Your browser is old and dusty. Try Google Chrome!

Details for sll0621

ORF sll0621
Accession NP_442874.1
Symbol ccdA
Category Other
Definition putative c-type cytochrome biogenesis protein CcdA
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -228 -242 -0.885388 0.242
NP_441061.1_2 Forward -235 -221 -1.18038 0.252
NP_440557.1_1 Reverse -228 -247 3.24438 0.211
NP_440795.1_7 Forward -235 -228 14.6904 0.0123
NP_440795.1_7 Reverse -228 -235 14.6904 0.0123
NP_441418.1_6 Reverse -227 -246 -18.7818 0.0837
NP_441418.1_6 Forward -236 -217 -20.945 0.133
NP_441418.1_6 Reverse -47 -66 -24.485 0.2
NP_442291.1_5 Forward -237 -221 -2.98973 0.232
NP_442272.1_2 Reverse -21 -40 11.2199 0.232
NP_440897.1_6 Forward -236 -217 16.2232 0.0255
NP_441453.1_1 Reverse -295 -313 3.75497 0.263
NP_441453.1_4 Reverse -227 -235 16.539 0.00633
NP_441453.1_4 Forward -236 -228 16.539 0.00633
NP_442151.1_6 Forward -311 -297 8.25939 0.178
NP_442151.1_6 Reverse -227 -241 6.19444 0.244
NP_441818.1_1 Forward -235 -224 9.30127 0.246
NP_441818.1_6 Forward -243 -229 8.35772 0.274
NP_441818.1_9 Reverse -377 -396 -7.86702 0.274
NP_441818.1_9 Reverse -56 -75 -9.73531 0.291
NP_440226.1_1 Reverse -227 -246 10.0292 0.0665
NP_442169.1_1 Forward -139 -120 -1.57384 0.265
NP_440150.1_6 Reverse -224 -243 2.45773 0.27
NP_440996.1_2 Reverse -87 -96 14.8477 0.248
NP_442173.1_1 Forward -235 -227 15.4574 0.00633
NP_442173.1_1 Reverse -228 -236 15.4574 0.00633
NP_442173.1_5 Reverse -327 -337 14.9575 0.287
NP_442752.1_4 Forward -236 -229 13.8055 0.0199
NP_442752.1_4 Reverse -227 -234 13.8055 0.0199
NP_443027.1_4 Reverse -225 -235 14.828 0.0437
NP_443027.1_4 Forward -238 -228 7.25653 0.24
NP_443027.1_4 Reverse -125 -135 5.78156 0.298
NP_441812.1_3 Reverse -226 -240 6.88276 0.287
NP_442975.1_10 Reverse -223 -237 13.1753 0.0459
NP_441675.1_8 Reverse -145 -159 17.5018 0.289
NP_440784.1_7 Forward -235 -228 15.9687 0.0123
NP_440784.1_7 Reverse -228 -235 15.9687 0.0123
NP_441934.1_4 Forward -184 -165 10.4225 0.237
NP_440061.1_9 Reverse -115 -129 6.58715 0.239
NP_440061.1_9 Reverse -354 -368 5.89884 0.266
NP_440110.1_4 Reverse -216 -235 9.3409 0.125
NP_440878.1_9 Forward -321 -302 5.89931 0.174
NP_442062.1_8 Forward -236 -226 19.4496 0.000558
NP_442062.1_8 Reverse -227 -237 10.3048 0.0493
NP_440761.1_4 Reverse -297 -316 -12.8819 0.257
NP_440304.1_4 Forward -238 -228 10.8948 0.051
NP_440304.1_4 Reverse -225 -235 10.8948 0.051
NP_440304.1_4 Reverse -300 -310 5.19158 0.223
NP_440304.1_4 Forward -171 -161 2.04498 0.299
NP_442242.1_1 Reverse -224 -243 16.2148 0.28
NP_442242.1_1 Forward -148 -129 16.2148 0.28
NP_442242.1_4 Forward -235 -228 14.3954 0.0124
NP_442242.1_4 Reverse -228 -235 14.3954 0.0124
NP_440044.1_8 Forward -235 -216 12.3892 0.0427
NP_442762.1_10 Forward -380 -361 -11.5053 0.275
NP_441208.1_9 Forward -239 -225 14.7492 0.093
NP_442196.1_4 Forward -79 -60 14.8474 0.263
NP_440132.1_1 Reverse -225 -243 19.1937 0.0283
NP_442110.1_7 Reverse -345 -359 2.35953 0.222
NP_442110.1_7 Forward -236 -222 1.57289 0.222
NP_441083.1_5 Forward -236 -226 11.3864 0.0159
NP_441083.1_5 Reverse -227 -237 11.2881 0.0159
NP_442841.1_10 Forward -237 -218 14.6508 0.124
NP_441738.1_2 Forward -234 -227 15.28 0.0102
NP_441738.1_2 Reverse -229 -236 15.28 0.0102
NP_441738.1_2 Reverse -163 -170 6.72528 0.236
NP_440209.1_1 Reverse -227 -235 18.1123 0.00295
NP_440209.1_1 Forward -236 -228 18.1123 0.00295
NP_442889.1_1 Reverse -110 -129 -13.9635 0.271
NP_442889.1_1 Forward -132 -113 -14.0619 0.271
NP_442889.1_1 Forward -122 -103 -15.5368 0.296
NP_442889.1_8 Reverse -224 -238 4.12889 0.27
NP_441713.1_1 Forward -242 -223 -3.14714 0.113
NP_441713.1_3 Forward -145 -126 2.3594 0.277
NP_442059.1_10 Reverse -7 -26 15.2408 0.126
NP_441716.1_1 Forward -236 -222 6.88276 0.186
NP_443013.1_8 Forward -247 -229 8.18062 0.258
NP_442111.1_4 Forward -237 -223 12.8809 0.0413
NP_442111.1_4 Reverse -226 -240 1.86788 0.293
NP_441163.1_1 Reverse -219 -236 8.00291 0.233
NP_440906.1_5 Forward -235 -228 15.8704 0.0124
NP_440906.1_5 Reverse -228 -235 15.8704 0.0124
NP_440747.1_10 Forward -239 -227 15.2803 0.0019
NP_440747.1_10 Reverse -224 -236 -2.02597 0.0196
NP_442973.1_5 Reverse -218 -237 15.5357 0.113
NP_441486.1_1 Reverse -224 -238 14.0609 0.00683
NP_441486.1_1 Forward -239 -225 2.35953 0.0844
NP_440944.1_2 Forward -138 -119 -3.24547 0.287
NP_442634.1_4 Reverse -225 -239 -1.18038 0.149
NP_442634.1_4 Forward -238 -224 -2.36035 0.149
NP_441265.1_6 Reverse -5 -24 20.1564 0.0786
NP_441014.1_5 Reverse -131 -149 13.4905 0.209
NP_442848.1_1 Reverse -221 -235 -3.04867 0.263
NP_442848.1_4 Forward -22 -8 7.66941 0.282
NP_443018.1_3 Forward -235 -228 14.8871 0.0123
NP_443018.1_3 Reverse -228 -235 14.8871 0.0123
NP_441316.1_7 Reverse -225 -240 22.596 0.0143
NP_441634.1_1 Forward -241 -222 -3.14714 0.275
NP_441634.1_5 Forward -26 -12 15.2409 0.262
NP_441634.1_8 Reverse -355 -369 -1.77037 0.295
NP_441634.1_8 Forward -238 -224 -3.63866 0.295
NP_440376.1_1 Forward -236 -227 19.4693 0.000692
NP_440376.1_1 Reverse -227 -236 19.4693 0.000692
NP_441588.1_4 Reverse -229 -239 7.05986 0.178
NP_442687.1_7 Reverse -226 -236 15.8113 0.0125
NP_442687.1_7 Forward -237 -227 9.02648 0.0994
NP_442191.1_4 Forward -235 -221 11.9627 0.233
NP_441846.1_10 Forward -179 -160 -22.2233 0.257
NP_442296.1_9 Forward -235 -216 -1.7705 0.214
NP_442658.1_1 Reverse -225 -235 15.9091 0.00966
NP_442658.1_1 Forward -238 -228 13.0576 0.04
NP_442198.1_3 Reverse -215 -234 3.14605 0.294
NP_440141.1_8 Reverse -55 -74 10.7175 0.208
NP_440141.1_8 Forward -65 -46 6.98095 0.251
NP_440141.1_8 Reverse -293 -312 5.11266 0.278
NP_442782.1_2 Forward -236 -222 0.294584 0.291
NP_442205.1_9 Reverse -221 -237 -2.30141 0.268
NP_441414.1_9 Forward -236 -217 1.86774 0.0705
NP_441414.1_9 Reverse -227 -246 -2.65548 0.12
NP_441256.1_1 Reverse -224 -243 -7.67036 0.239
NP_442937.1_5 Forward -316 -297 10.7175 0.154
NP_442937.1_5 Forward -143 -124 6.78429 0.27
NP_441317.1_4 Forward -29 -15 17.0077 0.136
NP_441317.1_4 Forward -28 -14 12.0422 0.236
NP_441958.1_5 Forward -237 -227 21.2195 0.000805
NP_441958.1_5 Reverse -226 -236 12.2714 0.00183
NP_442486.1_1 Reverse -224 -243 17.4424 0.212
NP_440203.1_5 Reverse -230 -240 11.091 0.205
NP_442876.1_5 Reverse -293 -312 22.5172 0.00865
NP_442876.1_7 Reverse -318 -336 26.6668 0.00233
NP_440984.1_7 Forward -241 -227 9.43936 0.127
NP_440984.1_7 Reverse -222 -236 4.52282 0.299
NP_442911.1_2 Reverse -217 -236 15.8307 0.0103
NP_442911.1_2 Forward -246 -227 -3.44213 0.112
NP_440153.1_5 Forward -235 -221 11.5043 0.0763
NP_442064.1_1 Forward -241 -222 -0.590531 0.146
NP_443055.1_6 Reverse -161 -179 0.116744 0.249
NP_440993.1_3 Forward -246 -227 -2.36125 0.299
NP_440602.1_2 Forward -131 -112 1.27776 0.263
NP_442002.1_9 Reverse -226 -233 10.7572 0.185
NP_440809.1_9 Reverse -218 -236 -7.45401 0.225
NP_441294.1_7 Reverse -223 -237 14.53 0.0409
NP_441294.1_7 Forward -233 -219 10.1145 0.207
NP_440411.1_10 Reverse -254 -273 11.2376 0.265
NP_442438.1_10 Reverse -222 -236 21.3374 0.01
NP_441000.1_6 Forward -237 -223 4.71948 0.0933
NP_441674.1_5 Forward -234 -215 -0.688862 0.152
NP_440147.1_4 Forward -238 -225 11.6223 0.0326
NP_440147.1_4 Reverse -225 -238 2.87088 0.202
NP_441550.1_8 Forward -238 -228 15.3192 0.0132
NP_441550.1_8 Reverse -225 -235 6.0761 0.214
NP_441916.1_7 Reverse -227 -237 18.9579 0.00144
NP_441916.1_7 Forward -236 -226 18.4663 0.00144
NP_441916.1_10 Forward -58 -39 3.14605 0.236
NP_441041.1_7 Forward -239 -227 14.4144 0.0348
NP_441041.1_7 Reverse -114 -126 6.543 0.206
NP_442396.1_5 Reverse -223 -236 5.91914 0.26
NP_440569.1_10 Forward -21 -2 3.29405 0.278
NP_441369.1_1 Reverse -286 -305 -9.047 0.18
NP_441547.1_2 Reverse -216 -234 7.19731 0.215
NP_442004.1_6 Forward -236 -222 2.85119 0.255
NP_442004.1_6 Reverse -227 -241 2.45787 0.264
NP_441725.1_4 Forward -241 -227 3.04726 0.279
NP_441725.1_5 Forward -235 -225 11.2881 0.0247
NP_441725.1_5 Reverse -48 -58 2.83163 0.115
NP_441725.1_5 Reverse -228 -238 1.94665 0.115
NP_439966.1_7 Reverse -225 -235 18.4657 0.00473
NP_439966.1_7 Forward -238 -228 6.27276 0.185
NP_439966.1_9 Reverse -225 -234 0.983037 0.253
NP_442941.1_3 Forward -235 -225 11.4848 0.0116
NP_442941.1_3 Reverse -228 -238 11.0914 0.0116
NP_440289.1_2 Reverse -224 -237 5.13249 0.0636
NP_442281.1_1 Forward -241 -227 17.6985 0.00542
NP_442281.1_1 Reverse -222 -236 3.14559 0.243
NP_440177.1_9 Reverse -213 -232 11.3075 0.277
NP_440177.1_9 Reverse -33 -52 10.7175 0.299
NP_442012.1_1 Forward -242 -223 3.04771 0.188
NP_440498.1_1 Forward -245 -227 6.70565 0.0845
NP_440498.1_1 Reverse -218 -236 -0.964162 0.222
NP_442982.1_5 Forward -246 -227 -2.65548 0.287
NP_441644.1_6 Reverse -227 -237 19.0557 0.000803
NP_441644.1_6 Forward -311 -301 10.1076 0.0628
NP_441644.1_6 Forward -236 -226 10.1076 0.0628
NP_442215.1_2 Forward -81 -65 3.10679 0.102
NP_442215.1_2 Forward -238 -222 -3.18639 0.211
NP_442215.1_2 Reverse -225 -241 -3.8747 0.223
NP_442247.1_8 Forward -238 -224 9.43936 0.247
NP_440929.1_8 Forward -236 -227 19.2726 0.000701
NP_440929.1_8 Reverse -227 -236 19.2726 0.000701
NP_442933.1_10 Forward -236 -227 17.601 0.00325
NP_442933.1_10 Reverse -227 -236 17.601 0.00325
NP_442648.1_4 Reverse -56 -75 6.29264 0.18
NP_441751.2_8 Reverse -228 -242 6.3911 0.0354
NP_442554.1_8 Reverse -228 -238 16.4013 0.0065
NP_442554.1_8 Forward -235 -225 13.8447 0.0145
NP_442554.1_9 Reverse -253 -272 20.7953 0.0277
NP_442970.1_1 Reverse -6 -20 8.79688 0.296
NP_441762.1_7 Reverse -226 -238 9.47875 0.0142
NP_441762.1_7 Forward -237 -225 2.98891 0.0676
NP_442142.1_4 Forward -239 -226 14.1783 0.0311
NP_442142.1_4 Reverse -224 -237 8.57349 0.112
NP_442292.1_1 Reverse -228 -237 17.5026 0.00435
NP_442292.1_1 Forward -235 -226 9.63616 0.0183
NP_442476.1_6 Forward -235 -221 4.81781 0.142
NP_443009.1_5 Forward -237 -226 19.626 0.00102
NP_443009.1_5 Reverse -226 -237 7.82632 0.118
NP_443009.1_5 Forward -127 -116 6.54802 0.157
NP_443009.1_5 Reverse -327 -338 3.99143 0.268
NP_442301.1_2 Forward -267 -248 16.3215 0.0927
NP_442408.2_1 Reverse -227 -246 6.19431 0.143
NP_441715.1_4 Forward -235 -225 16.303 0.0117
NP_441715.1_4 Reverse -228 -238 7.35486 0.108
NP_440357.1_3 Reverse -45 -64 0.0977854 0.285
NP_440158.1_8 Reverse -254 -273 18.3873 0.084
NP_440183.1_1 Reverse -45 -64 7.37428 0.262
NP_441198.1_8 Forward -238 -228 12.783 0.116
NP_441468.1_1 Forward -235 -228 15.8704 0.0124
NP_441468.1_1 Reverse -228 -235 15.8704 0.0124
NP_441020.2_6 Reverse -225 -242 19.5084 0.0076
NP_441020.2_6 Forward -238 -221 7.41366 0.232
NP_441015.1_10 Forward -241 -222 -1.57384 0.174
NP_441673.1_1 Forward -236 -227 20.8459 0.000698
NP_441673.1_1 Reverse -227 -236 20.8459 0.000698
NP_441016.2_6 Forward -269 -250 4.91521 0.292
NP_441876.1_9 Reverse -53 -63 13.8442 0.267
NP_441826.1_2 Reverse -221 -235 10.4227 0.0475
NP_441826.1_2 Reverse -41 -55 -0.590395 0.215
NP_441826.1_2 Forward -317 -303 -0.885388 0.228
NP_442490.1_9 Reverse -215 -234 1.76941 0.165
NP_442868.1_6 Forward -238 -228 0.963343 0.205
NP_442868.1_6 Reverse -225 -235 0.963343 0.205
NP_442427.1_8 Reverse -293 -312 7.86593 0.203
NP_442808.1_1 Reverse -226 -236 18.4657 0.00201
NP_442808.1_1 Forward -237 -227 8.73102 0.0481
NP_442808.1_1 Forward -225 -215 1.65123 0.282
NP_442050.1_5 Forward -238 -228 9.22267 0.193
NP_442050.1_5 Reverse -225 -235 9.12434 0.193
NP_441114.1_3 Reverse -118 -127 7.27622 0.247
NP_441114.1_3 Reverse -137 -146 6.39124 0.277
NP_440558.1_2 Reverse -44 -63 -6.1954 0.272
NP_442789.1_4 Forward -313 -294 -6.68705 0.287
NP_442789.1_4 Reverse -225 -244 -6.98204 0.289
NP_441878.1_1 Reverse -117 -136 17.8254 0.23
NP_441878.1_6 Forward -237 -227 10.5014 0.0176
NP_441878.1_6 Reverse -226 -236 10.4031 0.0176
NP_441878.1_6 Reverse -301 -311 -7.49312 0.231
NP_441878.1_6 Forward -152 -142 -7.98478 0.285
NP_441878.1_10 Reverse -307 -321 18.3875 0.268
NP_441036.1_8 Reverse -226 -236 17.7779 0.000554
NP_441036.1_8 Forward -237 -227 15.713 0.00724
NP_442721.1_3 Forward -79 -60 15.2408 0.209
NP_441557.1_5 Forward -236 -227 19.9609 0.000699
NP_441557.1_5 Reverse -227 -236 19.9609 0.000699
NP_441445.1_1 Reverse -239 -258 0.58944 0.272
NP_441590.1_3 Reverse -39 -58 10.5209 0.205
NP_441433.1_8 Reverse -179 -198 0.58944 0.239
NP_441308.1_8 Reverse -225 -235 10.1081 0.22
NP_440101.1_3 Reverse -222 -241 3.73603 0.224
NP_442830.1_5 Reverse -168 -182 -1.77094 0.299
NP_442183.1_1 Reverse -227 -241 10.9143 0.078
NP_441574.1_1 Reverse -44 -63 -7.27704 0.286
NP_441549.1_9 Forward -240 -222 -5.29072 0.198
NP_440861.1_2 Reverse -326 -345 11.4536 0.27
NP_441467.1_10 Forward -27 -13 5.99778 0.281
NP_442347.1_2 Forward -235 -226 11.1111 0.056
NP_442347.1_2 Forward -396 -387 3.63797 0.284
NP_442347.1_2 Reverse -228 -237 3.34298 0.284
NP_442645.1_2 Reverse -300 -319 -19.4701 0.288
NP_441037.1_4 Forward -238 -228 15.0168 0.028
NP_441037.1_4 Reverse -225 -235 7.02532 0.237
NP_442594.1_8 Reverse -239 -258 1.57275 0.299
NP_442047.1_2 Reverse -58 -72 16.3225 0.161
NP_441633.1_3 Forward -238 -225 1.29759 0.109
NP_441633.1_3 Reverse -225 -238 -3.81562 0.177
NP_440136.1_2 Forward -235 -228 15.9687 0.0123
NP_440136.1_2 Reverse -228 -235 15.9687 0.0123
NP_442998.1_10 Forward -234 -227 15.5754 0.0102
NP_442998.1_10 Reverse -229 -236 15.5754 0.0102
NP_440899.1_2 Forward -247 -228 8.65176 0.192
NP_440899.1_8 Forward -94 -75 -11.1119 0.296
NP_440299.1_1 Reverse -223 -236 14.08 0.0259
NP_440299.1_1 Forward -240 -227 3.46031 0.243
NP_441799.1_1 Forward -240 -226 21.4351 0.0036
NP_441799.1_1 Reverse -223 -237 14.7486 0.0222
NP_441007.1_10 Forward -241 -228 10.5407 0.0656
NP_442201.1_10 Reverse -216 -235 2.75272 0.0961
NP_442299.1_9 Reverse -72 -89 18.0334 0.257
NP_442333.2_1 Reverse -114 -133 -10.7186 0.296
NP_440256.1_1 Forward -239 -220 25.1722 0.00147
NP_441229.1_3 Reverse -75 -87 17.0502 0.261
NP_441559.1_8 Reverse -112 -126 0.687908 0.163
NP_441559.1_8 Reverse -222 -236 0.196253 0.169
NP_441559.1_8 Forward -131 -117 -0.393733 0.175
NP_441270.1_5 Reverse -63 -82 10.8472 0.296
NP_440915.1_6 Reverse -223 -237 4.22782 0.0986
NP_441179.1_9 Forward -259 -249 9.71433 0.28
NP_442785.1_7 Forward -238 -224 8.45605 0.297
NP_441866.1_4 Forward -27 -14 16.7464 0.234
NP_441866.1_4 Forward -38 -25 13.7312 0.273
NP_442967.1_10 Reverse -135 -149 15.0239 0.286
NP_442866.1_1 Reverse -222 -241 -3.04881 0.216
NP_441464.1_10 Forward -23 -9 12.6843 0.201
NP_441939.1_3 Forward -235 -216 5.50599 0.273
NP_441199.1_6 Reverse -223 -242 -0.983855 0.285
NP_440677.1_1 Forward -245 -226 11.0125 0.163
NP_440677.1_6 Reverse -218 -237 9.0459 0.27
NP_442386.1_9 Reverse -226 -235 15.7322 0.0144
NP_442386.1_9 Forward -224 -215 7.57079 0.219
NP_442386.1_9 Forward -237 -228 6.39082 0.219
NP_440570.1_4 Reverse -55 -73 0.609134 0.281
NP_441340.1_5 Forward -235 -228 15.6737 0.0124
NP_441340.1_5 Reverse -228 -235 15.6737 0.0124
NP_440327.1_6 Reverse -44 -63 2.94938 0.285
NP_442240.1_1 Reverse -39 -58 8.16011 0.239
NP_442240.1_2 Forward -235 -216 -16.6185 0.247
NP_440161.1_3 Reverse -225 -244 18.0924 0.0611
NP_440586.1_1 Reverse -238 -257 -4.72043 0.278
NP_440586.1_8 Forward -235 -228 13.2151 0.026
NP_440586.1_8 Reverse -228 -235 13.2151 0.026
NP_442251.1_6 Forward -235 -228 15.2804 0.0124
NP_442251.1_6 Reverse -228 -235 15.2804 0.0124
NP_441262.1_3 Reverse -227 -234 14.7888 0.0223
NP_441262.1_3 Forward -236 -229 14.7888 0.0223
NP_443051.1_1 Forward -237 -228 19.5676 0.00335
NP_443051.1_1 Reverse -226 -235 10.4228 0.00754
NP_439937.1_9 Forward -237 -220 -6.64833 0.157
NP_439937.1_9 Reverse -167 -184 -13.0398 0.279
NP_440439.1_1 Reverse -224 -237 17.5222 0.0105
NP_440439.1_1 Forward -239 -226 9.2624 0.0465
NP_439943.1_1 Reverse -50 -69 -10.522 0.29
NP_439943.1_7 Forward -131 -112 2.94938 0.29
NP_440372.1_2 Forward -235 -228 16.3621 0.0124
NP_440372.1_2 Reverse -228 -235 16.3621 0.0124
NP_440574.1_7 Forward -30 -11 16.2241 0.112
NP_441293.1_3 Reverse -11 -29 12.1295 0.291
NP_440316.1_10 Forward -178 -168 6.8632 0.251
NP_442488.1_3 Forward -373 -354 14.6508 0.177
NP_441803.1_2 Forward -241 -222 3.04771 0.197
NP_440139.1_1 Reverse -221 -240 9.93006 0.0938
NP_441572.1_7 Forward -242 -223 -3.83545 0.22
NP_441572.1_7 Reverse -221 -240 -4.91709 0.245
NP_442384.1_10 Forward -236 -223 16.3422 0.00854
NP_442384.1_10 Reverse -227 -240 13.589 0.0195
NP_441018.1_7 Forward -240 -221 10.0292 0.218
NP_442262.1_10 Forward -235 -228 14.1988 0.0123
NP_442262.1_10 Reverse -228 -235 14.1988 0.0123
NP_441689.1_5 Reverse -225 -235 8.53436 0.132
NP_441689.1_5 Forward -238 -228 8.3377 0.132
NP_440344.1_10 Forward -243 -226 -5.46769 0.106
NP_440344.1_10 Reverse -220 -237 -7.23765 0.116
NP_440075.1_1 Forward -328 -309 11.7008 0.0567
NP_440282.1_10 Forward -246 -227 -7.37537 0.251
NP_440531.1_6 Forward -244 -225 1.17943 0.179
NP_441965.1_3 Reverse -217 -236 -0.000545616 0.244
NP_441965.1_10 Reverse -224 -240 21.1014 0.0148
NP_440297.1_9 Forward -235 -225 9.32148 0.0917
NP_440297.1_9 Reverse -228 -238 -0.216628 0.282
NP_442280.1_10 Forward -93 -75 6.33103 0.279
NP_441103.1_9 Reverse -53 -63 12.7825 0.284
NP_440999.1_9 Reverse -223 -237 0.0979218 0.193
NP_440888.1_2 Forward -236 -222 18.7801 0.00187
NP_442277.1_4 Reverse -218 -237 18.3865 0.0247
NP_441543.1_2 Forward -235 -226 18.486 0.00236
NP_441543.1_2 Reverse -228 -237 15.9293 0.00518
NP_442845.1_2 Forward -236 -222 4.91614 0.249
NP_442845.1_2 Forward -242 -228 4.12949 0.267
NP_442845.1_8 Forward -357 -338 11.6025 0.291
NP_441304.1_10 Forward -340 -331 12.9794 0.271
NP_441551.1_5 Reverse -223 -239 13.3325 0.126
NP_441319.1_8 Reverse -221 -239 4.83737 0.285
NP_442701.1_2 Reverse -11 -29 2.57575 0.282
NP_441469.1_8 Reverse -226 -235 16.126 0.00797
NP_441469.1_8 Forward -57 -48 7.07956 0.227
NP_441469.1_8 Forward -237 -228 6.5879 0.227
NP_443064.1_6 Reverse -227 -237 10.8217 0.13
NP_442337.1_8 Forward -90 -71 5.80098 0.21
NP_441223.1_3 Forward -28 -9 21.1406 0.0851
NP_442578.1_7 Forward -235 -228 14.5921 0.026
NP_442578.1_7 Reverse -228 -235 14.5921 0.026
NP_441462.1_2 Reverse -227 -237 20.2362 0.000805
NP_441462.1_2 Forward -236 -226 11.5831 0.00406
NP_441621.1_7 Reverse -225 -239 4.32615 0.0934
NP_443062.1_1 Reverse -227 -245 6.8883 0.19
NP_443062.1_6 Forward -244 -225 5.89931 0.193
NP_442204.1_1 Forward -240 -229 8.4168 0.0945
NP_442204.1_5 Reverse -217 -236 14.3558 0.0486
NP_440516.1_2 Forward -242 -224 -2.73412 0.299
NP_440516.1_6 Reverse -169 -183 10.0287 0.233
NP_440516.1_8 Forward -236 -227 16.9127 0.00442
NP_440516.1_8 Reverse -227 -236 16.9127 0.00442
NP_442428.1_5 Forward -235 -228 15.8704 0.0124
NP_442428.1_5 Reverse -228 -235 15.8704 0.0124
NP_440673.1_3 Forward -234 -227 12.4288 0.0426
NP_440673.1_3 Reverse -229 -236 12.4288 0.0426
NP_441052.1_2 Forward -236 -226 10.5014 0.0285
NP_441052.1_2 Reverse -227 -237 10.4031 0.0285
NP_441052.1_2 Reverse -302 -312 5.09324 0.132
NP_442219.1_9 Forward -235 -226 8.35786 0.0681
NP_442219.1_9 Reverse -228 -237 8.25953 0.0681
NP_440436.1_4 Forward -235 -226 18.1905 0.00233
NP_440436.1_4 Reverse -228 -237 9.24241 0.0871
NP_441884.1_8 Reverse -226 -245 -9.83364 0.268
NP_441884.1_9 Reverse -224 -243 -15.5368 0.138
NP_441884.1_9 Reverse -44 -63 -22.125 0.275
NP_441719.1_4 Forward -235 -228 16.3621 0.0124
NP_441719.1_4 Reverse -228 -235 16.3621 0.0124
NP_441733.1_10 Forward -239 -226 5.82081 0.203
NP_441004.1_1 Reverse -58 -77 -16.5201 0.286
NP_441004.1_1 Reverse -296 -315 -17.1101 0.289
NP_441004.1_2 Reverse -291 -310 -3.63879 0.283
NP_441004.1_4 Reverse -299 -309 9.02648 0.259
NP_442366.1_3 Reverse -226 -244 6.70565 0.0773
NP_442366.1_3 Forward -237 -219 -2.14413 0.221
NP_442366.1_5 Forward -239 -229 14.0409 0.0497
NP_440296.1_10 Reverse -224 -243 -6.58872 0.228
NP_441115.1_4 Forward -237 -219 16.7346 0.0252
NP_442694.1_4 Forward -22 -13 13.8644 0.217
NP_442206.1_10 Reverse -227 -242 16.0078 0.0799
NP_440328.1_4 Reverse -221 -240 9.0459 0.105
NP_443054.1_2 Reverse -225 -239 1.76955 0.245
NP_441966.1_7 Forward -396 -377 -2.16459 0.297
NP_441851.1_10 Reverse -226 -236 16.008 0.00552
NP_441851.1_10 Forward -237 -227 8.53483 0.114
NP_441851.1_10 Forward -127 -117 4.3066 0.277
NP_441542.1_4 Forward -142 -128 5.1128 0.264
NP_441542.1_4 Reverse -296 -310 2.94952 0.295
NP_442515.1_1 Forward -312 -298 -3.54032 0.292
NP_441982.1_6 Reverse -9 -18 11.1485 0.288
NP_441349.1_10 Reverse -217 -236 12.9791 0.0194
NP_440389.1_2 Forward -106 -87 11.3075 0.287
NP_440432.1_9 Reverse -228 -243 -0.315096 0.164
NP_442843.1_1 Forward -64 -45 -8.55534 0.255
NP_440474.1_8 Forward -235 -221 13.1753 0.0735
NP_440726.1_2 Forward -63 -44 2.65439 0.246
NP_441124.1_5 Forward -164 -154 11.7668 0.245
NP_440431.1_3 Reverse -2 -21 -11.5053 0.286
NP_442450.1_5 Reverse -225 -235 9.32148 0.115
NP_442450.1_5 Forward -238 -228 7.64985 0.13
NP_440588.1_2 Reverse -218 -237 9.24257 0.0446
NP_440588.1_2 Forward -245 -226 8.35759 0.0455
NP_440040.1_8 Forward -276 -257 4.82192 0.246
NP_442006.1_2 Forward -178 -161 -18.3491 0.29
NP_442006.1_2 Reverse -227 -244 -18.4474 0.291
NP_441570.1_1 Reverse -227 -245 1.69077 0.029
NP_441570.1_1 Forward -236 -218 -7.35568 0.0887
NP_441078.1_4 Forward -236 -227 19.6659 0.0007
NP_441078.1_4 Reverse -227 -236 19.6659 0.0007
NP_441078.1_4 Reverse -302 -311 -1.6719 0.266
NP_442443.1_4 Reverse -16 -26 14.8275 0.202
NP_441432.1_8 Forward -237 -228 16.8143 0.00595
NP_441432.1_8 Reverse -226 -235 8.25953 0.0755
NP_441432.1_8 Reverse -301 -310 5.21127 0.185
NP_442320.1_8 Reverse -221 -235 -3.73699 0.131
NP_441732.1_2 Forward -240 -224 1.92682 0.0254
NP_441732.1_2 Reverse -223 -239 -17.2477 0.247
NP_440629.1_4 Reverse -124 -143 13.3725 0.217
NP_440629.1_6 Forward -242 -223 16.7018 0.0925
NP_440760.1_1 Reverse -227 -246 -4.91709 0.0475
NP_441131.1_5 Reverse -351 -370 5.60432 0.251
NP_440199.1_10 Reverse -224 -234 13.2547 0.108
NP_440461.1_3 Reverse -219 -238 15.6341 0.212
NP_442489.1_7 Forward -236 -227 20.1576 0.000695
NP_442489.1_7 Reverse -227 -236 20.1576 0.000695
NP_442489.1_7 Reverse -302 -311 -1.6719 0.235
NP_442489.1_7 Forward -311 -302 -1.96689 0.28
NP_440565.1_3 Reverse -38 -57 18.8688 0.191
NP_441452.1_1 Reverse -167 -186 13.0775 0.292
NP_440559.1_1 Forward -235 -226 8.75118 0.0586
NP_440559.1_1 Reverse -228 -237 8.65285 0.0586
NP_441659.2_8 Reverse -227 -237 20.9245 0.000805
NP_441659.2_8 Forward -236 -226 11.9764 0.0147
NP_441659.2_8 Reverse -142 -152 0.963343 0.254
NP_442913.1_10 Reverse -218 -237 -3.73712 0.216
NP_441040.1_2 Reverse -39 -58 -0.688862 0.128
NP_441040.1_2 Reverse -218 -237 -14.6519 0.286
NP_439956.1_7 Forward -132 -113 4.81767 0.257
NP_442008.1_2 Forward -239 -220 14.9458 0.0806
NP_442008.1_2 Reverse -60 -79 4.81767 0.232
NP_440708.1_6 Forward -93 -74 -9.53865 0.269
NP_442346.1_5 Forward -237 -227 16.303 0.00248
NP_442346.1_5 Reverse -226 -236 9.02648 0.118
NP_442346.1_5 Reverse -301 -311 8.33817 0.14
NP_442346.1_10 Reverse -45 -64 8.55425 0.153
NP_440545.1_3 Forward -240 -223 11.2486 0.0268
NP_440545.1_3 Reverse -223 -240 0.530496 0.137
NP_440545.1_3 Forward -60 -43 -3.50107 0.206
NP_441856.1_3 Reverse -224 -243 8.55425 0.101
NP_440025.1_6 Reverse -106 -125 12.5858 0.26
NP_440486.1_6 Reverse -62 -81 8.16093 0.248
NP_441653.1_3 Reverse -245 -259 18.2892 0.145
NP_442551.1_4 Forward -313 -298 -2.77337 0.276
NP_440847.1_3 Reverse -49 -63 13.372 0.217
NP_442875.1_2 Reverse -68 -87 26.6471 0.0036
NP_442875.1_7 Reverse -92 -111 24.3846 0.00779
NP_442875.1_8 Reverse -143 -162 20.649 0.0741
NP_440449.1_6 Reverse -134 -152 7.76952 0.212
NP_440449.1_6 Reverse -219 -237 5.92152 0.266
NP_441948.1_4 Reverse -220 -238 6.70565 0.0633
NP_441779.1_5 Reverse -211 -230 15.0432 0.278
NP_441833.1_4 Forward -235 -228 15.9687 0.0124
NP_441833.1_4 Reverse -228 -235 15.9687 0.0124
NP_442060.1_3 Reverse -31 -50 12.4867 0.286
NP_442162.1_9 Forward -235 -228 16.2637 0.0124
NP_442162.1_9 Reverse -228 -235 16.2637 0.0124
NP_440671.1_5 Reverse -163 -177 14.0603 0.293
NP_442199.1_5 Reverse -219 -238 -4.72043 0.229
NP_442140.1_3 Forward -235 -225 8.33817 0.119
NP_442140.1_3 Reverse -228 -238 6.66654 0.159
NP_440875.1_9 Reverse -229 -239 8.37203 0.233
NP_441813.1_5 Reverse -225 -235 17.188 0.00979
NP_441813.1_5 Forward -238 -228 8.63316 0.0367
NP_440590.1_4 Forward -235 -222 3.5592 0.0719
NP_440567.1_1 Forward -235 -221 18.6825 0.0136
NP_440567.1_1 Reverse -228 -242 11.0127 0.0305
NP_442497.1_10 Reverse -228 -237 17.601 0.00813
NP_442497.1_10 Forward -235 -226 10.4228 0.0087
NP_440821.1_4 Reverse -225 -235 19.0562 0.00399
NP_440821.1_4 Forward -238 -228 2.24165 0.131
NP_441239.1_9 Forward -238 -226 13.707 0.0355
NP_441239.1_9 Reverse -225 -237 13.3137 0.037
NP_441239.1_9 Forward -58 -46 6.1355 0.2
NP_441239.1_9 Reverse -167 -179 5.44718 0.221
NP_440156.1_4 Reverse -48 -58 8.92768 0.242
NP_442568.1_8 Reverse -13 -27 9.93102 0.257
NP_441727.1_3 Forward -243 -224 2.75272 0.299
NP_441892.1_1 Forward -245 -228 -0.649475 0.188
NP_440665.1_1 Reverse -230 -249 -16.6185 0.292
NP_440665.1_9 Reverse -139 -158 15.2408 0.142
NP_442669.1_1 Forward -339 -320 0.0977854 0.296
NP_440604.1_6 Forward -236 -217 4.03102 0.131
NP_440604.1_6 Reverse -227 -246 2.65439 0.137
NP_441698.1_7 Reverse -232 -250 22.6353 0.0252
NP_442643.1_1 Reverse -221 -240 -11.4069 0.231
NP_442138.1_10 Reverse -227 -246 -6.98204 0.286
NP_442809.1_6 Reverse -302 -321 1.47442 0.272
NP_440546.1_4 Reverse -227 -237 13.5365 0.0459
NP_440546.1_4 Forward -236 -226 11.8882 0.0679
NP_440546.1_4 Reverse -127 -137 7.52511 0.235
NP_440024.1_8 Forward -128 -109 20.4514 0.0869
NP_440462.1_6 Reverse -225 -235 15.418 0.0142
NP_440462.1_6 Forward -238 -228 10.5014 0.0396
NP_442465.1_9 Reverse -13 -27 12.1926 0.22
NP_440868.1_4 Reverse -223 -235 18.3285 0.0124
NP_440868.1_4 Forward -240 -228 15.1819 0.0164
NP_442499.1_4 Forward -346 -332 10.226 0.276
NP_441474.1_1 Forward -246 -227 -2.26292 0.273
NP_442402.1_4 Forward -91 -72 -6.09781 0.25
NP_441084.1_6 Reverse -300 -314 9.44108 0.282
NP_442882.1_7 Reverse -220 -234 12.0937 0.261
NP_440843.1_3 Forward -143 -124 18.3873 0.187
NP_442039.1_4 Forward -235 -228 15.1821 0.0124
NP_442039.1_4 Reverse -228 -235 15.1821 0.0124
NP_442039.1_7 Forward -54 -44 10.7964 0.257
NP_442829.1_2 Reverse -318 -334 12.1031 0.287
NP_442837.1_3 Forward -235 -228 15.7721 0.0124
NP_442837.1_3 Reverse -228 -235 15.7721 0.0124
NP_442053.1_1 Forward -236 -227 18.3876 0.0007
NP_442053.1_1 Reverse -227 -236 18.3876 0.0007
NP_440505.1_3 Reverse -225 -235 13.8447 0.0247
NP_440505.1_3 Forward -128 -118 12.8614 0.0427
NP_440505.1_3 Forward -238 -228 8.04317 0.147
NP_441252.1_6 Forward -15 -8 14.3954 0.168
NP_441203.1_1 Forward -235 -216 -10.1286 0.137
NP_441408.2_7 Reverse -300 -319 0.294447 0.228
NP_441408.2_7 Reverse -16 -35 -0.688862 0.234
NP_440914.1_1 Reverse -227 -237 16.3248 0.00196
NP_440914.1_1 Forward -236 -226 8.6151 0.186
NP_440914.1_1 Forward -151 -141 7.5416 0.232
NP_440914.1_1 Forward -251 -241 7.24882 0.242
NP_441011.1_8 Forward -235 -226 16.9127 0.00602
NP_441011.1_8 Reverse -228 -237 16.6177 0.00602
NP_442101.1_6 Reverse -288 -307 13.7658 0.195
NP_442101.1_6 Reverse -252 -271 10.8159 0.294
NP_442533.1_1 Forward -185 -166 -14.0619 0.239
NP_442533.1_6 Forward -236 -227 17.2076 0.00137
NP_442533.1_6 Reverse -227 -236 17.2076 0.00137
NP_442533.1_6 Forward -311 -302 5.70292 0.132
NP_442541.1_10 Reverse -47 -61 5.99717 0.248
NP_442322.1_4 Reverse -161 -178 -8.8116 0.286
NP_442322.1_4 Reverse -167 -184 -9.7949 0.297
NP_441482.1_7 Forward -242 -228 -3.24533 0.115
NP_439944.1_9 Forward -235 -225 10.3048 0.0887
NP_439944.1_9 Reverse -228 -238 9.12481 0.1
NP_441697.1_5 Forward -299 -280 -8.73794 0.268
NP_440816.1_7 Forward -240 -221 8.55425 0.289
NP_441028.1_6 Forward -193 -183 8.43603 0.216
NP_441028.1_6 Forward -92 -82 8.14104 0.217
NP_442664.1_8 Reverse -163 -182 11.5033 0.233
NP_441527.1_4 Reverse -13 -32 -7.01908 0.229
NP_440115.1_6 Forward -239 -229 7.35486 0.147
NP_439965.1_1 Reverse -218 -237 -6.78538 0.218
NP_441106.1_1 Forward -237 -228 18.486 0.0028
NP_441106.1_1 Reverse -226 -235 18.191 0.0028
NP_439903.1_6 Forward -389 -370 2.6536 0.222
NP_439903.1_6 Reverse -224 -243 1.47364 0.245
NP_441286.1_1 Forward -237 -225 5.05386 0.0259
NP_441286.1_1 Reverse -226 -238 -3.59927 0.145
NP_440670.1_8 Forward -236 -227 18.3876 0.000699
NP_440670.1_8 Reverse -227 -236 18.3876 0.000699
NP_440886.1_7 Reverse -226 -236 17.7774 0.0011
NP_440886.1_7 Forward -237 -227 8.04271 0.0805
NP_442614.1_2 Forward -236 -222 6.48943 0.291
NP_442717.1_1 Reverse -25 -44 -2.0655 0.285
NP_442072.1_9 Forward -237 -219 -21.8103 0.212
NP_442072.1_9 Forward -152 -134 -23.2853 0.288
NP_440907.2_8 Reverse -228 -238 15.9091 0.0161
NP_440907.2_8 Forward -235 -225 7.84605 0.117
NP_442459.1_8 Reverse -222 -241 21.6323 0.0225
NP_441463.1_3 Reverse -217 -236 -8.26035 0.267
NP_442842.1_10 Forward -30 -11 4.73683 0.214
NP_441626.1_2 Forward -235 -228 15.7721 0.0124
NP_441626.1_2 Reverse -228 -235 15.7721 0.0124
NP_442365.1_7 Forward -240 -221 -2.45882 0.2
NP_442794.1_1 Forward -240 -228 2.69391 0.286
NP_442615.1_1 Reverse -218 -236 8.08229 0.0297
NP_442615.1_1 Forward -245 -227 1.59244 0.0829
NP_441962.1_4 Forward -316 -297 -9.83364 0.222
NP_440387.1_1 Reverse -227 -243 13.4315 0.00865
NP_440387.1_1 Forward -236 -220 6.64671 0.0282
NP_441431.1_2 Reverse -224 -238 11.5037 0.136
NP_441488.1_7 Forward -242 -223 0.491109 0.296
NP_441836.1_2 Reverse -296 -315 8.75091 0.101
NP_441836.1_2 Forward -190 -171 -5.60541 0.284
NP_440143.1_1 Reverse -293 -312 14.5524 0.246
NP_440114.1_10 Forward -236 -222 12.8809 0.0698
NP_440114.1_10 Reverse -227 -241 8.84938 0.192
NP_439988.1_7 Forward -234 -220 12.5853 0.292
NP_442743.1_4 Forward -235 -216 18.6823 0.021
NP_441311.1_2 Forward -242 -228 13.6669 0.229
NP_442867.1_8 Reverse -172 -191 12.1925 0.197
NP_440457.1_1 Reverse -223 -235 11.4454 0.092
NP_440798.1_6 Forward -235 -222 14.8673 0.0423
NP_440798.1_6 Reverse -228 -241 1.39592 0.217
NP_440801.1_8 Reverse -226 -245 -1.37718 0.276
NP_440801.1_8 Reverse -109 -128 -1.86883 0.283
NP_442509.1_9 Forward -236 -226 16.2041 0.00739
NP_442509.1_9 Reverse -227 -237 8.04271 0.192
NP_440554.1_4 Forward -235 -225 14.6313 0.02
NP_440554.1_4 Reverse -228 -238 8.82982 0.0646
NP_441885.1_5 Forward -236 -226 11.4848 0.00668
NP_441885.1_5 Reverse -227 -237 11.3864 0.00668
NP_440628.1_1 Reverse -80 -90 13.1977 0.29
NP_441466.1_4 Reverse -149 -168 8.35759 0.295
NP_442341.1_7 Reverse -226 -240 4.81781 0.177
NP_442341.1_7 Forward -237 -223 1.17956 0.297
NP_442341.1_9 Reverse -225 -239 14.0603 0.0713
NP_442341.1_9 Forward -238 -224 8.65209 0.166
NP_442534.1_7 Forward -73 -54 6.4893 0.272
NP_440423.1_10 Forward -243 -224 10.0292 0.259
NP_443000.1_7 Forward -238 -228 10.6981 0.0345
NP_443000.1_7 Reverse -225 -235 8.73149 0.0437
NP_440076.1_9 Reverse -160 -173 15.1616 0.292
NP_441842.1_10 Reverse -220 -234 19.0758 0.0142
NP_441842.1_10 Forward -243 -229 6.19444 0.297
NP_440275.1_3 Forward -238 -228 9.02648 0.0563
NP_440275.1_3 Reverse -225 -235 8.4365 0.0602
NP_440091.1_1 Reverse -223 -235 17.7386 0.013
NP_440175.1_7 Reverse -247 -265 9.16793 0.28
NP_442591.1_5 Reverse -224 -243 14.2574 0.234
NP_440149.1_8 Forward -236 -217 2.26107 0.112
NP_440149.1_8 Reverse -302 -321 -7.76869 0.292
NP_441105.1_3 Reverse -36 -55 -6.78538 0.241
NP_440216.1_1 Forward -236 -222 17.6992 0.00155
NP_440216.1_1 Reverse -227 -241 -2.45868 0.0513
NP_440216.1_6 Reverse -220 -236 5.86006 0.189
NP_440216.1_9 Forward -359 -350 14.651 0.172
NP_440172.1_1 Reverse -227 -237 17.5813 0.00421
NP_440172.1_1 Forward -236 -226 8.73149 0.0586
NP_440172.1_1 Forward -126 -116 3.81494 0.216
NP_440172.1_1 Forward -311 -301 2.04498 0.286
NP_442015.1_10 Reverse -223 -236 9.85238 0.0433
NP_442015.1_10 Forward -240 -227 2.37923 0.193
NP_441226.1_7 Forward -235 -228 14.4934 0.0123
NP_441226.1_7 Reverse -228 -235 14.4934 0.0123
NP_441226.1_7 Forward -229 -222 6.82361 0.246
NP_442834.1_10 Reverse -221 -240 15.9291 0.0749
NP_441111.1_7 Forward -235 -227 18.7023 0.00294
NP_441111.1_7 Reverse -228 -236 18.7023 0.00294
NP_442379.1_10 Reverse -220 -237 4.6604 0.141
NP_441766.1_2 Forward -236 -227 17.5026 0.00297
NP_441766.1_2 Reverse -227 -236 17.5026 0.00297
NP_442417.1_5 Reverse -227 -241 7.17775 0.195
NP_440416.1_9 Reverse -220 -239 1.57275 0.0444
NP_440416.1_9 Forward -243 -224 -14.8485 0.18
NP_443052.1_8 Reverse -217 -236 -1.47551 0.0795
NP_442116.1_2 Reverse -105 -124 12.0933 0.289
NP_440845.1_1 Forward -153 -134 -2.65548 0.182
NP_442154.1_1 Forward -187 -169 -17.1888 0.249
NP_442154.1_1 Reverse -240 -258 -18.5654 0.282
NP_440261.1_5 Reverse -228 -241 -1.06236 0.0655
NP_440261.1_5 Forward -235 -222 -2.73398 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCATCTGATTCCAAAATAATCACCTTGACTCGGCTGGTATTCCAATGCAAATCACTATCCAAGAGCAATTGTTTGGAATCTTTAACTGTGGCCATTACCTCAAAAGCTCTCATCATTATTCCTCTTTACAACAAAACCAATACCACCATAACAAACTCCATCTAGGCGATCGCCGTCCGGAAACCCACTTTCACAGAATTCTATTATCTGCTCTCCATTGAGGGGCAGGGGGGGAATGTCTAACTTTAGGACGATGAGCTTTGGCAAGATGGCTGGGAATTGCTTAGCATTGTCGGAGAAGTGTTAATCTTTCCTCTGGTTTGACCCCGCCAATAAACCAGGGGCGAAATGGCAGCCGGCAAATTTCAGACTTATTTTTGGCTTTTTGGGCAACTGTGTA

CDS

ATGTGGCAATCTCTGCAAAATCAGCTTTTTTTTCTCCAGCAATGGGCTGATCGCCTAGTGGTGGAACAACTGGGACAACTAACTCCCCTTAGTTTACTGATCATCCTACTAGCGGGGCTAGTCACTAGTTTGACCCCCTGTTTACTGTCCCTGCTCCCCCTCACCATTGCCTACATTGGCGGGACCACGGAAGGCGATCGCCTGCAATCTTTGAGACAATCCCTCTGGTTTGCCCTGGGGTTGGCCATTACTTTGGCTAGCTTGGGGCTGGGGGCAGCGGCTTTGGGAAAAATTTATGGACAAATTGGGCTAGGTTTACCGATTTTGGTGAGTTTGGTGGCTATTTTAATGGGATTAAACCTGTTGGAATTATTACCCCTGCAGTTTCCCAGTTTAGGGGCAACGGATTGGATCAAAGACGATTTTCCCCCGGCTTTGCGGGCCCTATTGGCCGGACTAACTTTTGGGCTAATCGCCTCTCCCTGTAGCACCCCTGTGTTGGCCAGCTTGCTAGCTTGGGTCGCCAGTCGCCAAGATTTGTTACTGGGTAGTGGTCTCTTGTTGGCCTATACCGTTGGTTACGTTGCCCCGCTTATTTTAGTTGGCCTGTTTGCTGGCAGTTTAAAGCGGTTATTGCAACTGCGGCAATGGTCCGGTTGGCTCAATCCCCTCAGCGGCACAATTTTGCTGGGCTTTGGGGTGATTACCTTGCTCTCCCGACTGCCCCTGGGTCAGTGGTTATCCTAG

Protein

MWQSLQNQLFFLQQWADRLVVEQLGQLTPLSLLIILLAGLVTSLTPCLLSLLPLTIAYIGGTTEGDRLQSLRQSLWFALGLAITLASLGLGAAALGKIYGQIGLGLPILVSLVAILMGLNLLELLPLQFPSLGATDWIKDDFPPALRALLAGLTFGLIASPCSTPVLASLLAWVASRQDLLLGSGLLLAYTVGYVAPLILVGLFAGSLKRLLQLRQWSGWLNPLSGTILLGFGVITLLSRLPLGQWLS