Your browser is old and dusty. Try Google Chrome!

Details for sll0609

ORF sll0609
Accession NP_442290.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -199 -213 19.5675 0.0144
NP_441061.1_2 Forward -206 -192 10.0294 0.0651
NP_441061.1_2 Forward -47 -33 -2.55701 0.296
NP_440795.1_7 Forward -206 -199 14.6904 0.0123
NP_440795.1_7 Reverse -199 -206 14.6904 0.0123
NP_441418.1_6 Forward -207 -188 -2.0655 0.0169
NP_441418.1_6 Reverse -198 -217 -22.3217 0.175
NP_441418.1_6 Forward -135 -116 -22.6167 0.182
NP_441418.1_6 Forward -48 -29 -23.2067 0.192
NP_441418.1_6 Reverse -27 -46 -29.0082 0.215
NP_442291.1_5 Reverse -160 -176 -4.1697 0.266
NP_441453.1_1 Reverse -191 -209 2.37835 0.294
NP_441453.1_4 Reverse -198 -206 16.539 0.00633
NP_441453.1_4 Forward -207 -199 16.539 0.00633
NP_442151.1_6 Reverse -198 -212 9.04604 0.159
NP_442151.1_6 Forward -207 -193 8.35772 0.175
NP_442151.1_6 Forward -170 -156 7.76774 0.19
NP_443043.1_10 Forward -40 -21 -1.57384 0.259
NP_441818.1_9 Forward -141 -122 -7.27704 0.271
NP_441818.1_9 Forward -147 -128 -7.86702 0.274
NP_441818.1_9 Reverse -37 -56 -10.6203 0.296
NP_440226.1_1 Reverse -198 -217 8.55425 0.0849
NP_440931.1_7 Forward -54 -36 11.4247 0.258
NP_440150.1_2 Reverse -16 -35 4.12856 0.281
NP_440150.1_6 Forward -160 -141 2.26107 0.275
NP_440150.1_6 Reverse -195 -214 1.47442 0.288
NP_440996.1_3 Forward -99 -81 17.8171 0.0933
NP_442173.1_1 Forward -206 -198 15.4574 0.00633
NP_442173.1_1 Reverse -199 -207 15.4574 0.00633
NP_442752.1_4 Forward -207 -200 13.8055 0.0199
NP_442752.1_4 Reverse -198 -205 13.8055 0.0199
NP_442752.1_4 Forward -141 -134 12.1338 0.0546
NP_443027.1_4 Reverse -196 -206 16.2046 0.0437
NP_443027.1_4 Forward -209 -199 13.1564 0.0521
NP_441812.1_3 Forward -208 -194 11.0127 0.215
NP_442975.1_10 Reverse -194 -208 13.077 0.0459
NP_440784.1_7 Forward -206 -199 15.9687 0.0123
NP_440784.1_7 Reverse -199 -206 15.9687 0.0123
NP_442909.1_7 Reverse -199 -213 7.96378 0.194
NP_442909.1_7 Reverse -127 -141 6.19383 0.255
NP_442861.1_4 Forward -98 -79 1.17865 0.297
NP_440061.1_9 Reverse -196 -210 17.8952 0.0117
NP_440061.1_9 Forward -50 -36 11.7987 0.105
NP_440061.1_9 Reverse -142 -156 8.3571 0.177
NP_440110.1_8 Forward -209 -190 8.75091 0.0906
NP_441476.1_5 Forward -146 -127 -3.04881 0.231
NP_439979.1_9 Forward -152 -134 9.16393 0.257
NP_440878.1_9 Forward -217 -198 -3.14714 0.289
NP_442062.1_8 Reverse -198 -208 17.3846 0.00193
NP_442062.1_8 Forward -207 -197 10.3048 0.0493
NP_442062.1_8 Reverse -305 -315 2.83163 0.293
NP_440761.1_4 Forward -212 -193 -4.22878 0.132
NP_440761.1_4 Reverse -381 -400 -13.6686 0.257
NP_441859.1_3 Reverse -197 -216 9.14342 0.131
NP_440304.1_4 Reverse -196 -206 19.9412 0.00364
NP_440304.1_4 Forward -209 -199 9.91146 0.051
NP_442242.1_4 Forward -206 -199 14.3954 0.0124
NP_442242.1_4 Reverse -199 -206 14.3954 0.0124
NP_440044.1_8 Forward -206 -187 4.71934 0.11
NP_441781.1_7 Reverse -126 -145 4.81767 0.186
NP_439918.1_3 Forward -210 -191 16.1257 0.113
NP_441208.1_9 Forward -210 -196 16.2242 0.0671
NP_440764.1_5 Forward -305 -286 9.93088 0.279
NP_441594.1_6 Reverse -189 -208 5.40766 0.209
NP_441594.1_6 Forward -173 -154 -0.295539 0.298
NP_440132.1_1 Forward -209 -191 12.0155 0.198
NP_442110.1_7 Forward -207 -193 12.4876 0.0586
NP_442110.1_7 Reverse -148 -162 1.96621 0.222
NP_442110.1_7 Reverse -198 -212 -0.492064 0.291
NP_441925.1_4 Reverse -122 -141 0.588665 0.155
NP_440856.1_4 Reverse -191 -210 0.491109 0.167
NP_440856.1_7 Forward -210 -191 -2.55715 0.191
NP_440856.1_7 Forward -258 -239 -3.24547 0.198
NP_440856.1_7 Forward -48 -29 -5.99873 0.235
NP_441083.1_5 Reverse -198 -208 20.3345 0.00053
NP_441083.1_5 Forward -207 -197 11.2881 0.0159
NP_442827.1_8 Forward -215 -196 4.42355 0.135
NP_441434.1_3 Reverse -104 -123 -2.65548 0.269
NP_441434.1_7 Forward -281 -267 2.16287 0.288
NP_441738.1_2 Forward -205 -198 15.28 0.0102
NP_441738.1_2 Reverse -200 -207 15.28 0.0102
NP_441558.1_5 Reverse -196 -215 4.03102 0.293
NP_441942.1_7 Forward -356 -337 13.8641 0.277
NP_440209.1_1 Reverse -198 -206 18.1123 0.00295
NP_440209.1_1 Forward -207 -199 18.1123 0.00295
NP_440447.1_1 Reverse -193 -211 2.96908 0.271
NP_440056.1_9 Reverse -381 -400 12.7991 0.295
NP_441713.1_1 Forward -213 -194 -3.24547 0.113
NP_441713.1_8 Forward -157 -139 14.4738 0.171
NP_441770.1_4 Forward -374 -355 -12.0953 0.291
NP_442570.1_3 Forward -172 -153 1.47442 0.194
NP_441025.1_5 Reverse -344 -358 15.5359 0.257
NP_441792.1_5 Reverse -133 -149 12.8416 0.19
NP_441716.1_1 Forward -48 -34 12.0943 0.0849
NP_441716.1_1 Reverse -161 -175 10.226 0.0968
NP_441716.1_1 Forward -207 -193 10.1277 0.0971
NP_441716.1_1 Reverse -198 -212 8.84938 0.13
NP_441716.1_1 Reverse -144 -158 7.47274 0.169
NP_441598.1_3 Reverse -138 -157 15.396 0.161
NP_442111.1_4 Forward -208 -194 20.3541 0.00311
NP_442111.1_4 Reverse -197 -211 1.86788 0.293
NP_441163.1_1 Forward -171 -154 4.26636 0.291
NP_441163.1_4 Reverse -133 -152 14.2758 0.277
NP_440906.1_5 Forward -206 -199 15.8704 0.0124
NP_440906.1_5 Reverse -199 -206 15.8704 0.0124
NP_440747.1_10 Forward -210 -198 17.2469 0.000522
NP_440747.1_10 Reverse -195 -207 7.80712 0.00223
NP_440747.1_10 Forward -126 -114 -2.51763 0.0509
NP_440747.1_10 Reverse -141 -153 -11.8591 0.161
NP_440747.1_10 Forward -173 -161 -12.5474 0.297
NP_442973.1_5 Reverse -189 -208 14.0608 0.156
NP_441486.1_1 Reverse -195 -209 -3.54032 0.179
NP_441486.1_1 Forward -210 -196 -4.4253 0.198
NP_442634.1_4 Forward -209 -195 15.6342 0.0115
NP_442634.1_4 Reverse -196 -210 6.29277 0.0508
NP_442634.1_4 Forward -155 -141 -4.91696 0.223
NP_440403.1_4 Forward -163 -144 -8.85033 0.261
NP_441695.1_8 Reverse -144 -158 16.9125 0.177
NP_442848.1_1 Reverse -192 -206 -1.47537 0.263
NP_442848.1_1 Forward -213 -199 -2.06536 0.263
NP_442848.1_1 Reverse -249 -263 -4.62196 0.298
NP_442848.1_5 Reverse -336 -354 9.85225 0.232
NP_442848.1_5 Reverse -356 -374 -3.32411 0.291
NP_441012.1_4 Reverse -194 -207 5.91914 0.286
NP_441012.1_4 Reverse -122 -135 5.62415 0.291
NP_443018.1_3 Forward -206 -199 14.8871 0.0123
NP_443018.1_3 Reverse -199 -206 14.8871 0.0123
NP_441316.1_7 Reverse -196 -211 14.7295 0.0486
NP_441634.1_8 Forward -17 -3 1.37622 0.198
NP_441634.1_8 Forward -172 -158 -3.73699 0.295
NP_441634.1_8 Reverse -355 -369 -4.7203 0.295
NP_440376.1_1 Forward -207 -198 19.4693 0.000692
NP_440376.1_1 Reverse -198 -207 19.4693 0.000692
NP_440376.1_1 Forward -164 -155 0.196389 0.283
NP_442730.1_8 Reverse -190 -209 3.53858 0.275
NP_442687.1_7 Reverse -197 -207 9.02648 0.0994
NP_442687.1_7 Forward -208 -198 8.92815 0.0994
NP_442191.1_4 Forward -152 -138 15.3562 0.0603
NP_442485.1_3 Forward -159 -140 10.0292 0.12
NP_441846.1_10 Forward -153 -134 -23.7966 0.298
NP_440042.1_2 Reverse -122 -141 -4.32711 0.293
NP_441422.1_7 Reverse -196 -213 -3.8944 0.237
NP_442296.1_5 Forward -162 -143 2.3594 0.26
NP_440360.1_5 Reverse -111 -130 0.786102 0.297
NP_442658.1_1 Reverse -196 -206 13.0576 0.04
NP_442658.1_1 Forward -209 -199 9.616 0.147
NP_440141.1_4 Reverse -135 -154 -9.44032 0.298
NP_442782.1_2 Forward -207 -193 1.57289 0.281
NP_442496.1_5 Forward -148 -130 7.00065 0.266
NP_442205.1_9 Forward -213 -197 -1.80975 0.264
NP_440656.1_8 Reverse -187 -206 -4.03212 0.198
NP_441414.1_9 Reverse -198 -217 -5.11376 0.169
NP_441487.1_6 Reverse -190 -209 1.0811 0.254
NP_442937.1_5 Forward -128 -109 6.4893 0.278
NP_442321.1_1 Forward -383 -364 1.17943 0.155
NP_441958.1_5 Reverse -197 -207 21.2195 0.000805
NP_441958.1_5 Forward -208 -198 12.2714 0.00183
NP_442486.1_4 Reverse -134 -153 13.1758 0.167
NP_440203.1_2 Reverse -35 -54 15.3391 0.201
NP_440203.1_5 Forward -204 -194 14.9258 0.0886
NP_440203.1_5 Reverse -135 -145 14.1392 0.0933
NP_440203.1_5 Reverse -201 -211 11.1893 0.202
NP_440984.1_7 Forward -212 -198 10.3243 0.126
NP_440984.1_7 Forward -53 -39 5.21113 0.265
NP_441162.1_3 Reverse -340 -359 12.8808 0.181
NP_439990.1_5 Forward -212 -199 9.75405 0.133
NP_439990.1_5 Forward -128 -115 9.16406 0.15
NP_439990.1_5 Reverse -300 -313 8.77074 0.162
NP_439990.1_5 Reverse -193 -206 8.18076 0.18
NP_439990.1_6 Reverse -78 -97 7.66927 0.251
NP_442376.1_2 Reverse -127 -146 -13.1769 0.286
NP_442911.1_2 Forward -217 -198 12.3892 0.0128
NP_442911.1_2 Reverse -188 -207 9.53756 0.0173
NP_440153.1_5 Forward -122 -108 1.67122 0.245
NP_442064.1_1 Forward -212 -193 -13.7669 0.298
NP_442064.1_4 Forward -133 -114 4.42355 0.287
NP_442051.1_3 Reverse -167 -186 14.1583 0.269
NP_443055.1_3 Forward -179 -160 13.2234 0.184
NP_443055.1_6 Reverse -124 -142 -2.63651 0.298
NP_440993.1_2 Reverse -193 -209 17.7581 0.0447
NP_440138.1_6 Forward -206 -187 9.53674 0.175
NP_441348.1_3 Reverse -109 -128 10.4225 0.198
NP_441099.1_5 Reverse -122 -141 -7.67036 0.179
NP_441099.1_5 Forward -293 -274 -10.4236 0.253
NP_442002.1_1 Forward -150 -132 2.0841 0.173
NP_440809.1_9 Reverse -189 -207 -7.55234 0.225
NP_441294.1_7 Reverse -157 -171 8.86667 0.274
NP_441646.1_1 Forward -214 -195 -1.7705 0.294
NP_442438.1_10 Forward -212 -198 3.44117 0.162
NP_442438.1_10 Reverse -193 -207 1.57289 0.191
NP_442431.1_7 Reverse -8 -27 7.86593 0.25
NP_442771.1_1 Forward -209 -191 -5.48739 0.166
NP_442771.1_1 Reverse -196 -214 -6.4707 0.168
NP_442771.1_1 Forward -143 -125 -9.51896 0.227
NP_440484.1_3 Forward -209 -195 8.35772 0.3
NP_440147.1_4 Reverse -196 -209 13.0973 0.0326
NP_440147.1_4 Forward -209 -196 1.49425 0.226
NP_441550.1_8 Forward -209 -199 16.7941 0.00906
NP_441550.1_8 Reverse -196 -206 13.0576 0.0273
NP_441916.1_7 Forward -207 -197 18.9579 0.00144
NP_441916.1_7 Reverse -198 -208 10.3048 0.0261
NP_441916.1_10 Reverse -190 -209 3.6377 0.227
NP_440206.1_4 Reverse -140 -159 4.03023 0.26
NP_440206.1_4 Reverse -134 -153 -0.00131823 0.289
NP_440206.1_4 Reverse -151 -170 -0.886293 0.29
NP_441041.1_4 Forward -358 -339 -8.16202 0.197
NP_441041.1_4 Forward -207 -188 -8.55534 0.204
NP_441041.1_7 Forward -210 -198 9.1668 0.12
NP_441041.1_7 Reverse -195 -207 6.34865 0.211
NP_442642.1_9 Reverse -191 -208 6.23369 0.192
NP_440569.1_7 Reverse -132 -151 17.5024 0.116
NP_443063.1_7 Forward -208 -192 4.87675 0.288
NP_442004.1_6 Forward -207 -193 6.48943 0.172
NP_442004.1_6 Reverse -198 -212 4.71948 0.204
NP_441725.1_4 Reverse -193 -207 12.9786 0.0693
NP_441725.1_4 Forward -286 -272 7.57046 0.227
NP_441725.1_5 Forward -206 -196 11.1898 0.0247
NP_441725.1_5 Reverse -199 -209 9.02648 0.0553
NP_441725.1_5 Reverse -306 -316 -1.29827 0.299
NP_439966.1_7 Reverse -196 -206 14.8275 0.0177
NP_439966.1_7 Forward -209 -199 14.8275 0.0177
NP_439966.1_9 Forward -209 -200 0.884706 0.253
NP_442941.1_3 Forward -206 -196 19.9412 0.00262
NP_442941.1_3 Reverse -199 -209 10.9931 0.0116
NP_440289.1_2 Reverse -195 -208 3.85419 0.0735
NP_440289.1_2 Forward -286 -273 1.00259 0.141
NP_440289.1_2 Forward -210 -197 -4.7006 0.294
NP_440983.1_5 Reverse -132 -151 -0.983855 0.228
NP_440260.1_8 Forward -132 -114 0.904127 0.193
NP_442281.1_1 Reverse -193 -207 17.6002 0.00542
NP_442281.1_1 Forward -212 -198 15.0436 0.0144
NP_442281.1_1 Reverse -57 -71 6.39049 0.127
NP_442281.1_1 Reverse -367 -381 4.8172 0.18
NP_442281.1_1 Reverse -139 -153 1.5723 0.296
NP_441334.1_7 Forward -209 -190 -9.34199 0.12
NP_442256.1_2 Forward -209 -191 7.29564 0.107
NP_440479.1_9 Reverse -123 -141 14.2771 0.297
NP_440437.1_1 Reverse -192 -211 9.0459 0.0525
NP_442012.1_1 Forward -213 -194 -0.0988766 0.251
NP_442982.1_5 Forward -217 -198 -2.55715 0.286
NP_442982.1_5 Reverse -188 -207 -3.14714 0.296
NP_443030.1_4 Reverse -337 -356 -4.6221 0.251
NP_441644.1_6 Forward -207 -197 19.0557 0.000803
NP_441644.1_6 Reverse -198 -208 17.3841 0.00127
NP_441644.1_6 Forward -153 -143 6.27276 0.163
NP_441644.1_6 Reverse -155 -165 3.42118 0.282
NP_441644.1_6 Reverse -161 -171 3.12618 0.297
NP_442215.1_2 Forward -209 -193 3.50012 0.0955
NP_442215.1_2 Forward -156 -140 -2.39974 0.197
NP_442029.1_1 Reverse -272 -291 -20.3551 0.297
NP_440253.1_2 Forward -207 -189 -3.22577 0.287
NP_440929.1_8 Forward -207 -198 19.2726 0.000701
NP_440929.1_8 Reverse -198 -207 19.2726 0.000701
NP_440566.1_6 Forward -155 -136 13.7658 0.18
NP_442933.1_10 Forward -207 -198 17.601 0.00325
NP_442933.1_10 Reverse -198 -207 17.601 0.00325
NP_441751.2_8 Reverse -199 -213 23.5007 0.00466
NP_441751.2_8 Forward -206 -192 7.9644 0.0327
NP_442926.1_1 Forward -159 -140 -6.09707 0.278
NP_442926.1_3 Reverse -28 -47 4.03102 0.272
NP_442554.1_8 Reverse -199 -209 18.0729 0.00543
NP_442554.1_8 Forward -206 -196 16.9913 0.0065
NP_442554.1_8 Forward -152 -142 5.5849 0.145
NP_442554.1_8 Reverse -145 -155 3.51995 0.222
NP_441762.1_7 Reverse -197 -209 2.79224 0.0676
NP_441762.1_7 Forward -208 -196 -6.94252 0.284
NP_442142.1_4 Reverse -195 -208 14.8666 0.0302
NP_442142.1_4 Forward -210 -197 14.08 0.0317
NP_442142.1_4 Reverse -117 -130 13.49 0.0348
NP_442142.1_4 Reverse -141 -154 3.55864 0.251
NP_442142.1_4 Reverse -204 -217 3.36198 0.258
NP_442292.1_1 Reverse -199 -208 18.486 0.00229
NP_442292.1_1 Forward -206 -197 17.5026 0.00435
NP_442292.1_5 Reverse -270 -289 -2.16383 0.282
NP_442476.1_6 Reverse -199 -213 10.226 0.0732
NP_443009.1_5 Forward -208 -197 14.5128 0.02
NP_443009.1_5 Reverse -197 -208 10.1862 0.0792
NP_442301.1_2 Reverse -122 -141 3.9319 0.284
NP_442408.2_1 Forward -207 -188 -4.81876 0.267
NP_441715.1_4 Forward -206 -196 14.238 0.0295
NP_441715.1_4 Reverse -199 -209 7.84651 0.107
NP_440881.1_10 Reverse -199 -212 13.4906 0.249
NP_440279.1_2 Forward -218 -199 14.5524 0.0756
NP_440158.1_8 Forward -209 -190 16.6174 0.12
NP_440158.1_8 Forward -137 -118 10.5209 0.249
NP_440158.1_8 Forward -156 -137 9.14423 0.285
NP_441198.1_8 Reverse -196 -206 13.2713 0.108
NP_440379.1_5 Forward -157 -138 3.04771 0.149
NP_441468.1_1 Forward -206 -199 15.8704 0.0124
NP_441468.1_1 Reverse -199 -206 15.8704 0.0124
NP_441468.1_1 Reverse -125 -132 6.72562 0.126
NP_440920.1_1 Forward -171 -152 6.39097 0.207
NP_441020.2_6 Forward -209 -192 19.6067 0.00737
NP_441015.1_10 Reverse -34 -53 0.58944 0.165
NP_441015.1_10 Forward -152 -133 -3.93378 0.195
NP_441015.1_10 Forward -212 -193 -6.39206 0.248
NP_441015.1_10 Forward -128 -109 -7.96535 0.272
NP_441673.1_1 Forward -207 -198 20.8459 0.000698
NP_441673.1_1 Reverse -198 -207 20.8459 0.000698
NP_441731.1_3 Forward -215 -196 -4.03212 0.284
NP_441339.1_4 Reverse -123 -142 -4.13045 0.242
NP_441826.1_2 Forward -213 -199 12.7826 0.0253
NP_441826.1_2 Reverse -155 -169 6.09611 0.0946
NP_441826.1_2 Reverse -192 -206 3.73617 0.106
NP_441826.1_2 Forward -42 -28 3.73617 0.106
NP_441826.1_2 Forward -276 -262 1.27789 0.157
NP_442490.1_9 Forward -219 -200 -5.31042 0.273
NP_442490.1_10 Reverse -144 -162 7.59063 0.295
NP_442868.1_6 Forward -209 -199 17.4829 0.012
NP_442868.1_6 Reverse -196 -206 1.06167 0.205
NP_441612.1_2 Reverse -161 -171 10.9696 0.21
NP_441612.1_2 Reverse -198 -208 8.54929 0.21
NP_443058.1_7 Forward -208 -189 10.9142 0.206
NP_442361.1_3 Reverse -192 -205 17.2272 0.0481
NP_442808.1_1 Forward -284 -274 13.4509 0.0481
NP_442808.1_1 Reverse -197 -207 8.73102 0.0481
NP_442808.1_1 Forward -208 -198 8.63269 0.0481
NP_442808.1_1 Reverse -131 -141 2.73286 0.256
NP_441101.1_10 Reverse -194 -213 -6.29373 0.289
NP_442775.1_4 Reverse -269 -288 17.2074 0.157
NP_442542.1_2 Reverse -153 -166 11.1307 0.114
NP_442542.1_9 Forward -359 -345 12.8803 0.108
NP_442050.1_5 Reverse -196 -206 18.0724 0.00365
NP_442050.1_5 Forward -209 -199 15.6142 0.01
NP_442050.1_8 Reverse -33 -52 13.0151 0.272
NP_442342.1_9 Reverse -130 -146 11.3666 0.12
NP_442342.1_9 Forward -209 -193 4.58176 0.247
NP_440558.1_2 Reverse -17 -36 -0.197208 0.198
NP_440558.1_2 Reverse -189 -208 -0.590531 0.204
NP_440558.1_2 Forward -132 -113 -3.04881 0.232
NP_440558.1_2 Reverse -129 -148 -5.80207 0.264
NP_442789.1_4 Forward -209 -190 5.30933 0.145
NP_442789.1_4 Forward -47 -28 -8.45701 0.299
NP_441878.1_6 Forward -154 -144 19.5479 0.0065
NP_441878.1_6 Reverse -197 -207 10.5014 0.0176
NP_441878.1_6 Forward -208 -198 10.4031 0.0176
NP_441878.1_6 Reverse -143 -153 1.06167 0.116
NP_441878.1_6 Forward -49 -39 0.0783647 0.152
NP_441878.1_6 Forward -171 -161 -7.68978 0.255
NP_441036.1_8 Reverse -197 -207 15.713 0.00724
NP_441036.1_8 Forward -208 -198 8.33817 0.174
NP_441557.1_5 Forward -207 -198 19.9609 0.000699
NP_441557.1_5 Reverse -198 -207 19.9609 0.000699
NP_441557.1_8 Forward -365 -355 12.7626 0.235
NP_441445.1_1 Forward -173 -154 0.687771 0.27
NP_441445.1_1 Reverse -189 -208 -0.000545616 0.283
NP_442066.2_9 Forward -211 -198 10.5407 0.154
NP_441308.1_8 Reverse -196 -206 13.353 0.218
NP_441381.1_6 Forward -245 -226 10.6192 0.231
NP_441458.1_10 Reverse -189 -208 3.73603 0.24
NP_442183.1_1 Forward -207 -193 18.2892 0.00781
NP_442183.1_1 Reverse -198 -212 17.2075 0.0118
NP_442397.1_9 Reverse -198 -217 5.89931 0.246
NP_440595.1_9 Reverse -33 -52 10.7175 0.187
NP_441574.1_1 Forward -207 -188 -6.39206 0.277
NP_441549.1_9 Forward -211 -193 3.85406 0.0925
NP_442347.1_2 Reverse -199 -208 12.4878 0.056
NP_442347.1_2 Forward -206 -197 3.34298 0.284
NP_440547.1_8 Reverse -112 -131 12.2908 0.298
NP_441037.1_4 Reverse -272 -282 9.75413 0.21
NP_441037.1_4 Forward -209 -199 9.55921 0.21
NP_441037.1_4 Reverse -196 -206 7.31769 0.237
NP_442594.1_10 Forward -21 -2 8.25844 0.288
NP_440151.1_5 Reverse -143 -162 6.88262 0.232
NP_441633.1_3 Reverse -196 -209 -3.4223 0.177
NP_441633.1_3 Forward -209 -196 -6.17557 0.238
NP_440136.1_2 Forward -206 -199 15.9687 0.0123
NP_440136.1_2 Reverse -199 -206 15.9687 0.0123
NP_442590.1_10 Forward -160 -141 13.2741 0.135
NP_442590.1_10 Forward -213 -194 4.81767 0.27
NP_442590.1_10 Forward -359 -340 4.42435 0.276
NP_442590.1_10 Forward -60 -41 3.83436 0.283
NP_442998.1_10 Forward -205 -198 15.5754 0.0102
NP_442998.1_10 Reverse -200 -207 15.5754 0.0102
NP_442998.1_10 Reverse -22 -29 7.21728 0.144
NP_440899.1_2 Reverse -187 -206 11.6017 0.129
NP_440899.1_5 Reverse -122 -141 3.24438 0.265
NP_440299.1_1 Reverse -194 -207 13.195 0.0319
NP_440299.1_1 Forward -211 -198 12.1134 0.0425
NP_440299.1_1 Reverse -368 -381 8.77016 0.0851
NP_441799.1_1 Forward -211 -197 15.4369 0.0182
NP_441799.1_1 Reverse -23 -37 7.3738 0.144
NP_441799.1_1 Reverse -194 -208 6.48882 0.17
NP_441799.1_1 Reverse -257 -271 3.8339 0.279
NP_441007.1_10 Forward -212 -199 18.4072 0.0299
NP_441007.1_10 Reverse -193 -206 1.10092 0.209
NP_442333.2_5 Reverse -187 -206 -15.6352 0.299
NP_440256.1_1 Forward -210 -191 6.19431 0.0314
NP_440256.1_1 Reverse -340 -359 1.0811 0.0789
NP_440256.1_1 Forward -160 -141 -4.22878 0.15
NP_440256.1_1 Forward -126 -107 -10.1286 0.295
NP_441229.1_10 Reverse -176 -195 -1.18052 0.288
NP_443042.1_3 Reverse -374 -392 12.6055 0.295
NP_441559.1_8 Reverse -193 -207 1.27789 0.156
NP_441559.1_8 Forward -158 -144 -7.47356 0.294
NP_441395.1_3 Reverse -73 -92 21.5339 0.0981
NP_440915.1_6 Forward -211 -197 12.7826 0.0206
NP_440915.1_6 Reverse -194 -208 3.8345 0.1
NP_440915.1_6 Forward -145 -131 -0.492064 0.197
NP_440915.1_6 Reverse -140 -154 -1.5737 0.239
NP_440915.1_6 Reverse -120 -134 -3.24533 0.292
NP_442855.1_3 Reverse -146 -165 13.0775 0.228
NP_441704.1_8 Reverse -300 -319 5.89851 0.273
NP_441704.1_8 Forward -325 -306 5.30853 0.297
NP_442866.1_1 Forward -212 -193 11.3075 0.0767
NP_442866.1_1 Forward -159 -140 1.86774 0.158
NP_440748.1_5 Reverse -135 -154 -2.36049 0.273
NP_441464.1_8 Forward -29 -15 6.88276 0.222
NP_441199.1_6 Reverse -194 -213 14.0608 0.0427
NP_441199.1_6 Forward -145 -126 -1.7705 0.298
NP_439985.1_7 Forward -159 -140 17.994 0.148
NP_442993.1_1 Reverse -198 -214 -8.69292 0.173
NP_442993.1_1 Forward -352 -336 -11.7412 0.257
NP_442386.1_9 Forward -208 -199 13.8639 0.0289
NP_442386.1_9 Reverse -197 -206 6.39082 0.219
NP_441750.1_1 Forward -147 -128 4.71934 0.124
NP_441340.1_5 Forward -206 -199 15.6737 0.0124
NP_441340.1_5 Reverse -199 -206 15.6737 0.0124
NP_442484.1_2 Reverse -133 -152 -1.57384 0.294
NP_442791.1_10 Reverse -125 -144 16.3224 0.296
NP_440168.1_9 Forward -209 -190 -1.96717 0.28
NP_441776.1_5 Reverse -194 -213 10.2259 0.291
NP_440161.1_3 Forward -209 -190 9.93088 0.237
NP_440586.1_8 Forward -206 -199 13.2151 0.026
NP_440586.1_8 Reverse -199 -206 13.2151 0.026
NP_442251.1_6 Forward -206 -199 15.2804 0.0124
NP_442251.1_6 Reverse -199 -206 15.2804 0.0124
NP_442251.1_6 Reverse -306 -313 8.69224 0.199
NP_440192.1_4 Reverse -127 -146 9.68867 0.268
NP_440684.1_9 Forward -213 -199 10.521 0.195
NP_441262.1_3 Reverse -198 -205 14.7888 0.0223
NP_441262.1_3 Forward -207 -200 14.7888 0.0223
NP_441262.1_3 Forward -314 -307 5.15232 0.265
NP_440027.1_3 Reverse -138 -156 7.78652 0.205
NP_440027.1_3 Reverse -139 -157 4.24662 0.262
NP_443051.1_1 Reverse -197 -206 19.5676 0.00335
NP_443051.1_1 Forward -208 -199 10.4228 0.00754
NP_440451.1_10 Reverse -133 -152 7.07848 0.292
NP_439937.1_8 Forward -209 -190 -3.73712 0.271
NP_440408.1_7 Forward -153 -134 14.1591 0.171
NP_440408.1_7 Forward -154 -135 10.0292 0.253
NP_440439.1_1 Reverse -195 -208 9.06573 0.0475
NP_440439.1_1 Forward -210 -197 8.27909 0.0547
NP_440439.1_1 Reverse -141 -154 -0.177378 0.209
NP_440372.1_2 Forward -206 -199 16.3621 0.0124
NP_440372.1_2 Reverse -199 -206 16.3621 0.0124
NP_440574.1_3 Forward -319 -300 -0.983855 0.299
NP_441789.1_7 Reverse -134 -153 0.686995 0.245
NP_440316.1_10 Forward -154 -144 8.33817 0.24
NP_440316.1_10 Forward -164 -154 7.55152 0.246
NP_439977.1_5 Forward -213 -194 2.26107 0.176
NP_441572.1_7 Reverse -138 -157 -0.983855 0.186
NP_441572.1_7 Forward -213 -194 -5.31042 0.257
NP_440267.1_2 Reverse -193 -207 9.6354 0.156
NP_442384.1_10 Forward -207 -194 15.4572 0.00986
NP_442384.1_10 Reverse -198 -211 9.45906 0.0536
NP_442384.1_10 Reverse -144 -157 2.08423 0.237
NP_440693.1_8 Forward -175 -156 12.9791 0.27
NP_442035.1_7 Forward -99 -80 15.6917 0.285
NP_441018.1_7 Forward -211 -192 9.73422 0.218
NP_441018.1_7 Forward -133 -114 9.63589 0.22
NP_441018.1_10 Reverse -140 -159 15.9282 0.236
NP_442790.1_4 Forward -216 -197 18.289 0.0194
NP_442262.1_7 Forward -144 -125 20.1006 0.16
NP_442262.1_10 Forward -206 -199 14.1988 0.0123
NP_442262.1_10 Reverse -199 -206 14.1988 0.0123
NP_441689.1_5 Reverse -196 -206 17.8758 0.0158
NP_441689.1_5 Forward -209 -199 5.87944 0.197
NP_440163.1_10 Forward -167 -157 10.0098 0.213
NP_440344.1_10 Reverse -191 -208 9.47861 0.00838
NP_440282.1_10 Reverse -134 -153 7.96426 0.115
NP_440282.1_10 Forward -58 -39 0.491109 0.192
NP_440282.1_10 Forward -139 -120 -5.9004 0.25
NP_440531.1_6 Reverse -335 -354 -2.55715 0.253
NP_440531.1_6 Forward -161 -142 -3.04881 0.26
NP_441060.1_3 Reverse -141 -160 12.2908 0.184
NP_440826.1_5 Reverse -357 -375 14.9958 0.231
NP_440562.1_3 Reverse -199 -216 4.56207 0.192
NP_441965.1_10 Reverse -195 -211 5.46674 0.204
NP_441965.1_10 Reverse -36 -52 3.30346 0.266
NP_442693.1_7 Reverse -93 -112 16.0274 0.202
NP_440297.1_1 Reverse -123 -142 13.1758 0.134
NP_440297.1_2 Reverse -89 -107 25.2902 0.0117
NP_440297.1_4 Reverse -235 -254 13.7658 0.144
NP_440297.1_5 Reverse -201 -220 26.4505 0.00235
NP_440297.1_6 Reverse -19 -38 24.0905 0.0199
NP_440297.1_9 Forward -206 -196 9.22315 0.0917
NP_440297.1_9 Reverse -145 -155 0.275027 0.282
NP_440297.1_9 Reverse -199 -209 -0.216628 0.282
NP_440350.1_1 Reverse -341 -360 -3.63879 0.236
NP_441592.1_4 Reverse -198 -217 -1.08219 0.247
NP_440894.1_10 Forward -31 -12 6.4893 0.215
NP_440999.1_9 Forward -211 -197 7.27608 0.0893
NP_440999.1_9 Reverse -194 -208 3.44117 0.13
NP_440888.1_2 Forward -207 -193 13.9619 0.022
NP_440888.1_2 Reverse -198 -212 13.2736 0.0307
NP_440888.1_2 Forward -123 -109 10.5204 0.0919
NP_440888.1_2 Forward -20 -6 7.3738 0.198
NP_440600.1_4 Reverse -190 -208 1.88744 0.125
NP_440491.1_1 Forward -210 -191 9.06107 0.219
NP_441949.1_2 Reverse -119 -138 0.884433 0.294
NP_441543.1_2 Reverse -199 -208 16.9127 0.00359
NP_441543.1_2 Forward -206 -197 15.9293 0.00518
NP_441543.1_2 Reverse -162 -171 8.55452 0.0988
NP_442845.1_2 Forward -213 -199 15.0442 0.0763
NP_442845.1_2 Reverse -192 -206 4.03116 0.271
NP_441551.1_5 Forward -211 -195 19.3307 0.034
NP_441551.1_5 Forward -157 -141 10.4809 0.193
NP_441178.1_6 Reverse -129 -148 4.81688 0.268
NP_440982.1_1 Reverse -132 -151 10.3234 0.212
NP_441469.1_8 Forward -353 -344 10.6195 0.206
NP_441469.1_8 Reverse -197 -206 6.5879 0.227
NP_441469.1_8 Forward -208 -199 6.48957 0.227
NP_443064.1_6 Reverse -198 -208 12.5669 0.0796
NP_443064.1_6 Reverse -114 -124 11.5004 0.13
NP_443064.1_6 Forward -207 -197 10.8217 0.13
NP_442578.1_7 Forward -206 -199 14.5921 0.026
NP_442578.1_7 Reverse -199 -206 14.5921 0.026
NP_440710.1_1 Reverse -190 -208 -1.75081 0.185
NP_441462.1_2 Forward -207 -197 20.2362 0.000805
NP_441462.1_2 Reverse -198 -208 11.5831 0.00406
NP_441621.1_7 Forward -209 -195 4.52282 0.0934
NP_441621.1_7 Reverse -196 -210 -2.75368 0.188
NP_443062.1_1 Forward -207 -189 11.4711 0.0984
NP_440519.1_8 Forward -207 -191 1.33684 0.288
NP_442204.1_1 Reverse -194 -205 19.2332 0.0136
NP_442204.1_1 Reverse -140 -151 9.59678 0.0736
NP_442204.1_1 Forward -145 -134 0.648657 0.281
NP_441560.1_3 Reverse -27 -45 5.91901 0.285
NP_441560.1_10 Reverse -190 -209 18.4857 0.0867
NP_440544.1_2 Forward -144 -125 3.34271 0.284
NP_440516.1_8 Forward -207 -198 16.9127 0.00442
NP_440516.1_8 Reverse -198 -207 16.9127 0.00442
NP_442428.1_5 Forward -206 -199 15.8704 0.0124
NP_442428.1_5 Reverse -199 -206 15.8704 0.0124
NP_440673.1_3 Forward -205 -198 12.4288 0.0426
NP_440673.1_3 Reverse -200 -207 12.4288 0.0426
NP_440673.1_7 Reverse -187 -206 0.58944 0.267
NP_440673.1_7 Reverse -150 -169 -0.295539 0.29
NP_441052.1_2 Reverse -198 -208 19.9412 0.00106
NP_441052.1_2 Forward -170 -160 11.2881 0.0285
NP_441052.1_2 Forward -207 -197 10.4031 0.0285
NP_441052.1_2 Reverse -161 -171 4.3066 0.161
NP_441052.1_2 Forward -48 -38 1.16001 0.25
NP_442219.1_9 Reverse -199 -208 17.7976 0.00718
NP_442219.1_9 Forward -206 -197 8.25953 0.0681
NP_442219.1_9 Forward -365 -356 2.06468 0.289
NP_440436.1_4 Reverse -199 -208 17.2072 0.00233
NP_440436.1_4 Forward -206 -197 9.24241 0.0871
NP_440436.1_4 Reverse -133 -142 6.78414 0.147
NP_441884.1_9 Forward -210 -191 -23.6983 0.284
NP_441884.1_9 Reverse -195 -214 -25.1733 0.29
NP_440314.1_9 Reverse -199 -218 1.86774 0.0872
NP_440041.1_2 Forward -137 -118 -0.0988766 0.187
NP_440041.1_2 Forward -209 -190 -4.72043 0.293
NP_441719.1_4 Forward -206 -199 16.3621 0.0124
NP_441719.1_4 Reverse -199 -206 16.3621 0.0124
NP_441733.1_10 Forward -210 -197 7.78743 0.15
NP_441004.1_1 Forward -147 -128 -5.21209 0.175
NP_441004.1_1 Forward -213 -194 -12.3902 0.247
NP_441004.1_1 Reverse -126 -145 -18.0934 0.297
NP_442813.1_4 Forward -232 -213 -4.6221 0.299
NP_442366.1_3 Forward -208 -190 5.23069 0.0885
NP_442366.1_3 Reverse -197 -215 -3.32411 0.246
NP_442366.1_5 Reverse -271 -281 10.6976 0.245
NP_440129.1_10 Reverse -191 -205 16.8142 0.0373
NP_443029.1_8 Forward -136 -117 11.1109 0.293
NP_443029.1_8 Forward -183 -164 11.0125 0.293
NP_440296.1_6 Forward -336 -318 11.1745 0.295
NP_440296.1_10 Forward -210 -191 -14.5535 0.27
NP_441115.1_4 Reverse -143 -161 8.86816 0.234
NP_442206.1_10 Forward -207 -192 15.8112 0.0799
NP_442206.1_10 Reverse -198 -213 6.76473 0.178
NP_443054.1_2 Reverse -143 -157 7.86607 0.136
NP_443054.1_2 Reverse -196 -210 2.85119 0.24
NP_441851.1_9 Forward -150 -131 9.83255 0.239
NP_441851.1_10 Forward -208 -198 15.8113 0.00552
NP_441851.1_10 Reverse -197 -207 8.53483 0.114
NP_442208.1_5 Reverse -358 -377 -8.45701 0.275
NP_442208.1_5 Reverse -37 -56 -10.4236 0.299
NP_442856.1_7 Forward -57 -38 -5.70374 0.286
NP_441668.1_4 Reverse -17 -36 10.1275 0.112
NP_441668.1_4 Forward -217 -198 2.0644 0.205
NP_442515.1_1 Reverse -160 -174 5.80112 0.106
NP_442515.1_1 Reverse -197 -211 4.71948 0.107
NP_442515.1_1 Reverse -129 -143 0.982901 0.174
NP_442515.1_1 Reverse -356 -370 -1.5737 0.257
NP_442515.1_1 Reverse -310 -324 -2.06536 0.268
NP_442515.1_1 Forward -30 -16 -2.06536 0.268
NP_442515.1_1 Forward -208 -194 -4.91696 0.298
NP_440593.1_3 Reverse -109 -128 7.47261 0.109
NP_440593.1_3 Reverse -127 -146 3.44104 0.155
NP_440593.1_3 Reverse -181 -200 -3.24547 0.233
NP_440593.1_3 Reverse -28 -47 -4.6221 0.251
NP_440463.1_7 Forward -136 -122 15.6342 0.248
NP_440165.1_5 Forward -208 -189 3.24438 0.103
NP_442709.1_3 Forward -214 -195 7.86593 0.121
NP_440940.1_7 Reverse -188 -206 5.52492 0.225
NP_441349.1_10 Reverse -188 -207 3.04771 0.0704
NP_441349.1_10 Forward -145 -126 -6.78538 0.236
NP_441349.1_10 Forward -217 -198 -8.16202 0.269
NP_441409.1_6 Reverse -192 -211 0.0977854 0.0655
NP_441409.1_6 Forward -213 -194 -7.08038 0.142
NP_442843.1_1 Reverse -12 -31 -3.93378 0.23
NP_439960.1_10 Forward -130 -112 6.90232 0.138
NP_441150.1_6 Reverse -129 -148 18.8781 0.0874
NP_441477.1_5 Reverse -140 -159 6.78429 0.277
NP_441477.1_10 Forward -214 -196 4.24738 0.203
NP_442450.1_5 Reverse -196 -206 9.41981 0.115
NP_440588.1_2 Forward -144 -125 5.01433 0.0729
NP_440588.1_2 Forward -216 -197 0.884433 0.143
NP_442006.1_2 Forward -361 -344 -5.56602 0.143
NP_442006.1_3 Forward -147 -129 -6.4707 0.298
NP_441003.1_9 Reverse -152 -171 8.75091 0.224
NP_441003.1_9 Reverse -135 -154 5.30933 0.266
NP_441003.1_9 Forward -45 -26 5.11266 0.268
NP_441003.1_9 Forward -57 -38 4.52268 0.277
NP_441570.1_1 Forward -207 -189 9.45892 0.0113
NP_441570.1_1 Reverse -114 -132 -10.7973 0.18
NP_441570.1_1 Forward -170 -152 -11.1906 0.189
NP_441570.1_1 Forward -123 -105 -12.1739 0.209
NP_441078.1_4 Forward -207 -198 19.6659 0.0007
NP_441078.1_4 Reverse -198 -207 19.6659 0.0007
NP_441078.1_4 Forward -170 -161 5.99792 0.0932
NP_441078.1_4 Reverse -144 -153 -1.37691 0.254
NP_441078.1_4 Forward -153 -144 -1.47524 0.266
NP_441078.1_4 Reverse -161 -170 -1.77023 0.266
NP_442729.1_5 Forward -142 -132 8.82982 0.244
NP_442729.1_8 Forward -211 -198 9.95071 0.125
NP_441663.1_7 Reverse -33 -52 8.55425 0.209
NP_441663.1_8 Reverse -192 -211 13.7658 0.0588
NP_442443.1_1 Forward -149 -130 -2.95047 0.264
NP_441094.1_3 Reverse -75 -92 10.7569 0.173
NP_440526.1_3 Reverse -199 -210 17.7577 0.0398
NP_440526.1_3 Forward -313 -302 7.23633 0.156
NP_440526.1_3 Reverse -133 -144 5.46638 0.247
NP_441432.1_8 Reverse -197 -206 16.8143 0.00595
NP_441432.1_8 Forward -208 -199 16.8143 0.00595
NP_441432.1_8 Reverse -113 -122 5.40793 0.158
NP_441432.1_8 Reverse -26 -35 4.91628 0.196
NP_441432.1_8 Forward -171 -162 2.94966 0.28
NP_441432.1_8 Reverse -10 -19 2.85133 0.281
NP_442320.1_8 Reverse -299 -313 -4.13031 0.148
NP_442320.1_8 Forward -213 -199 -4.13031 0.148
NP_442320.1_8 Reverse -192 -206 -4.52363 0.171
NP_441732.1_2 Reverse -194 -210 21.298 0.00205
NP_441732.1_2 Forward -127 -111 -14.1995 0.145
NP_440629.1_6 Reverse -192 -211 17.6778 0.078
NP_440760.1_1 Reverse -198 -217 -7.27704 0.0696
NP_442797.1_7 Forward -142 -124 2.47742 0.239
NP_442797.1_7 Reverse -350 -368 -0.374176 0.282
NP_441945.1_10 Forward -136 -117 9.14423 0.269
NP_441945.1_10 Forward -208 -189 7.47261 0.284
NP_440913.1_1 Forward -209 -191 5.03403 0.252
NP_442727.1_10 Reverse -297 -316 -3.54046 0.256
NP_442968.1_8 Forward -157 -138 19.6656 0.116
NP_441072.1_2 Forward -218 -199 6.98095 0.261
NP_442010.1_9 Forward -368 -354 15.8302 0.175
NP_442489.1_7 Forward -207 -198 20.1576 0.000695
NP_442489.1_7 Reverse -198 -207 20.1576 0.000695
NP_442489.1_7 Reverse -144 -153 -1.37691 0.195
NP_442489.1_7 Forward -153 -144 -1.47524 0.203
NP_442489.1_7 Forward -123 -114 -1.6719 0.235
NP_442489.1_7 Forward -170 -161 -1.77023 0.247
NP_442079.1_7 Forward -206 -187 6.19431 0.162
NP_440559.1_1 Reverse -199 -208 17.4043 0.00658
NP_440559.1_1 Forward -206 -197 8.65285 0.0586
NP_440559.1_1 Forward -313 -304 4.81794 0.193
NP_441659.2_8 Forward -207 -197 20.9245 0.000805
NP_441659.2_8 Reverse -198 -208 18.1713 0.00133
NP_442913.1_10 Reverse -348 -367 -3.63879 0.214
NP_442008.1_2 Forward -156 -137 6.68596 0.217
NP_442008.1_2 Forward -210 -191 5.89931 0.223
NP_440708.1_6 Reverse -116 -135 5.60432 0.132
NP_440708.1_6 Reverse -134 -153 0.884433 0.188
NP_441800.1_3 Forward -152 -134 3.75572 0.289
NP_442346.1_5 Forward -208 -198 16.6963 0.00248
NP_442346.1_5 Reverse -197 -207 16.303 0.00248
NP_442346.1_5 Forward -171 -161 7.74818 0.159
NP_442346.1_5 Forward -154 -144 6.46988 0.201
NP_442346.1_5 Reverse -143 -153 4.99491 0.267
NP_442346.1_10 Reverse -127 -146 -2.85214 0.294
NP_442346.1_10 Forward -59 -40 -3.63879 0.294
NP_440545.1_3 Forward -211 -194 15.3785 0.0132
NP_440545.1_3 Reverse -194 -211 8.49531 0.0444
NP_440545.1_3 Forward -157 -140 2.98877 0.0903
NP_440545.1_3 Reverse -140 -157 0.333834 0.141
NP_440545.1_3 Reverse -35 -52 -1.0428 0.162
NP_440459.1_2 Forward -361 -344 14.2968 0.119
NP_440459.1_2 Forward -162 -145 9.18362 0.233
NP_441653.1_2 Reverse -238 -257 2.17674 0.299
NP_441653.1_3 Forward -18 -4 12.7826 0.279
NP_442603.1_7 Reverse -198 -212 14.1586 0.0731
NP_442603.1_7 Forward -207 -193 8.25877 0.178
NP_441585.1_5 Reverse -138 -157 1.57197 0.285
NP_441888.1_7 Reverse -193 -207 3.63784 0.225
NP_440449.1_6 Reverse -124 -142 6.89415 0.239
NP_441948.1_4 Reverse -267 -285 -3.81576 0.207
NP_441047.1_2 Reverse -344 -363 0.884433 0.239
NP_441502.1_3 Forward -209 -190 9.93088 0.21
NP_441833.1_4 Forward -206 -199 15.9687 0.0124
NP_441833.1_4 Reverse -199 -206 15.9687 0.0124
NP_441112.1_6 Forward -362 -343 5.89931 0.172
NP_442162.1_9 Forward -206 -199 16.2637 0.0124
NP_442162.1_9 Reverse -199 -206 16.2637 0.0124
NP_440671.1_4 Forward -42 -28 16.7159 0.0263
NP_440671.1_4 Reverse -192 -206 11.406 0.133
NP_440671.1_4 Forward -276 -262 5.99778 0.266
NP_441341.1_7 Forward -388 -369 12.1925 0.283
NP_442199.1_5 Reverse -190 -209 -3.3438 0.205
NP_442140.1_3 Reverse -199 -209 13.5497 0.0542
NP_442140.1_3 Forward -140 -130 4.40493 0.243
NP_442021.1_3 Forward -213 -194 -6.1954 0.257
NP_440875.1_9 Reverse -200 -210 9.3454 0.233
NP_440875.1_9 Forward -205 -195 8.27469 0.233
NP_440875.1_9 Reverse -41 -51 7.30133 0.269
NP_440875.1_9 Reverse -141 -151 6.81464 0.297
NP_441813.1_5 Reverse -196 -206 15.9097 0.01
NP_441813.1_5 Forward -209 -199 8.73149 0.0367
NP_440590.1_4 Reverse -149 -162 0.707601 0.144
NP_440590.1_4 Reverse -199 -212 -4.01229 0.257
NP_440590.1_4 Forward -313 -300 -5.58558 0.283
NP_440567.1_1 Reverse -199 -213 13.2743 0.0213
NP_440567.1_1 Forward -206 -192 11.2093 0.0294
NP_440567.1_6 Reverse -199 -218 6.78429 0.228
NP_442497.1_1 Reverse -108 -127 7.96345 0.275
NP_442497.1_10 Forward -206 -197 17.601 0.00813
NP_442497.1_10 Reverse -199 -208 10.4228 0.0087
NP_440821.1_4 Forward -209 -199 17.9746 0.00497
NP_440821.1_4 Reverse -196 -206 11.0914 0.0146
NP_441239.1_9 Reverse -196 -208 12.1337 0.0494
NP_441239.1_9 Forward -155 -143 11.7404 0.0551
NP_441239.1_9 Reverse -142 -154 7.21714 0.169
NP_441239.1_9 Forward -209 -197 7.11881 0.169
NP_441239.1_9 Reverse -122 -134 6.72548 0.178
NP_441951.1_9 Reverse -153 -172 -1.67217 0.298
NP_441009.1_4 Forward -207 -188 14.4541 0.167
NP_441727.1_3 Reverse -191 -210 10.4225 0.166
NP_441727.1_3 Forward -214 -195 2.65439 0.299
NP_441892.1_1 Reverse -189 -206 14.7885 0.032
NP_441892.1_1 Forward -150 -133 1.21881 0.155
NP_441892.1_1 Reverse -152 -169 -3.99273 0.253
NP_440604.1_6 Forward -207 -188 17.8957 0.0305
NP_442044.1_1 Reverse -193 -212 3.6377 0.131
NP_442193.1_8 Forward -267 -248 11.8967 0.249
NP_442270.1_9 Forward -357 -338 -8.35868 0.217
NP_440949.1_7 Reverse -190 -209 9.14342 0.264
NP_440354.1_5 Forward -210 -191 6.39097 0.179
NP_442138.1_10 Forward -207 -188 -3.54046 0.242
NP_440546.1_4 Forward -207 -197 13.5365 0.0459
NP_440546.1_4 Reverse -198 -208 10.046 0.109
NP_440546.1_4 Forward -141 -131 8.10685 0.203
NP_440546.1_4 Reverse -372 -382 7.91294 0.214
NP_440546.1_4 Forward -153 -143 7.23423 0.252
NP_441230.1_5 Reverse -127 -146 4.22769 0.188
NP_440462.1_6 Reverse -196 -206 16.893 0.00853
NP_440462.1_6 Forward -209 -199 10.3048 0.0396
NP_440868.1_4 Forward -211 -199 16.4603 0.0149
NP_440868.1_4 Reverse -194 -206 6.1355 0.0878
NP_440868.1_8 Forward -211 -192 4.42435 0.103
NP_442499.1_1 Reverse -193 -212 2.85105 0.279
NP_442479.1_9 Forward -383 -364 2.65439 0.191
NP_441474.1_1 Reverse -134 -153 2.6536 0.247
NP_442402.1_6 Reverse -354 -363 12.9794 0.289
NP_442402.1_10 Forward -365 -355 15.5158 0.175
NP_441084.1_6 Reverse -9 -23 10.8954 0.226
NP_441084.1_6 Forward -50 -36 10.4106 0.241
NP_439942.1_7 Forward -155 -136 2.3594 0.19
NP_440696.1_3 Reverse -144 -162 4.44404 0.198
NP_440696.1_3 Forward -157 -139 1.10079 0.22
NP_440696.1_3 Forward -163 -145 -3.12744 0.282
NP_442023.1_1 Reverse -129 -148 13.5683 0.285
NP_442039.1_4 Forward -206 -199 15.1821 0.0124
NP_442039.1_4 Reverse -199 -206 15.1821 0.0124
NP_441811.1_8 Forward -326 -312 11.3077 0.218
NP_441811.1_8 Forward -144 -130 6.3911 0.273
NP_441811.1_8 Reverse -126 -140 5.60446 0.294
NP_440008.1_9 Forward -147 -128 12.1925 0.187
NP_442837.1_3 Forward -206 -199 15.7721 0.0124
NP_442837.1_3 Reverse -199 -206 15.7721 0.0124
NP_440160.1_2 Reverse -337 -356 -0.983855 0.232
NP_440160.1_2 Reverse -143 -162 -7.17871 0.283
NP_440160.1_2 Forward -153 -134 -8.26035 0.286
NP_439994.1_3 Reverse -197 -216 15.5598 0.0919
NP_442053.1_1 Forward -207 -198 18.3876 0.0007
NP_442053.1_1 Reverse -198 -207 18.3876 0.0007
NP_440505.1_3 Forward -209 -199 16.598 0.00683
NP_440505.1_3 Reverse -196 -206 15.123 0.014
NP_440505.1_3 Reverse -355 -365 6.66654 0.172
NP_441102.1_1 Forward -206 -187 6.98095 0.231
NP_441102.1_4 Reverse -247 -266 18.3873 0.245
NP_441203.1_1 Forward -206 -187 -3.44213 0.0699
NP_441203.1_1 Reverse -199 -218 -10.817 0.137
NP_441203.1_1 Reverse -262 -281 -12.9802 0.149
NP_440914.1_1 Reverse -198 -208 17.5935 0.000537
NP_440914.1_1 Forward -207 -197 16.3248 0.00196
NP_441011.1_8 Forward -206 -197 16.6177 0.00602
NP_441011.1_8 Reverse -199 -208 8.25953 0.144
NP_442101.1_10 Reverse -190 -209 -7.08038 0.209
NP_442533.1_6 Forward -207 -198 17.2076 0.00137
NP_442533.1_6 Reverse -198 -207 17.2076 0.00137
NP_442533.1_6 Reverse -144 -153 13.8644 0.0178
NP_442533.1_6 Forward -157 -148 9.14451 0.0664
NP_442533.1_6 Forward -153 -144 7.17789 0.0948
NP_442533.1_6 Reverse -161 -170 5.80125 0.128
NP_442533.1_6 Forward -48 -39 4.62128 0.179
NP_442533.1_6 Reverse -39 -48 4.0313 0.194
NP_442533.1_6 Forward -352 -343 2.94966 0.232
NP_442533.1_6 Forward -133 -124 2.26134 0.266
NP_442533.1_6 Reverse -155 -164 2.06468 0.275
NP_442541.1_10 Reverse -144 -158 11.602 0.182
NP_442541.1_10 Reverse -161 -175 2.16228 0.265
NP_442541.1_10 Forward -48 -34 1.17898 0.29
NP_442322.1_4 Reverse -136 -153 -9.49991 0.295
NP_442229.1_3 Forward -144 -127 14.0018 0.282
NP_443016.1_1 Reverse -192 -211 -2.85214 0.225
NP_441219.1_6 Forward -124 -106 11.2289 0.22
NP_441482.1_7 Reverse -192 -206 15.7325 0.00937
NP_441482.1_7 Forward -213 -199 -10.6202 0.211
NP_441482.1_7 Forward -129 -115 -10.8168 0.216
NP_439944.1_9 Reverse -199 -209 19.1546 0.00329
NP_439944.1_9 Forward -206 -196 17.6796 0.00347
NP_439944.1_9 Forward -313 -303 5.97822 0.206
NP_442269.1_10 Forward -140 -121 5.99764 0.237
NP_441028.1_6 Forward -364 -354 5.78111 0.243
NP_440116.1_5 Forward -210 -193 16.9518 0.0499
NP_440116.1_8 Forward -206 -187 -5.21209 0.188
NP_440115.1_6 Forward -210 -200 18.9579 0.0139
NP_440115.1_6 Reverse -195 -205 7.45319 0.147
NP_440007.1_9 Reverse -194 -208 11.996 0.163
NP_440007.1_9 Reverse -340 -354 1.17956 0.29
NP_442728.1_5 Forward -156 -137 20.7473 0.112
NP_441347.1_5 Forward -213 -199 11.4053 0.255
NP_441602.1_3 Forward -212 -193 -4.91709 0.277
NP_442673.1_5 Forward -321 -303 17.6204 0.15
NP_441972.1_5 Reverse -115 -134 7.37428 0.0748
NP_441972.1_5 Reverse -187 -206 2.75272 0.121
NP_441972.1_5 Forward -169 -150 -3.54046 0.2
NP_441972.1_5 Forward -292 -273 -4.42544 0.211
NP_441106.1_1 Reverse -197 -206 18.486 0.0028
NP_441106.1_1 Forward -208 -199 9.63616 0.0311
NP_441106.1_1 Reverse -143 -152 2.75299 0.261
NP_441420.1_1 Forward -142 -123 -0.885524 0.262
NP_440429.1_9 Reverse -161 -180 2.55606 0.278
NP_441815.1_3 Reverse -125 -144 8.55425 0.257
NP_439903.1_6 Forward -210 -191 10.4217 0.106
NP_439903.1_6 Reverse -195 -214 9.63507 0.12
NP_441286.1_1 Forward -208 -196 14.3953 0.00424
NP_441286.1_1 Reverse -197 -209 12.232 0.00999
NP_441286.1_1 Forward -315 -303 -1.14099 0.14
NP_442674.1_3 Reverse -190 -209 9.7334 0.174
NP_442674.1_10 Reverse -247 -266 11.4058 0.215
NP_440670.1_8 Forward -207 -198 18.3876 0.000699
NP_440670.1_8 Reverse -198 -207 18.3876 0.000699
NP_441930.1_2 Reverse -249 -259 11.8781 0.271
NP_440886.1_7 Reverse -197 -207 8.04271 0.0805
NP_440886.1_7 Forward -208 -198 7.94438 0.0805
NP_440886.1_7 Forward -46 -36 5.09279 0.201
NP_442614.1_2 Reverse -198 -212 9.2427 0.242
NP_442382.1_9 Forward -127 -108 10.815 0.281
NP_441753.1_10 Reverse -189 -208 1.47442 0.264
NP_442963.1_7 Reverse -258 -277 12.6841 0.204
NP_440907.2_8 Reverse -199 -209 10.8943 0.0969
NP_440907.2_8 Forward -206 -196 9.51767 0.103
NP_442264.1_2 Forward -324 -307 17.5418 0.0953
NP_442264.1_2 Forward -211 -194 5.44704 0.276
NP_439967.1_5 Forward -145 -126 9.43923 0.264
NP_441021.1_1 Reverse -199 -218 1.47442 0.0845
NP_440326.1_5 Forward -209 -196 13.589 0.229
NP_441463.1_3 Reverse -188 -207 -2.36049 0.153
NP_441463.1_3 Forward -46 -27 -4.13045 0.195
NP_441463.1_6 Reverse -196 -210 19.6548 0.11
NP_441626.1_2 Forward -206 -199 15.7721 0.0124
NP_441626.1_2 Reverse -199 -206 15.7721 0.0124
NP_442365.1_7 Forward -211 -192 -1.7705 0.196
NP_442365.1_7 Reverse -194 -213 -2.26216 0.199
NP_442794.1_1 Reverse -194 -206 10.2654 0.0721
NP_442794.1_1 Forward -211 -199 3.18557 0.286
NP_442615.1_1 Forward -216 -198 3.85406 0.0512
NP_442467.1_4 Reverse -372 -391 5.60432 0.289
NP_441962.1_4 Reverse -193 -212 -1.7705 0.125
NP_441962.1_4 Forward -212 -193 -11.3086 0.239
NP_440387.1_1 Reverse -198 -214 22.2813 0.00192
NP_440387.1_1 Forward -207 -191 15.2998 0.00554
NP_440855.1_5 Reverse -136 -155 7.4718 0.285
NP_441431.1_3 Forward -154 -135 12.4875 0.162
NP_441836.1_2 Forward -159 -140 1.37609 0.193
NP_441993.1_1 Forward -170 -151 10.328 0.127
NP_440467.1_3 Reverse -133 -152 13.8931 0.183
NP_440114.1_10 Reverse -267 -281 11.2093 0.121
NP_441425.1_4 Reverse -225 -239 16.2242 0.282
NP_440293.1_3 Forward -149 -130 5.70265 0.192
NP_440293.1_3 Forward -160 -141 -4.32711 0.262
NP_440293.1_3 Reverse -350 -369 -6.29373 0.288
NP_440293.1_9 Forward -158 -144 9.70148 0.285
NP_440766.1_4 Reverse -194 -208 6.98109 0.097
NP_439988.1_3 Forward -152 -138 3.73617 0.298
NP_441237.1_9 Reverse -199 -209 14.9263 0.0242
NP_440643.1_6 Reverse -133 -152 4.32602 0.22
NP_440502.1_3 Forward -364 -354 14.2769 0.251
NP_442867.1_8 Reverse -344 -363 6.4893 0.26
NP_440457.1_1 Reverse -194 -206 8.39711 0.101
NP_440457.1_1 Forward -211 -199 -0.452677 0.263
NP_440457.1_1 Forward -157 -145 -1.14099 0.294
NP_441801.1_4 Reverse -116 -126 2.63497 0.29
NP_441332.1_6 Forward -360 -350 12.1308 0.236
NP_440473.1_1 Reverse -141 -160 17.0418 0.0912
NP_442509.1_9 Reverse -198 -208 8.14104 0.192
NP_442509.1_9 Forward -207 -197 8.04271 0.192
NP_442514.1_5 Reverse -136 -155 -0.197979 0.182
NP_440554.1_4 Forward -206 -196 16.1063 0.0189
NP_440554.1_4 Reverse -199 -209 6.37155 0.123
NP_441885.1_5 Reverse -198 -208 20.9245 0.000538
NP_441885.1_5 Forward -207 -197 11.3864 0.00668
NP_441885.1_5 Forward -170 -160 0.0783647 0.183
NP_442310.1_1 Forward -143 -124 13.5691 0.191
NP_442341.1_7 Forward -208 -194 8.55439 0.0864
NP_442341.1_7 Reverse -197 -211 6.19444 0.134
NP_442341.1_7 Reverse -26 -40 5.60446 0.151
NP_442341.1_9 Reverse -196 -210 9.83206 0.144
NP_442341.1_9 Reverse -152 -166 4.52221 0.299
NP_441756.1_5 Reverse -140 -159 -0.39387 0.244
NP_441756.1_5 Forward -157 -138 -4.81876 0.296
NP_442395.2_4 Reverse -26 -45 1.6703 0.235
NP_442395.2_4 Forward -208 -189 1.37531 0.244
NP_442395.2_4 Reverse -197 -216 0.785326 0.26
NP_440191.1_4 Forward -363 -353 12.9542 0.282
NP_443000.1_7 Reverse -196 -206 17.4829 0.00719
NP_443000.1_7 Forward -209 -199 10.4031 0.0345
NP_443059.1_10 Reverse -190 -209 5.89851 0.194
NP_441842.1_10 Reverse -191 -205 10.3243 0.165
NP_440275.1_3 Forward -209 -199 17.6796 0.0102
NP_440275.1_3 Reverse -196 -206 9.12481 0.055
NP_440091.1_1 Forward -211 -199 1.41561 0.197
NP_440091.1_1 Reverse -301 -313 1.31728 0.198
NP_442354.1_7 Reverse -195 -214 11.6025 0.191
NP_442275.1_1 Reverse -145 -164 2.65439 0.284
NP_443010.1_10 Reverse -195 -212 1.90109 0.289
NP_440175.1_4 Forward -172 -153 -3.44213 0.122
NP_440175.1_7 Forward -211 -193 8.87516 0.285
NP_442495.1_4 Reverse -43 -53 13.943 0.183
NP_442495.1_5 Forward -144 -125 9.24257 0.287
NP_442495.1_5 Reverse -40 -59 5.60432 0.291
NP_440149.1_8 Forward -207 -188 -2.55715 0.172
NP_440149.1_10 Forward -170 -151 -1.47551 0.203
NP_441105.1_3 Reverse -187 -206 7.7676 0.0517
NP_441105.1_3 Forward -175 -156 -8.94866 0.281
NP_441105.1_3 Reverse -109 -128 -9.63698 0.292
NP_441105.1_3 Forward -218 -199 -9.83364 0.297
NP_441105.1_3 Forward -140 -121 -10.0303 0.3
NP_440216.1_1 Forward -207 -193 -2.55701 0.0521
NP_440216.1_1 Reverse -198 -212 -10.4235 0.145
NP_440216.1_1 Reverse -144 -158 -11.2101 0.169
NP_440216.1_1 Forward -153 -139 -11.9968 0.236
NP_440216.1_9 Reverse -7 -16 10.9145 0.286
NP_440172.1_1 Forward -207 -197 17.5813 0.00421
NP_440172.1_1 Reverse -198 -208 15.0247 0.00945
NP_440172.1_1 Forward -352 -342 4.40493 0.189
NP_442290.1_1 Forward -101 -82 31.4654 0.000114
NP_442290.1_2 Forward -65 -46 29.0071 0.000788
NP_442290.1_3 Forward -140 -121 28.9088 0.000647
NP_442290.1_4 Forward -248 -229 27.5321 0.00253
NP_442290.1_5 Forward -224 -205 27.9255 0.0000589
NP_442290.1_6 Forward -269 -250 24.1889 0.0256
NP_442290.1_7 Forward -38 -19 24.0905 0.019
NP_442290.1_8 Forward -118 -104 17.5025 0.214
NP_442290.1_9 Forward -173 -154 17.404 0.181
NP_442015.1_10 Reverse -194 -207 11.229 0.0372
NP_442015.1_10 Forward -145 -132 3.36254 0.183
NP_442015.1_10 Forward -211 -198 2.37923 0.193
NP_442015.1_10 Forward -127 -114 -0.275709 0.259
NP_441045.1_6 Reverse -134 -152 15.4563 0.284
NP_441226.1_4 Reverse -345 -364 8.94757 0.278
NP_441226.1_7 Forward -206 -199 14.4934 0.0123
NP_441226.1_7 Reverse -199 -206 14.4934 0.0123
NP_441111.1_7 Forward -206 -198 18.7023 0.00294
NP_441111.1_7 Reverse -199 -207 18.7023 0.00294
NP_442379.1_10 Forward -214 -197 7.90532 0.102
NP_442379.1_10 Reverse -191 -208 -4.28772 0.291
NP_441766.1_2 Forward -207 -198 17.5026 0.00297
NP_441766.1_2 Reverse -198 -207 17.5026 0.00297
NP_441766.1_9 Forward -162 -143 3.44104 0.218
NP_442417.1_2 Forward -47 -29 13.4905 0.263
NP_442417.1_5 Forward -207 -193 18.8791 0.0203
NP_440416.1_9 Reverse -137 -156 2.85105 0.0381
NP_440416.1_9 Reverse -191 -210 -4.22878 0.0767
NP_440416.1_9 Forward -171 -152 -21.3384 0.294
NP_440416.1_9 Forward -164 -145 -21.7317 0.296
NP_440072.1_5 Forward -147 -129 -2.93078 0.271
NP_442403.1_9 Forward -48 -29 11.8975 0.148
NP_440591.1_9 Forward -214 -196 3.85406 0.295
NP_442154.1_1 Forward -140 -122 -17.9754 0.273
NP_440261.1_5 Reverse -199 -212 8.37742 0.0263
NP_440261.1_5 Reverse -145 -158 -7.84719 0.201
NP_440261.1_5 Forward -206 -193 -10.6005 0.201
NP_440988.1_10 Reverse -196 -210 8.28727 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCTAAAGGTCTTGCCTAAAAGATATGGCTCAGGTTGCTTTCCCCAGTCGGCAGTGGCTTTGAACAGTATGATTGGTTTGTTTTGATTGCAATCGTTACTGAATAGAAATCAGTCACCCAGGATAGCCCATAGTGAATGCTCTCTCAATTCCCACTTGGATGGTTCATGTTTCCAGTGTCATTGAATGGATCGTGGCGATCGCCTTGGTGAGTCGTTATGCTACAAAAGCTGGTTATGGCCACTGGCGGGCCCTGGCCTGGGGGATGGTGCCAGCCCTGGTGAGTGCCACCTGTGCCTGTACTTGGCATTTCTTTGACAATGCTAGTCAGTTAGATTGGTTAGTGACGCTCCAGGCCCTGACCACCGTGATTGGCAATATTACCCTTTGCCTGGCGGCCTG

CDS

GTGGATTTATCGTCAATCAGCCCAGCCCTCTGCCCCCAAGCCCTGATGGAACTTAGCCAAATTTTTGCCAAGGAAAATCTTTTTGCCCTTTCCCTTTTTCCCTACCTGGGTTTTCTCTGGTTTCTACGGCAATCGCCGCAAACCCCCAAGCTCGTAATGGTGGGATTTTATGTTCTATTGGTGTTTGTTGTGGTAACTATCCCTGCGGGGCTCTACGCTGAAAGCCATTACCAAGCCCAGTTGGCCGATGTAGATTGGCTCCACGGCAGTGCAGAGGTATTTTTATCCCTTTCCAATCTGTTGGTAGTTTTTGGCTTTATCCAGGGTCTAGCCCGACAATCGGCGGAAAAACAGGAAAATAATTAG

Protein

MDLSSISPALCPQALMELSQIFAKENLFALSLFPYLGFLWFLRQSPQTPKLVMVGFYVLLVFVVVTIPAGLYAESHYQAQLADVDWLHGSAEVFLSLSNLLVVFGFIQGLARQSAEKQENN