Your browser is old and dusty. Try Google Chrome!

Details for sll0601

ORF sll0601
Accession NP_442300.1
Symbol
Category Glutamate family / Nitrogen assimilation
Definition nitrilase homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Forward -139 -120 8.25963 0.24
NP_441453.1_7 Reverse -266 -273 11.6422 0.298
NP_441098.1_3 Reverse -167 -186 -7.6503 0.296
NP_442909.1_7 Forward -36 -22 7.47213 0.215
NP_442062.1_3 Forward -201 -182 8.75091 0.152
NP_441581.1_9 Forward -394 -375 4.34446 0.296
NP_442196.1_9 Reverse -17 -30 16.7355 0.297
NP_442742.1_9 Forward -128 -109 -6.1954 0.222
NP_440769.1_8 Forward -140 -121 9.83255 0.2
NP_441083.1_5 Forward -58 -48 2.92996 0.187
NP_442245.1_8 Forward -86 -67 17.7974 0.256
NP_441141.1_4 Reverse -51 -70 13.3725 0.292
NP_441716.1_2 Reverse -216 -235 -0.855322 0.277
NP_442145.1_4 Reverse -183 -202 2.43462 0.299
NP_441077.1_2 Forward -382 -363 4.15348 0.228
NP_441077.1_6 Forward -197 -181 2.03061 0.29
NP_440781.1_6 Reverse -124 -142 5.52568 0.271
NP_440236.1_2 Reverse -231 -249 -4.50408 0.277
NP_442782.1_2 Reverse -130 -144 0.491246 0.289
NP_441414.1_9 Forward -58 -39 -4.72043 0.161
NP_440184.1_1 Forward -237 -218 4.21601 0.227
NP_442300.1_5 Forward -340 -321 20.1573 0.068
NP_442685.1_2 Forward -198 -188 14.828 0.231
NP_440203.1_5 Forward -277 -267 10.1076 0.239
NP_442816.1_7 Reverse -168 -187 10.9334 0.213
NP_441338.2_1 Reverse -314 -333 22.3206 0.00416
NP_440993.1_2 Forward -44 -28 2.71347 0.262
NP_441752.1_2 Reverse -75 -94 15.9291 0.151
NP_441550.1_8 Forward -60 -50 4.7978 0.283
NP_441041.1_7 Forward -283 -271 5.47405 0.255
NP_440569.1_10 Reverse -359 -378 7.20922 0.231
NP_442941.1_5 Reverse -363 -377 14.525 0.279
NP_441514.1_6 Forward -269 -262 12.8221 0.252
NP_441457.1_7 Forward -105 -86 10.2259 0.126
NP_442933.1_6 Reverse -361 -380 21.151 0.0646
NP_440620.1_4 Reverse -123 -137 16.2452 0.236
NP_441618.1_3 Reverse -49 -68 6.19431 0.156
NP_441764.1_8 Reverse -118 -128 10.7365 0.3
NP_441612.1_2 Reverse -118 -128 8.83972 0.21
NP_441101.1_4 Reverse -176 -195 12.7825 0.15
NP_441534.1_5 Reverse -116 -135 1.86774 0.293
NP_441557.1_8 Forward -36 -26 10.0093 0.3
NP_441433.1_8 Forward -366 -347 -1.86883 0.263
NP_442645.1_2 Reverse -296 -315 -17.1101 0.248
NP_440235.1_6 Forward -202 -192 17.3053 0.198
NP_441866.1_4 Reverse -208 -221 13.3421 0.273
NP_440329.1_4 Reverse -371 -385 16.4417 0.255
NP_440306.1_8 Forward -136 -117 3.14526 0.204
NP_441340.1_9 Reverse -119 -129 8.35163 0.256
NP_442327.1_3 Reverse -121 -140 5.39487 0.279
NP_442959.1_5 Reverse -179 -198 8.65258 0.224
NP_439977.1_5 Forward -43 -24 -0.885524 0.236
NP_442416.1_1 Forward -139 -120 6.54077 0.255
NP_442114.1_1 Forward -198 -179 13.0775 0.176
NP_442917.1_1 Forward -382 -363 7.07848 0.254
NP_442917.1_1 Forward -204 -185 6.29183 0.275
NP_440297.1_9 Reverse -353 -363 1.06167 0.282
NP_440350.1_5 Reverse -205 -224 0.687771 0.158
NP_440700.1_8 Reverse -64 -78 11.406 0.28
NP_441778.1_7 Reverse -47 -66 21.8289 0.0666
NP_440888.1_2 Reverse -141 -155 6.78381 0.22
NP_440491.1_1 Forward -283 -264 8.18396 0.249
NP_441304.1_10 Forward -270 -261 15.1427 0.164
NP_441469.1_8 Reverse -154 -163 10.1278 0.227
NP_440148.1_1 Reverse -108 -127 -5.40875 0.231
NP_441560.1_10 Reverse -19 -38 7.96426 0.266
NP_440544.1_5 Forward -125 -118 14.5681 0.264
NP_440255.1_3 Reverse -369 -379 14.0586 0.298
NP_441670.1_10 Reverse -29 -48 19.5673 0.169
NP_442219.1_9 Reverse -142 -151 2.458 0.27
NP_442366.1_3 Forward -281 -263 -2.93078 0.235
NP_440431.1_3 Forward -390 -371 -9.73531 0.256
NP_442348.1_2 Forward -267 -258 13.4711 0.191
NP_442348.1_2 Forward -268 -259 7.17789 0.285
NP_440526.1_3 Forward -36 -25 1.53316 0.267
NP_440321.1_1 Reverse -20 -37 14.1002 0.27
NP_440760.1_1 Forward -37 -18 -17.4051 0.198
NP_442797.1_8 Reverse -284 -303 19.6656 0.167
NP_440199.1_10 Forward -320 -310 6.66654 0.287
NP_441057.1_3 Forward -136 -117 -11.4069 0.231
NP_441022.1_1 Forward -377 -368 11.0666 0.284
NP_440363.1_9 Reverse -299 -317 13.6872 0.249
NP_442346.1_9 Forward -342 -323 17.7974 0.0305
NP_441943.1_8 Reverse -262 -281 -12.2919 0.261
NP_442603.1_7 Forward -58 -44 12.5853 0.0979
NP_441329.1_3 Reverse -9 -19 11.5325 0.295
NP_441329.1_6 Forward -225 -206 -3.00842 0.294
NP_440912.1_3 Reverse -205 -224 9.34008 0.262
NP_442199.1_7 Reverse -279 -298 3.53858 0.245
NP_441609.1_1 Forward -139 -120 -2.36049 0.289
NP_440594.1_10 Forward -249 -235 18.2885 0.155
NP_441508.1_1 Forward -378 -359 10.5576 0.285
NP_441541.1_1 Forward -186 -168 3.53519 0.182
NP_441541.1_2 Reverse -217 -236 17.093 0.127
NP_440833.1_6 Reverse -256 -270 8.55376 0.272
NP_442216.1_4 Reverse -260 -268 8.08217 0.255
NP_441567.1_3 Reverse -14 -33 13.2741 0.222
NP_441184.1_9 Forward -131 -118 16.0472 0.231
NP_442479.1_5 Forward -139 -120 6.13556 0.26
NP_442402.1_4 Forward -135 -116 -1.27961 0.189
NP_441848.1_4 Reverse -359 -375 8.60108 0.288
NP_441848.1_7 Reverse -366 -385 -3.93454 0.286
NP_439948.1_2 Forward -222 -204 17.3815 0.259
NP_440505.1_3 Reverse -26 -36 4.89658 0.257
NP_440520.1_6 Forward -397 -378 9.3409 0.137
NP_440914.1_1 Forward -150 -140 9.39583 0.186
NP_442931.1_10 Reverse -102 -121 8.55343 0.175
NP_442931.1_10 Reverse -182 -201 6.78348 0.244
NP_440263.1_5 Forward -83 -69 18.1908 0.166
NP_441697.1_5 Reverse -358 -377 -10.4568 0.279
NP_441697.1_5 Reverse -359 -378 -11.1252 0.292
NP_440816.1_2 Forward -226 -207 9.0489 0.235
NP_441028.1_6 Forward -126 -116 14.0409 0.158
NP_441527.1_4 Forward -211 -192 -11.9847 0.285
NP_440429.1_2 Forward -42 -23 8.94757 0.272
NP_442674.1_2 Reverse -128 -147 10.4225 0.208
NP_441463.1_2 Reverse -126 -144 4.79171 0.175
NP_441463.1_2 Reverse -361 -379 -0.590442 0.29
NP_441463.1_3 Forward -327 -308 -2.26216 0.152
NP_442743.1_8 Forward -136 -117 9.50036 0.255
NP_439910.1_2 Forward -45 -28 -14.0225 0.177
NP_442680.1_5 Forward -382 -363 4.66368 0.227
NP_441332.1_4 Forward -378 -359 4.22769 0.293
NP_442582.1_6 Reverse -182 -201 16.2725 0.246
NP_442737.1_4 Reverse -43 -62 17.7974 0.151
NP_442737.1_5 Reverse -313 -332 19.666 0.0536
NP_442703.1_9 Forward -186 -168 6.50899 0.244
NP_442703.1_9 Forward -212 -194 6.31233 0.244
NP_441173.1_9 Reverse -363 -371 11.8187 0.222
NP_441902.1_3 Reverse -292 -302 12.593 0.24
NP_442451.1_2 Reverse -60 -79 -8.16202 0.241
NP_440216.1_8 Reverse -132 -149 18.6234 0.161
NP_442371.1_1 Forward -52 -42 14.3359 0.191
NP_442329.1_9 Reverse -140 -159 17.8948 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGAAGAATCAAGCATTCGATCAAAAAAATTTGTAAAAGTGCTATGGAGAATATTCAGTTTGGTTAACCACCATGCTCAGAATGGTCAACGATAACGGTTACTTCTCTAATCTCCAGAGGATAGATTCCCAAGGGGAATTGTTAAGTAAACCTTGTTATTGTCCTTAGAAATTCTTATCAATAAGGCTAAAAATAGACTCTTAAAAATATGTTGAGATTAACAATCTTAAAAAGCGGGGGACTTCAGTCTAGCAAACACCAAACTTTAAGCAAGTTTTTCTCCATAATATCTTAAGATGTGAAGCCCTCTACCTCTTTTTTGGAGCAAGTTCCGTCCCTACACCCGATCAGGATAAAATGAACTGCTAGCCCCACTGCTTCTTTCTGACAAGGAATTTTC

CDS

ATGAAACCGTATTTAGCCGCTGCCCTGCAAATGACCAGCCGCCCCAACCTCACCGAGAATTTACAAGAAGCAGAGGAGTTGATCGATTTGGCGGTGCGCCAGGGGGCAGAATTGGTGGGTTTGCCGGAGAATTTTGCTTTTTTGGGCAATGAAACTGAAAAGCTAGAACAGGCAACGGCGATCGCCACGGCGACGGAAAAATTTTTACAGACCATGGCCCAACGGTTCCAGGTGACTATCCTGGCGGGGGGCTTTCCCTTTCCGGTGGCAGGGGAAGCAGGCAAAGCCTATAACACAGCTACTCTAATTGCCCCCAATGGGCAGGAATTGGCCCGGTACCACAAAGTGCATTTGTTTGATGTTAATGTGCCCGACGGCAATACCTACTGGGAATCGGCCACGGTGATGGCTGGGCAAAAATATCCCCCAGTGTACCACTCCGACAGCTTTGGTAATTTGGGGCTGTCCATTTGCTACGACGTTCGTTTCCCTGAATTGTATCGTTACCTTTCCCGCCAAGGAGCAGATGTTCTGTTTGTGCCCGCCGCTTTCACTGCCTACACCGGCAAGGACCATTGGCAAGTGTTGCTCCAGGCCCGGGCCATTGAAAATACCTGCTACGTCATTGCCCCGGCCCAAACTGGTTGTCATTACGAAAGACGGCATACCCATGGGCATGCCATGATCATTGACCCCTGGGGAGTGATCCTGGCCGATGCGGGGGAAAAACCAGGGTTGGCGATCGCCGAAATTAACCCAGACCGCCTCAAACAGGTGCGCCAACAAATGCCTTCGCTGCAACATCGGGTATTTGTCTGA

Protein

MKPYLAAALQMTSRPNLTENLQEAEELIDLAVRQGAELVGLPENFAFLGNETEKLEQATAIATATEKFLQTMAQRFQVTILAGGFPFPVAGEAGKAYNTATLIAPNGQELARYHKVHLFDVNVPDGNTYWESATVMAGQKYPPVYHSDSFGNLGLSICYDVRFPELYRYLSRQGADVLFVPAAFTAYTGKDHWQVLLQARAIENTCYVIAPAQTGCHYERRHTHGHAMIIDPWGVILADAGEKPGLAIAEINPDRLKQVRQQMPSLQHRVFV