Your browser is old and dusty. Try Google Chrome!

Details for sll0608

ORF sll0608
Accession NP_442291.1
Symbol ycf49
Category hypothetical protein YCF49
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -304 -297 14.6904 0.0123
NP_440795.1_7 Reverse -297 -304 14.6904 0.0123
NP_442291.1_5 Forward -306 -290 24.248 0.00925
NP_442291.1_5 Reverse -295 -311 5.17175 0.0801
NP_442291.1_7 Forward -346 -332 16.8142 0.211
NP_440897.1_6 Forward -305 -286 -3.63955 0.252
NP_441453.1_4 Reverse -296 -304 16.539 0.00633
NP_441453.1_4 Forward -305 -297 16.539 0.00633
NP_442151.1_6 Reverse -296 -310 8.55439 0.171
NP_442151.1_6 Reverse -160 -174 6.3911 0.236
NP_441818.1_1 Reverse -297 -308 18.446 0.0046
NP_441818.1_1 Forward -304 -293 18.0527 0.00639
NP_441818.1_9 Reverse -332 -351 -4.81876 0.244
NP_441818.1_9 Reverse -146 -165 -9.53865 0.291
NP_440226.1_1 Forward -305 -286 14.7491 0.0291
NP_440226.1_1 Reverse -296 -315 8.45592 0.0871
NP_442655.1_10 Reverse -219 -238 -11.8003 0.261
NP_442173.1_1 Forward -304 -296 15.4574 0.00633
NP_442173.1_1 Reverse -297 -305 15.4574 0.00633
NP_442173.1_1 Reverse -253 -261 7.8859 0.134
NP_442752.1_4 Forward -305 -298 13.8055 0.0199
NP_442752.1_4 Reverse -296 -303 13.8055 0.0199
NP_443027.1_4 Forward -307 -297 11.0914 0.107
NP_443027.1_4 Reverse -294 -304 11.0914 0.107
NP_440784.1_7 Forward -304 -297 15.9687 0.0123
NP_440784.1_7 Reverse -297 -304 15.9687 0.0123
NP_442909.1_7 Forward -304 -290 5.60385 0.275
NP_442289.1_4 Reverse -288 -304 15.6932 0.19
NP_440061.1_9 Forward -307 -293 22.8117 0.0017
NP_440061.1_9 Reverse -294 -308 13.372 0.0819
NP_442062.1_8 Forward -305 -295 17.3846 0.00193
NP_442062.1_8 Reverse -296 -306 17.3846 0.00193
NP_442062.1_8 Reverse -36 -46 2.83163 0.293
NP_440761.1_4 Reverse -112 -131 -13.6686 0.257
NP_440304.1_4 Reverse -351 -361 3.02829 0.299
NP_440304.1_4 Forward -307 -297 1.84832 0.299
NP_440304.1_4 Reverse -294 -304 1.84832 0.299
NP_442242.1_4 Forward -304 -297 14.3954 0.0124
NP_442242.1_4 Reverse -297 -304 14.3954 0.0124
NP_441208.1_9 Forward -196 -182 12.6843 0.13
NP_441208.1_9 Forward -246 -232 12.586 0.132
NP_440764.1_5 Forward -36 -17 9.93088 0.279
NP_442110.1_7 Reverse -326 -340 6.78443 0.134
NP_442110.1_7 Forward -305 -291 -0.197071 0.276
NP_441083.1_5 Forward -305 -295 20.3345 0.00053
NP_441083.1_5 Reverse -296 -306 20.3345 0.00053
NP_441738.1_2 Forward -303 -296 15.28 0.0102
NP_441738.1_2 Reverse -298 -305 15.28 0.0102
NP_441558.1_5 Reverse -294 -313 16.0274 0.0344
NP_441942.1_7 Forward -87 -68 13.8641 0.277
NP_440209.1_1 Reverse -296 -304 18.1123 0.00295
NP_440209.1_1 Forward -305 -297 18.1123 0.00295
NP_442889.1_8 Forward -308 -294 5.40719 0.227
NP_440056.1_9 Reverse -112 -131 12.7991 0.295
NP_441713.1_1 Forward -311 -292 -5.21209 0.113
NP_441770.1_4 Forward -105 -86 -12.0953 0.291
NP_440178.1_7 Forward -306 -287 -4.32711 0.0548
NP_440178.1_7 Reverse -295 -314 -22.3217 0.261
NP_442570.1_3 Reverse -331 -350 3.93269 0.166
NP_442570.1_3 Reverse -330 -349 -3.73712 0.225
NP_441025.1_5 Reverse -75 -89 15.5359 0.257
NP_440538.1_10 Forward -236 -217 9.83255 0.296
NP_441716.1_1 Forward -305 -291 13.8643 0.0689
NP_441716.1_1 Reverse -296 -310 4.71948 0.252
NP_442111.1_4 Forward -306 -292 10.3243 0.0545
NP_441163.1_1 Reverse -345 -362 5.64298 0.271
NP_440906.1_5 Forward -304 -297 15.8704 0.0124
NP_440906.1_5 Reverse -297 -304 15.8704 0.0124
NP_440747.1_10 Forward -308 -296 16.8536 0.00143
NP_440747.1_10 Reverse -293 -305 16.8536 0.00143
NP_441130.1_10 Forward -307 -293 15.2409 0.034
NP_441130.1_10 Reverse -294 -308 14.6509 0.0428
NP_441486.1_1 Forward -308 -294 5.89945 0.0344
NP_441486.1_1 Reverse -293 -307 5.80112 0.0344
NP_441194.1_1 Reverse -374 -393 13.4162 0.238
NP_440403.1_4 Forward -314 -295 -7.96535 0.25
NP_440842.1_4 Forward -394 -375 3.15929 0.207
NP_441014.1_5 Forward -220 -202 11.1305 0.261
NP_441014.1_5 Reverse -329 -347 9.45892 0.276
NP_441014.1_8 Forward -354 -335 -8.85033 0.288
NP_441014.1_10 Reverse -295 -314 11.2084 0.118
NP_442848.1_1 Reverse -290 -304 7.07942 0.0791
NP_442848.1_1 Forward -311 -297 -1.8687 0.263
NP_442848.1_5 Reverse -67 -85 9.85225 0.232
NP_442848.1_5 Reverse -87 -105 -3.32411 0.291
NP_443018.1_3 Forward -304 -297 14.8871 0.0123
NP_443018.1_3 Reverse -297 -304 14.8871 0.0123
NP_441634.1_8 Forward -307 -293 5.80112 0.114
NP_441634.1_8 Reverse -294 -308 5.1128 0.114
NP_441634.1_8 Reverse -86 -100 -4.7203 0.295
NP_440376.1_1 Forward -305 -296 19.4693 0.000692
NP_440376.1_1 Reverse -296 -305 19.4693 0.000692
NP_441588.1_4 Reverse -298 -308 8.73149 0.14
NP_442687.1_7 Forward -306 -296 8.92815 0.0994
NP_442687.1_7 Reverse -295 -305 8.92815 0.0994
NP_442687.1_7 Reverse -221 -231 5.5849 0.194
NP_441013.1_2 Forward -342 -324 -3.52077 0.29
NP_442770.1_8 Reverse -221 -240 13.0775 0.112
NP_441422.1_7 Forward -307 -290 -3.99273 0.238
NP_441950.1_7 Reverse -335 -354 -9.53865 0.297
NP_442658.1_1 Reverse -294 -304 7.94438 0.199
NP_442658.1_1 Forward -307 -297 7.94438 0.199
NP_441414.1_9 Forward -305 -286 11.1109 0.0193
NP_441414.1_9 Reverse -296 -315 4.12936 0.0552
NP_441256.1_8 Reverse -333 -352 4.03102 0.272
NP_442321.1_1 Forward -114 -95 1.17943 0.155
NP_441958.1_5 Forward -306 -296 12.2714 0.00183
NP_441958.1_5 Reverse -295 -305 12.2714 0.00183
NP_442836.1_5 Reverse -290 -309 13.8641 0.0588
NP_442836.1_5 Forward -311 -292 13.1758 0.065
NP_439905.1_1 Forward -304 -291 11.6223 0.204
NP_439905.1_1 Reverse -297 -310 9.65572 0.216
NP_440984.1_7 Reverse -291 -305 11.996 0.122
NP_440984.1_7 Forward -310 -296 8.94771 0.133
NP_441162.1_3 Reverse -71 -90 12.8808 0.181
NP_439990.1_5 Forward -310 -297 18.7022 0.0112
NP_439990.1_5 Reverse -31 -44 8.77074 0.162
NP_442690.1_1 Forward -152 -133 -2.95047 0.142
NP_442690.1_1 Forward -142 -123 -17.0118 0.296
NP_442911.1_2 Reverse -286 -305 3.53937 0.0428
NP_442911.1_2 Forward -315 -296 -2.16383 0.0946
NP_440153.1_5 Forward -304 -290 21.1407 0.0215
NP_440153.1_8 Forward -234 -221 -3.12731 0.285
NP_441591.1_10 Forward -307 -288 4.52268 0.297
NP_442064.1_1 Forward -310 -291 -9.73531 0.259
NP_441099.1_5 Forward -24 -5 -10.4236 0.253
NP_441099.1_5 Forward -315 -296 -11.1119 0.271
NP_441294.1_7 Reverse -292 -306 19.1375 0.00332
NP_441294.1_7 Forward -309 -295 9.92255 0.219
NP_441646.1_1 Reverse -289 -308 7.86593 0.152
NP_442438.1_10 Reverse -291 -305 11.3077 0.0463
NP_442438.1_10 Forward -217 -203 0.491246 0.225
NP_442431.1_10 Reverse -334 -352 0.707465 0.267
NP_441000.1_6 Forward -306 -292 4.71948 0.0933
NP_441000.1_6 Reverse -295 -309 -3.34366 0.221
NP_440147.1_4 Forward -307 -294 16.3422 0.0113
NP_440147.1_4 Reverse -294 -307 16.3422 0.0113
NP_441175.1_7 Forward -305 -286 7.07928 0.239
NP_441550.1_8 Reverse -294 -304 15.1225 0.0132
NP_441550.1_8 Forward -307 -297 15.1225 0.0132
NP_441916.1_7 Forward -305 -295 10.3048 0.0261
NP_441916.1_7 Reverse -296 -306 10.3048 0.0261
NP_441916.1_7 Forward -301 -291 1.84832 0.272
NP_441041.1_4 Forward -89 -70 -8.16202 0.197
NP_441041.1_4 Reverse -296 -315 -8.752 0.207
NP_441041.1_7 Forward -308 -296 10.8188 0.0864
NP_440569.1_10 Forward -371 -352 2.81659 0.285
NP_441568.1_4 Reverse -199 -218 1.76941 0.248
NP_441547.1_2 Reverse -208 -226 8.86894 0.212
NP_442004.1_6 Forward -305 -291 2.06454 0.274
NP_441725.1_4 Forward -17 -3 7.57046 0.227
NP_441725.1_5 Forward -304 -294 2.04498 0.115
NP_441725.1_5 Reverse -297 -307 2.04498 0.115
NP_441725.1_5 Reverse -37 -47 -1.29827 0.299
NP_439966.1_7 Reverse -294 -304 15.3192 0.0152
NP_439966.1_7 Forward -307 -297 15.3192 0.0152
NP_442941.1_3 Forward -304 -294 19.2529 0.00262
NP_442941.1_3 Reverse -297 -307 19.2529 0.00262
NP_440289.1_2 Forward -308 -295 12.6056 0.0139
NP_440289.1_2 Reverse -293 -306 3.16588 0.0811
NP_440289.1_2 Forward -17 -4 1.00259 0.141
NP_440260.1_8 Reverse -330 -348 -6.66736 0.294
NP_442281.1_1 Forward -310 -296 7.76712 0.0927
NP_442281.1_1 Reverse -98 -112 4.8172 0.18
NP_442256.1_2 Forward -307 -289 0.510803 0.118
NP_442256.1_2 Reverse -294 -312 -9.51896 0.274
NP_440437.1_1 Reverse -290 -309 -4.03212 0.248
NP_442500.1_2 Reverse -220 -239 8.06259 0.283
NP_443030.1_4 Reverse -68 -87 -4.6221 0.251
NP_441644.1_6 Forward -305 -295 17.3841 0.00127
NP_441644.1_6 Reverse -296 -306 17.3841 0.00127
NP_442215.1_2 Forward -307 -291 -4.1697 0.228
NP_442215.1_2 Reverse -294 -310 -5.05468 0.244
NP_442215.1_2 Reverse -277 -293 -6.13632 0.264
NP_442029.1_1 Reverse -3 -22 -20.3551 0.297
NP_442247.1_10 Reverse -321 -340 20.1573 0.162
NP_440253.1_2 Reverse -296 -314 1.78911 0.152
NP_440929.1_8 Forward -305 -296 19.2726 0.000701
NP_440929.1_8 Reverse -296 -305 19.2726 0.000701
NP_442933.1_10 Forward -305 -296 17.601 0.00325
NP_442933.1_10 Reverse -296 -305 17.601 0.00325
NP_441751.2_8 Reverse -297 -311 9.83269 0.0311
NP_441751.2_8 Forward -304 -290 -2.36035 0.132
NP_442554.1_8 Forward -304 -294 16.2046 0.0065
NP_442554.1_8 Reverse -297 -307 16.2046 0.0065
NP_441762.1_7 Forward -306 -294 -6.74586 0.284
NP_441762.1_7 Reverse -295 -307 -6.74586 0.284
NP_442142.1_4 Forward -308 -295 12.2117 0.0464
NP_442142.1_4 Reverse -293 -306 4.34528 0.223
NP_442292.1_1 Forward -304 -295 18.486 0.00229
NP_442292.1_1 Reverse -297 -306 18.486 0.00229
NP_442292.1_5 Forward -198 -179 3.93269 0.257
NP_442292.1_5 Reverse -1 -20 -2.16383 0.282
NP_442476.1_6 Forward -304 -290 17.6008 0.0352
NP_442476.1_6 Reverse -297 -311 1.86788 0.202
NP_443009.1_5 Reverse -295 -306 8.90795 0.0965
NP_443009.1_5 Forward -306 -295 8.90795 0.0965
NP_442301.1_2 Forward -238 -219 3.73524 0.288
NP_441715.1_4 Forward -304 -294 17.3846 0.0106
NP_441715.1_4 Reverse -297 -307 17.3846 0.0106
NP_440881.1_7 Reverse -157 -176 14.3558 0.221
NP_441468.1_1 Forward -304 -297 15.8704 0.0124
NP_441468.1_1 Reverse -297 -304 15.8704 0.0124
NP_441015.1_10 Forward -310 -291 -7.08038 0.262
NP_441015.1_10 Reverse -220 -239 -8.16202 0.272
NP_441015.1_10 Reverse -335 -354 -9.73531 0.282
NP_441673.1_1 Forward -305 -296 20.8459 0.000698
NP_441673.1_1 Reverse -296 -305 20.8459 0.000698
NP_441876.1_9 Reverse -210 -220 10.206 0.299
NP_441826.1_2 Reverse -290 -304 11.406 0.0367
NP_441826.1_2 Forward -311 -297 -4.4253 0.296
NP_442745.1_2 Forward -187 -168 4.12936 0.282
NP_441764.1_4 Reverse -375 -392 19.2443 0.0453
NP_442868.1_6 Forward -307 -297 19.2529 0.00563
NP_442868.1_6 Reverse -294 -304 19.2529 0.00563
NP_441612.1_2 Reverse -296 -306 8.54929 0.21
NP_441612.1_2 Forward -305 -295 8.54929 0.21
NP_442427.1_8 Forward -314 -295 6.4893 0.239
NP_442808.1_1 Forward -15 -5 13.4509 0.0481
NP_442808.1_1 Reverse -295 -305 8.63269 0.0481
NP_442808.1_1 Forward -306 -296 8.63269 0.0481
NP_442808.1_1 Forward -185 -175 2.73286 0.256
NP_442775.1_6 Reverse -214 -233 11.0125 0.277
NP_440145.1_3 Forward -315 -296 -0.590531 0.142
NP_442542.1_2 Forward -307 -294 7.78743 0.17
NP_442542.1_2 Reverse -294 -307 7.78743 0.17
NP_442542.1_9 Forward -90 -76 12.8803 0.108
NP_442113.1_10 Reverse -187 -206 -7.08038 0.265
NP_442050.1_5 Reverse -294 -304 14.3359 0.0206
NP_442050.1_5 Forward -307 -297 14.3359 0.0206
NP_441518.1_3 Forward -179 -160 -8.35868 0.186
NP_441878.1_6 Forward -306 -296 10.4031 0.0176
NP_441878.1_6 Reverse -295 -305 10.4031 0.0176
NP_441878.1_6 Reverse -338 -348 -7.68978 0.255
NP_441036.1_8 Forward -306 -296 8.33817 0.174
NP_441036.1_8 Reverse -295 -305 8.33817 0.174
NP_441557.1_5 Forward -305 -296 19.9609 0.000699
NP_441557.1_5 Reverse -296 -305 19.9609 0.000699
NP_441557.1_8 Forward -96 -86 12.7626 0.235
NP_441445.1_1 Forward -314 -295 10.3242 0.0963
NP_441445.1_1 Reverse -287 -306 -0.197208 0.286
NP_441445.1_1 Reverse -216 -235 -0.39387 0.291
NP_441590.1_4 Forward -347 -328 1.6703 0.299
NP_442066.2_9 Forward -309 -296 17.9155 0.0209
NP_440101.1_3 Reverse -291 -310 4.52268 0.214
NP_441549.1_9 Forward -309 -291 3.95239 0.0925
NP_442347.1_2 Forward -304 -295 12.4878 0.056
NP_442347.1_2 Reverse -297 -306 12.4878 0.056
NP_442645.1_2 Reverse -288 -307 -12.0953 0.144
NP_442645.1_2 Forward -313 -294 -12.5869 0.144
NP_441037.1_4 Reverse -3 -13 9.75413 0.21
NP_440151.1_6 Reverse -288 -307 16.4207 0.139
NP_441633.1_3 Forward -307 -294 3.46087 0.0699
NP_441633.1_3 Reverse -294 -307 3.46087 0.0699
NP_440136.1_2 Forward -304 -297 15.9687 0.0123
NP_440136.1_2 Reverse -297 -304 15.9687 0.0123
NP_442590.1_9 Reverse -330 -349 12.7825 0.223
NP_442590.1_10 Forward -90 -71 4.42435 0.276
NP_442998.1_10 Forward -303 -296 15.5754 0.0102
NP_442998.1_10 Reverse -298 -305 15.5754 0.0102
NP_440299.1_1 Reverse -292 -305 14.1783 0.0259
NP_440299.1_1 Reverse -99 -112 8.77016 0.0851
NP_440299.1_1 Forward -309 -296 2.28034 0.292
NP_441799.1_1 Reverse -292 -306 16.3219 0.0152
NP_441799.1_1 Forward -309 -295 13.5686 0.0311
NP_441007.1_10 Forward -310 -297 2.87088 0.183
NP_441007.1_10 Reverse -291 -304 -0.570702 0.287
NP_440256.1_1 Forward -308 -289 17.994 0.00478
NP_440256.1_1 Reverse -71 -90 1.0811 0.0789
NP_443042.1_3 Reverse -105 -123 12.6055 0.295
NP_440709.1_1 Forward -396 -377 4.91521 0.18
NP_441559.1_8 Reverse -301 -315 2.65453 0.143
NP_441559.1_8 Reverse -291 -305 0.687908 0.163
NP_441559.1_8 Forward -310 -296 -5.80194 0.27
NP_440915.1_6 Forward -309 -295 1.67122 0.132
NP_440915.1_6 Reverse -292 -306 0.0979218 0.176
NP_442785.1_7 Forward -307 -293 11.5043 0.228
NP_441704.1_8 Reverse -31 -50 5.89851 0.273
NP_441704.1_8 Forward -56 -37 5.30853 0.297
NP_442866.1_1 Forward -333 -314 -3.83545 0.222
NP_439985.1_7 Reverse -331 -350 4.81767 0.224
NP_442993.1_1 Reverse -296 -312 -9.67623 0.19
NP_442993.1_1 Forward -83 -67 -11.7412 0.257
NP_442386.1_9 Reverse -295 -304 13.8639 0.0289
NP_442386.1_9 Forward -306 -297 13.8639 0.0289
NP_441750.1_4 Forward -235 -216 5.60432 0.185
NP_441340.1_5 Forward -304 -297 15.6737 0.0124
NP_441340.1_5 Reverse -297 -304 15.6737 0.0124
NP_442240.1_2 Forward -304 -285 -12.4886 0.163
NP_440586.1_1 Reverse -343 -362 -5.50708 0.285
NP_440586.1_8 Forward -304 -297 13.2151 0.026
NP_440586.1_8 Reverse -297 -304 13.2151 0.026
NP_442251.1_6 Forward -304 -297 15.2804 0.0124
NP_442251.1_6 Reverse -297 -304 15.2804 0.0124
NP_442251.1_6 Reverse -37 -44 8.69224 0.199
NP_441262.1_3 Reverse -296 -303 14.7888 0.0223
NP_441262.1_3 Forward -305 -298 14.7888 0.0223
NP_441262.1_3 Forward -45 -38 5.15232 0.265
NP_440027.1_3 Reverse -286 -304 5.32826 0.245
NP_440027.1_8 Forward -308 -289 10.815 0.243
NP_443051.1_1 Reverse -295 -304 10.4228 0.00754
NP_443051.1_1 Forward -306 -297 10.4228 0.00754
NP_439984.1_3 Reverse -289 -303 12.487 0.272
NP_439937.1_9 Forward -306 -289 -14.5148 0.287
NP_440439.1_1 Reverse -293 -306 4.24752 0.104
NP_440372.1_2 Forward -304 -297 16.3621 0.0124
NP_440372.1_2 Reverse -297 -304 16.3621 0.0124
NP_440574.1_3 Forward -50 -31 -0.983855 0.299
NP_442663.1_1 Forward -278 -259 2.6536 0.231
NP_441572.1_7 Forward -311 -292 -3.14714 0.207
NP_441572.1_7 Reverse -347 -366 -5.9004 0.276
NP_442384.1_10 Forward -305 -292 21.4554 0.00194
NP_442384.1_10 Reverse -296 -309 11.6223 0.0341
NP_441018.1_7 Forward -309 -290 12.1925 0.167
NP_441018.1_7 Reverse -215 -234 7.96426 0.259
NP_442262.1_10 Forward -304 -297 14.1988 0.0123
NP_442262.1_10 Reverse -297 -304 14.1988 0.0123
NP_442262.1_10 Forward -251 -244 7.21728 0.281
NP_441689.1_5 Forward -307 -297 5.78111 0.197
NP_441689.1_5 Reverse -294 -304 5.78111 0.197
NP_440531.1_6 Reverse -288 -307 5.01433 0.118
NP_440531.1_6 Forward -313 -294 2.3594 0.158
NP_440531.1_6 Reverse -66 -85 -2.55715 0.253
NP_440531.1_6 Reverse -278 -297 -5.11376 0.293
NP_440531.1_8 Reverse -335 -354 8.06259 0.216
NP_440826.1_5 Reverse -88 -106 14.9958 0.231
NP_441965.1_3 Reverse -286 -305 0.786102 0.23
NP_441965.1_10 Reverse -293 -309 8.61333 0.123
NP_441965.1_10 Forward -308 -292 4.18844 0.247
NP_442693.1_7 Forward -306 -287 12.5858 0.202
NP_440297.1_9 Forward -304 -294 -0.118297 0.282
NP_440297.1_9 Reverse -297 -307 -0.118297 0.282
NP_440297.1_9 Forward -222 -212 -0.216628 0.282
NP_440350.1_1 Reverse -72 -91 -3.63879 0.236
NP_440999.1_9 Forward -309 -295 8.06273 0.0797
NP_440999.1_9 Forward -235 -221 1.76955 0.158
NP_440999.1_9 Reverse -292 -306 -0.393733 0.205
NP_440999.1_9 Reverse -302 -316 -2.95034 0.281
NP_440888.1_2 Forward -305 -291 18.9768 0.00173
NP_440888.1_2 Reverse -296 -310 14.7486 0.0152
NP_440888.1_2 Forward -362 -348 10.0287 0.107
NP_440600.1_4 Reverse -288 -306 6.80398 0.097
NP_440822.1_1 Forward -354 -335 16.7555 0.13
NP_442033.1_10 Forward -307 -288 -7.17871 0.186
NP_441543.1_2 Forward -304 -295 16.9127 0.00359
NP_441543.1_2 Reverse -297 -306 16.9127 0.00359
NP_442845.1_2 Forward -305 -291 4.81781 0.251
NP_441469.1_8 Forward -84 -75 10.6195 0.206
NP_441469.1_8 Forward -306 -297 6.48957 0.227
NP_441469.1_8 Reverse -295 -304 6.48957 0.227
NP_443064.1_6 Forward -305 -295 12.5669 0.0796
NP_443064.1_6 Reverse -296 -306 12.5669 0.0796
NP_442578.1_7 Forward -304 -297 14.5921 0.026
NP_442578.1_7 Reverse -297 -304 14.5921 0.026
NP_440710.1_1 Reverse -288 -306 -0.0791831 0.163
NP_442286.1_1 Reverse -296 -315 6.4893 0.285
NP_441462.1_2 Forward -305 -295 11.5831 0.00406
NP_441462.1_2 Reverse -296 -306 11.5831 0.00406
NP_443062.1_1 Reverse -296 -314 11.9587 0.0887
NP_443062.1_1 Forward -305 -287 6.79079 0.192
NP_443062.1_6 Forward -313 -294 12.1925 0.0996
NP_443062.1_6 Reverse -198 -217 0.58944 0.292
NP_440519.1_6 Forward -144 -130 10.1277 0.29
NP_442204.1_1 Reverse -292 -303 0.0586712 0.284
NP_442204.1_2 Reverse -238 -257 8.45592 0.25
NP_442780.1_1 Reverse -379 -398 7.66927 0.279
NP_442780.1_3 Forward -393 -374 19.3367 0.0795
NP_440454.1_2 Reverse -133 -147 16.1498 0.163
NP_440516.1_2 Forward -311 -293 12.9988 0.0609
NP_440516.1_8 Forward -305 -296 16.9127 0.00442
NP_440516.1_8 Reverse -296 -305 16.9127 0.00442
NP_442428.1_5 Forward -304 -297 15.8704 0.0124
NP_442428.1_5 Reverse -297 -304 15.8704 0.0124
NP_440673.1_3 Forward -303 -296 12.4288 0.0426
NP_440673.1_3 Reverse -298 -305 12.4288 0.0426
NP_441052.1_2 Forward -305 -295 19.9412 0.00106
NP_441052.1_2 Reverse -296 -306 19.9412 0.00106
NP_442219.1_9 Forward -304 -295 17.7976 0.00718
NP_442219.1_9 Reverse -297 -306 17.7976 0.00718
NP_442219.1_9 Forward -96 -87 2.06468 0.289
NP_440436.1_4 Forward -304 -295 17.2072 0.00233
NP_440436.1_4 Reverse -297 -306 17.2072 0.00233
NP_441884.1_8 Forward -306 -287 -0.4922 0.138
NP_441884.1_9 Forward -308 -289 -22.42 0.278
NP_440314.1_9 Reverse -297 -316 -1.7705 0.14
NP_441719.1_4 Forward -304 -297 16.3621 0.0124
NP_441719.1_4 Reverse -297 -304 16.3621 0.0124
NP_441004.1_1 Reverse -334 -353 -8.55534 0.2
NP_441004.1_1 Reverse -216 -235 -17.5035 0.292
NP_442366.1_5 Reverse -2 -12 10.6976 0.245
NP_440296.1_6 Forward -67 -49 11.1745 0.295
NP_441115.1_4 Forward -306 -288 7.78652 0.272
NP_440288.1_2 Forward -242 -223 8.16093 0.209
NP_440328.1_4 Reverse -242 -261 3.6377 0.174
NP_443054.1_2 Forward -350 -336 5.40779 0.236
NP_443054.1_2 Reverse -294 -308 1.17956 0.251
NP_441851.1_10 Forward -306 -296 15.8113 0.00552
NP_441851.1_10 Reverse -295 -305 15.8113 0.00552
NP_442208.1_5 Reverse -89 -108 -8.45701 0.275
NP_442622.1_8 Forward -305 -287 -18.4671 0.222
NP_442011.1_1 Forward -306 -287 -0.787193 0.268
NP_442515.1_1 Reverse -295 -309 11.0127 0.0431
NP_442515.1_1 Forward -306 -292 9.04604 0.0671
NP_442515.1_1 Forward -170 -156 1.47456 0.158
NP_442515.1_1 Reverse -87 -101 -1.5737 0.257
NP_442515.1_1 Reverse -41 -55 -2.06536 0.268
NP_442515.1_1 Forward -232 -218 -4.81863 0.298
NP_441683.1_2 Forward -176 -157 13.5683 0.287
NP_441982.1_6 Reverse -231 -240 11.053 0.288
NP_440463.1_8 Reverse -330 -349 9.62978 0.247
NP_441046.1_2 Forward -316 -297 10.9142 0.191
NP_442689.1_8 Forward -148 -131 6.13536 0.155
NP_441349.1_10 Reverse -286 -305 20.354 0.00739
NP_441349.1_10 Forward -315 -296 -1.27885 0.101
NP_440432.1_9 Forward -230 -215 5.78142 0.0512
NP_440432.1_9 Reverse -297 -312 -4.93665 0.228
NP_441477.1_10 Reverse -289 -307 -0.865831 0.294
NP_440588.1_2 Reverse -287 -306 -1.18052 0.155
NP_440954.1_4 Forward -315 -296 3.34271 0.203
NP_440954.1_4 Forward -288 -269 -3.3438 0.275
NP_442006.1_2 Forward -92 -75 -5.56602 0.143
NP_442006.1_2 Reverse -213 -230 -15.1041 0.215
NP_442243.1_1 Reverse -290 -308 2.37835 0.204
NP_442243.1_1 Forward -355 -337 -2.73484 0.295
NP_441570.1_1 Forward -305 -287 12.0155 0.00685
NP_441570.1_1 Reverse -296 -314 -17.2871 0.269
NP_440078.1_10 Reverse -296 -315 2.26107 0.277
NP_441078.1_4 Forward -305 -296 19.6659 0.0007
NP_441078.1_4 Reverse -296 -305 19.6659 0.0007
NP_440526.1_3 Reverse -297 -308 10.2846 0.0646
NP_440526.1_3 Forward -44 -33 7.23633 0.156
NP_440526.1_3 Forward -304 -293 0.943182 0.267
NP_441432.1_8 Reverse -295 -304 16.8143 0.00595
NP_441432.1_8 Forward -306 -297 16.8143 0.00595
NP_442320.1_8 Reverse -30 -44 -4.13031 0.148
NP_441732.1_2 Forward -309 -293 -15.3794 0.145
NP_441732.1_2 Reverse -292 -308 -16.3627 0.165
NP_441732.1_2 Forward -366 -350 -17.0511 0.231
NP_441732.1_7 Forward -137 -118 8.55425 0.298
NP_440760.1_1 Forward -305 -286 -11.9969 0.0903
NP_440760.1_1 Reverse -296 -315 -13.4719 0.105
NP_442797.1_7 Reverse -81 -99 -0.374176 0.282
NP_440199.1_10 Forward -308 -298 7.25653 0.231
NP_442353.1_4 Forward -311 -292 11.2084 0.0983
NP_442353.1_4 Reverse -290 -309 3.73524 0.21
NP_440913.1_1 Reverse -294 -312 8.08229 0.192
NP_442727.1_10 Reverse -28 -47 -3.54046 0.256
NP_441072.1_2 Reverse -285 -304 8.45592 0.24
NP_442010.1_9 Forward -99 -85 15.8302 0.175
NP_440713.1_4 Reverse -286 -305 11.5042 0.115
NP_442489.1_7 Forward -305 -296 20.1576 0.000695
NP_442489.1_7 Reverse -296 -305 20.1576 0.000695
NP_440559.1_1 Forward -304 -295 17.4043 0.00658
NP_440559.1_1 Reverse -297 -306 17.4043 0.00658
NP_440559.1_1 Forward -44 -35 4.81794 0.193
NP_441659.2_8 Forward -305 -295 18.1713 0.00133
NP_441659.2_8 Reverse -296 -306 18.1713 0.00133
NP_442913.1_10 Reverse -287 -306 15.7324 0.0155
NP_442913.1_10 Forward -314 -295 4.62101 0.0853
NP_442913.1_10 Reverse -79 -98 -3.63879 0.214
NP_441040.1_2 Forward -357 -338 2.16274 0.119
NP_440779.1_5 Forward -231 -214 -5.56602 0.149
NP_442346.1_5 Forward -306 -296 16.6963 0.00248
NP_442346.1_5 Reverse -295 -305 16.6963 0.00248
NP_440545.1_3 Reverse -292 -309 -2.71443 0.191
NP_440545.1_3 Forward -366 -349 -4.97604 0.237
NP_440545.1_5 Reverse -334 -351 7.02034 0.21
NP_441856.1_3 Reverse -293 -312 -0.295539 0.217
NP_441786.1_10 Reverse -287 -306 15.0441 0.121
NP_440459.1_2 Forward -92 -75 14.2968 0.119
NP_440459.1_2 Forward -307 -290 7.90532 0.276
NP_440010.1_10 Reverse -335 -354 2.45773 0.277
NP_442137.1_1 Reverse -331 -350 7.17762 0.25
NP_440847.1_3 Reverse -245 -259 12.3887 0.249
NP_440847.1_5 Reverse -209 -228 11.2092 0.281
NP_442603.1_7 Forward -305 -291 11.897 0.109
NP_442603.1_7 Reverse -296 -310 8.84875 0.162
NP_441948.1_4 Reverse -289 -307 6.31233 0.0646
NP_441047.1_2 Reverse -75 -94 0.884433 0.239
NP_441833.1_4 Forward -304 -297 15.9687 0.0124
NP_441833.1_4 Reverse -297 -304 15.9687 0.0124
NP_440912.1_2 Reverse -205 -220 17.6795 0.0698
NP_441112.1_6 Forward -93 -74 5.89931 0.172
NP_442162.1_9 Forward -304 -297 16.2637 0.0124
NP_442162.1_9 Reverse -297 -304 16.2637 0.0124
NP_442162.1_9 Reverse -253 -260 5.93897 0.214
NP_441341.1_7 Forward -119 -100 12.1925 0.283
NP_442546.1_6 Reverse -381 -400 14.4666 0.296
NP_442140.1_3 Forward -304 -294 10.3048 0.0902
NP_442140.1_3 Reverse -297 -307 10.3048 0.0902
NP_442140.1_3 Forward -371 -361 6.8632 0.158
NP_440875.1_9 Reverse -298 -308 7.69067 0.255
NP_441813.1_5 Reverse -294 -304 18.1713 0.00743
NP_441813.1_5 Forward -307 -297 18.1713 0.00743
NP_440590.1_4 Reverse -297 -310 13.294 0.013
NP_440590.1_4 Forward -304 -291 11.524 0.0197
NP_440590.1_4 Forward -44 -31 -5.58558 0.283
NP_440567.1_1 Forward -304 -290 3.73617 0.137
NP_442497.1_10 Forward -304 -295 10.4228 0.0087
NP_442497.1_10 Reverse -297 -306 10.4228 0.0087
NP_440821.1_4 Reverse -294 -304 9.41981 0.0286
NP_440821.1_4 Forward -307 -297 9.41981 0.0286
NP_441239.1_9 Reverse -294 -306 5.25052 0.223
NP_441239.1_9 Forward -307 -295 5.25052 0.223
NP_440706.1_1 Reverse -292 -311 -4.72043 0.262
NP_442193.1_8 Forward -308 -289 9.63507 0.292
NP_442270.1_9 Forward -88 -69 -8.35868 0.217
NP_441508.1_1 Forward -392 -373 14.402 0.143
NP_440354.1_5 Forward -331 -312 7.7676 0.174
NP_440354.1_5 Forward -365 -346 3.6377 0.237
NP_440546.1_4 Forward -305 -295 10.046 0.109
NP_440546.1_4 Reverse -296 -306 10.046 0.109
NP_440546.1_4 Reverse -103 -113 7.91294 0.214
NP_440546.1_6 Reverse -227 -246 7.96426 0.265
NP_440462.1_6 Forward -307 -297 9.61647 0.0429
NP_440462.1_6 Reverse -294 -304 9.61647 0.0429
NP_442899.1_4 Reverse -384 -400 12.9392 0.232
NP_440868.1_4 Reverse -292 -304 17.6402 0.0124
NP_440868.1_4 Forward -309 -297 10.0687 0.0405
NP_442499.1_4 Reverse -344 -358 12.3893 0.226
NP_442479.1_9 Forward -114 -95 2.65439 0.191
NP_440402.1_3 Reverse -271 -290 4.81767 0.276
NP_442402.1_4 Forward -199 -180 -5.99948 0.249
NP_442402.1_6 Reverse -85 -94 12.9794 0.289
NP_442402.1_10 Forward -96 -86 15.5158 0.175
NP_442402.1_10 Forward -241 -231 10.206 0.299
NP_441848.1_4 Reverse -227 -243 7.45517 0.288
NP_440696.1_3 Forward -305 -287 4.6407 0.198
NP_442039.1_4 Forward -304 -297 15.1821 0.0124
NP_442039.1_4 Reverse -297 -304 15.1821 0.0124
NP_441811.1_4 Forward -350 -331 0.884433 0.29
NP_441811.1_8 Forward -57 -43 11.3077 0.218
NP_442837.1_3 Forward -304 -297 15.7721 0.0124
NP_442837.1_3 Reverse -297 -304 15.7721 0.0124
NP_440160.1_2 Reverse -68 -87 -0.983855 0.232
NP_440160.1_2 Forward -349 -330 -1.7705 0.243
NP_442053.1_1 Forward -305 -296 18.3876 0.0007
NP_442053.1_1 Reverse -296 -305 18.3876 0.0007
NP_440505.1_3 Reverse -294 -304 18.3679 0.00213
NP_440505.1_3 Forward -307 -297 18.3679 0.00213
NP_440505.1_3 Reverse -86 -96 6.66654 0.172
NP_440505.1_5 Reverse -227 -241 15.4376 0.268
NP_440505.1_7 Reverse -215 -234 -2.16383 0.289
NP_440505.1_7 Reverse -328 -347 -2.85214 0.294
NP_442360.1_5 Reverse -124 -134 12.8614 0.298
NP_441701.1_3 Reverse -216 -233 8.20031 0.247
NP_440914.1_1 Forward -305 -295 17.5935 0.000537
NP_440914.1_1 Reverse -296 -306 17.5935 0.000537
NP_441011.1_8 Forward -304 -295 8.25953 0.144
NP_441011.1_8 Reverse -297 -306 8.25953 0.144
NP_442533.1_6 Forward -305 -296 17.2076 0.00137
NP_442533.1_6 Reverse -296 -305 17.2076 0.00137
NP_442533.1_6 Forward -83 -74 2.94966 0.232
NP_442541.1_10 Forward -305 -291 3.93223 0.252
NP_442232.1_3 Reverse -288 -307 -5.01543 0.165
NP_443016.1_1 Forward -267 -248 -5.40875 0.245
NP_441482.1_7 Reverse -290 -304 -10.2268 0.209
NP_441482.1_7 Forward -311 -297 -10.3252 0.209
NP_439944.1_9 Forward -304 -294 10.5014 0.0887
NP_439944.1_9 Reverse -297 -307 10.5014 0.0887
NP_439944.1_9 Forward -44 -34 5.97822 0.206
NP_441028.1_6 Forward -95 -85 5.78111 0.243
NP_441028.1_6 Forward -358 -348 3.51951 0.292
NP_440116.1_8 Reverse -297 -316 5.80098 0.0608
NP_440116.1_8 Forward -304 -285 -7.76869 0.237
NP_440115.1_6 Reverse -293 -303 15.0247 0.0505
NP_440115.1_6 Forward -308 -298 6.8632 0.167
NP_440007.1_9 Forward -309 -295 5.30946 0.26
NP_440007.1_9 Reverse -71 -85 1.17956 0.29
NP_441602.1_3 Reverse -327 -346 1.86774 0.206
NP_442673.1_5 Forward -52 -34 17.6204 0.15
NP_441972.1_5 Forward -23 -4 -4.42544 0.211
NP_441972.1_5 Forward -304 -285 -7.76869 0.252
NP_441106.1_1 Forward -306 -297 9.63616 0.0311
NP_441106.1_1 Reverse -295 -304 9.63616 0.0311
NP_442306.1_10 Reverse -230 -249 -11.9969 0.159
NP_441286.1_1 Forward -306 -294 12.9203 0.00815
NP_441286.1_1 Reverse -295 -307 12.9203 0.00815
NP_441286.1_1 Forward -46 -34 -1.14099 0.14
NP_440670.1_8 Forward -305 -296 18.3876 0.000699
NP_440670.1_8 Reverse -296 -305 18.3876 0.000699
NP_440886.1_7 Forward -306 -296 7.94438 0.0805
NP_440886.1_7 Reverse -295 -305 7.94438 0.0805
NP_440886.1_7 Forward -235 -225 3.91283 0.26
NP_440886.1_7 Reverse -193 -203 3.8145 0.265
NP_440828.1_1 Forward -232 -213 -1.08295 0.284
NP_442614.1_2 Reverse -296 -310 15.0442 0.0835
NP_442614.1_2 Forward -305 -291 14.3559 0.102
NP_442072.1_9 Reverse -295 -313 -12.5672 0.0852
NP_442072.1_9 Forward -306 -288 -22.1053 0.22
NP_440513.1_4 Forward -305 -286 8.65258 0.295
NP_442264.1_2 Forward -55 -38 17.5418 0.0953
NP_442264.1_2 Forward -309 -292 5.74204 0.272
NP_439967.1_7 Forward -306 -288 15.7521 0.132
NP_441626.1_2 Forward -304 -297 15.7721 0.0124
NP_441626.1_2 Reverse -297 -304 15.7721 0.0124
NP_442365.1_3 Forward -325 -306 15.8307 0.245
NP_442365.1_7 Forward -309 -290 11.3075 0.0723
NP_442615.1_1 Forward -314 -296 3.55906 0.0536
NP_442467.1_4 Reverse -103 -122 5.60432 0.289
NP_441962.1_4 Reverse -291 -310 -11.9969 0.25
NP_440387.1_1 Forward -305 -289 -3.57971 0.162
NP_440387.1_1 Reverse -296 -312 -5.25134 0.222
NP_441431.1_2 Reverse -249 -263 8.94708 0.2
NP_441836.1_2 Reverse -290 -309 -3.14714 0.234
NP_441993.1_1 Forward -305 -286 4.09075 0.225
NP_441993.1_1 Reverse -329 -348 1.84923 0.269
NP_440358.1_8 Forward -199 -180 -0.39387 0.266
NP_440814.1_4 Forward -314 -295 -4.03212 0.16
NP_440114.1_10 Reverse -296 -310 7.9644 0.219
NP_440114.1_10 Forward -305 -291 7.27608 0.239
NP_440287.1_6 Forward -314 -295 6.78429 0.16
NP_440293.1_3 Reverse -81 -100 -6.29373 0.288
NP_442743.1_4 Forward -304 -285 -3.54046 0.234
NP_439910.1_2 Forward -313 -296 -4.28772 0.0697
NP_439910.1_2 Forward -276 -259 -22.6756 0.285
NP_440502.1_3 Forward -95 -85 14.2769 0.251
NP_442867.1_8 Reverse -75 -94 6.4893 0.26
NP_440457.1_1 Reverse -292 -304 10.7571 0.092
NP_440457.1_1 Forward -309 -297 -0.74767 0.273
NP_440798.1_6 Forward -304 -291 6.21414 0.14
NP_441332.1_6 Forward -91 -81 12.1308 0.236
NP_442509.1_9 Forward -305 -295 8.14104 0.192
NP_442509.1_9 Reverse -296 -306 8.14104 0.192
NP_440448.1_4 Reverse -285 -304 6.88262 0.297
NP_440554.1_4 Forward -304 -294 8.92815 0.0646
NP_440554.1_4 Reverse -297 -307 8.92815 0.0646
NP_442862.1_3 Reverse -322 -339 7.61033 0.253
NP_441885.1_5 Forward -305 -295 20.9245 0.000538
NP_441885.1_5 Reverse -296 -306 20.9245 0.000538
NP_440478.1_10 Forward -307 -293 8.45605 0.257
NP_442341.1_7 Reverse -295 -309 7.47274 0.105
NP_442341.1_7 Forward -306 -292 1.08123 0.299
NP_440191.1_4 Forward -94 -84 12.9542 0.282
NP_440423.1_10 Forward -338 -319 9.3409 0.26
NP_443000.1_7 Reverse -294 -304 19.9412 0.00223
NP_443000.1_7 Forward -307 -297 19.9412 0.00223
NP_441842.1_1 Forward -303 -290 10.9334 0.28
NP_440275.1_3 Forward -307 -297 15.123 0.0182
NP_440275.1_3 Reverse -294 -304 15.123 0.0182
NP_440091.1_1 Reverse -292 -304 8.29878 0.0653
NP_440091.1_1 Forward -309 -297 1.31728 0.198
NP_440091.1_1 Reverse -32 -44 1.31728 0.198
NP_441662.1_3 Reverse -124 -143 7.85374 0.264
NP_443010.1_10 Reverse -293 -310 4.02703 0.242
NP_442451.1_2 Reverse -227 -246 -9.93197 0.26
NP_440804.1_7 Forward -287 -270 10.8545 0.216
NP_441105.1_3 Forward -316 -297 -8.55534 0.274
NP_441105.1_3 Reverse -285 -304 -9.14533 0.284
NP_440216.1_1 Forward -305 -291 19.3708 0.000776
NP_440216.1_1 Reverse -296 -310 0.196253 0.0284
NP_440216.1_9 Reverse -180 -189 6.29291 0.289
NP_440172.1_1 Forward -305 -295 15.0247 0.00945
NP_440172.1_1 Reverse -296 -306 15.0247 0.00945
NP_440172.1_1 Forward -83 -73 4.40493 0.189
NP_442015.1_10 Reverse -292 -305 11.819 0.0372
NP_442015.1_10 Forward -309 -296 2.77255 0.187
NP_441226.1_4 Reverse -76 -95 8.94757 0.278
NP_441226.1_7 Forward -304 -297 14.4934 0.0123
NP_441226.1_7 Reverse -297 -304 14.4934 0.0123
NP_441226.1_7 Forward -340 -333 5.34865 0.289
NP_441111.1_7 Forward -304 -296 18.7023 0.00294
NP_441111.1_7 Reverse -297 -305 18.7023 0.00294
NP_441766.1_2 Forward -305 -296 17.5026 0.00297
NP_441766.1_2 Reverse -296 -305 17.5026 0.00297
NP_440416.1_9 Reverse -289 -308 -8.752 0.12
NP_440416.1_9 Forward -306 -287 -20.945 0.289
NP_442154.1_1 Reverse -329 -347 -9.71562 0.188
NP_440261.1_5 Forward -304 -291 5.13249 0.0476
NP_440261.1_5 Reverse -297 -310 4.93583 0.0478
NP_440988.1_10 Forward -307 -293 8.38408 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACTTGCTTAATATTTCGTTACGTATTCCCCATGGTAGGACATTTCCTCCGGCCAAGAGCCCAACCCAGGCACTGATTGGTTTCGGAAATTACTGGCGATCGCCAGCCGTAGGTATTAACCGAAATTAGCCAGAGTTAACCAATCGGTCAGATGGAGCGTTTTTCCGCAACGACCACCCCATGGGACTAACATCATCGAGGTAGTGGAGTTTTTCCTCGGAACCCTAAATTGCAACCACACCAGACGAAACGCTTTTGTTACCATTTGCCTAAAGGTCTTGCCTAAAAGATATGGCTCAGGTTGCTTTCCCCAGTCGGCAGTGGCTTTGAACAGTATGATTGGTTTGTTTTGATTGCAATCGTTACTGAATAGAAATCAGTCACCCAGGATAGCCCATA

CDS

GTGAATGCTCTCTCAATTCCCACTTGGATGGTTCATGTTTCCAGTGTCATTGAATGGATCGTGGCGATCGCCTTGGTGAGTCGTTATGCTACAAAAGCTGGTTATGGCCACTGGCGGGCCCTGGCCTGGGGGATGGTGCCAGCCCTGGTGAGTGCCACCTGTGCCTGTACTTGGCATTTCTTTGACAATGCTAGTCAGTTAGATTGGTTAGTGACGCTCCAGGCCCTGACCACCGTGATTGGCAATATTACCCTTTGCCTGGCGGCCTGGTGGATTTATCGTCAATCAGCCCAGCCCTCTGCCCCCAAGCCCTGA

Protein

MNALSIPTWMVHVSSVIEWIVAIALVSRYATKAGYGHWRALAWGMVPALVSATCACTWHFFDNASQLDWLVTLQALTTVIGNITLCLAAWWIYRQSAQPSAPKP