRELPNLYLSSEEVGELIDFYCAVGIRHEIFFLWRPFLRDPKDEMVLELAVKAGCQTIITYNARDFVGVEQFGLNVLEPSEFLRVIGKLP