Your browser is old and dusty. Try Google Chrome!

Details for sll0595

ORF sll0595
Accession NP_442539.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -181 -167 17.6992 0.0218
NP_441061.1_2 Reverse -173 -187 9.83269 0.0689
NP_441061.1_2 Forward -187 -173 8.84938 0.083
NP_441061.1_2 Forward -105 -91 1.76955 0.183
NP_440557.1_1 Forward -105 -86 0.0977854 0.265
NP_440795.1_7 Forward -313 -306 14.6904 0.0123
NP_440795.1_7 Reverse -306 -313 14.6904 0.0123
NP_440795.1_7 Forward -105 -98 14.6904 0.0123
NP_440795.1_7 Reverse -98 -105 14.6904 0.0123
NP_441418.1_6 Reverse -97 -116 -13.0786 0.073
NP_442291.1_5 Forward -107 -91 10.9733 0.0409
NP_442291.1_5 Reverse -304 -320 6.15506 0.0727
NP_442291.1_5 Forward -315 -299 3.40179 0.111
NP_442291.1_5 Reverse -96 -112 -3.28472 0.239
NP_441453.1_4 Reverse -305 -313 16.539 0.00633
NP_441453.1_4 Reverse -97 -105 16.539 0.00633
NP_441453.1_4 Forward -314 -306 16.539 0.00633
NP_441453.1_4 Forward -106 -98 16.539 0.00633
NP_441453.1_7 Reverse -122 -129 14.1988 0.175
NP_441453.1_7 Reverse -232 -239 11.9372 0.298
NP_442151.1_6 Forward -106 -92 16.9125 0.013
NP_442151.1_6 Reverse -305 -319 9.83269 0.139
NP_442151.1_6 Forward -92 -78 9.43936 0.148
NP_442151.1_6 Reverse -97 -111 5.70279 0.266
NP_442151.1_6 Forward -182 -168 5.30946 0.284
NP_441818.1_1 Forward -105 -94 18.8393 0.00301
NP_441818.1_1 Reverse -306 -317 18.446 0.0046
NP_441818.1_1 Forward -313 -302 9.30127 0.246
NP_441818.1_1 Reverse -98 -109 9.30127 0.246
NP_440226.1_1 Reverse -305 -324 17.5024 0.0184
NP_440226.1_1 Reverse -97 -116 16.6174 0.0215
NP_440226.1_1 Forward -106 -87 12.1925 0.0465
NP_441630.1_3 Reverse -89 -108 8.94757 0.105
NP_441630.1_3 Forward -322 -303 -0.885524 0.29
NP_440996.1_3 Forward -93 -75 11.8189 0.221
NP_442655.1_1 Reverse -300 -319 10.0292 0.0915
NP_443002.1_5 Forward -187 -169 11.5231 0.247
NP_442173.1_1 Forward -313 -305 15.4574 0.00633
NP_442173.1_1 Forward -105 -97 15.4574 0.00633
NP_442173.1_1 Reverse -306 -314 15.4574 0.00633
NP_442173.1_1 Reverse -98 -106 15.4574 0.00633
NP_442752.1_4 Forward -314 -307 13.8055 0.0199
NP_442752.1_4 Reverse -305 -312 13.8055 0.0199
NP_442752.1_4 Forward -106 -99 13.8055 0.0199
NP_442752.1_4 Reverse -97 -104 13.8055 0.0199
NP_442752.1_4 Reverse -200 -207 7.90559 0.144
NP_442752.1_4 Forward -338 -331 4.95566 0.26
NP_443027.1_4 Forward -108 -98 14.828 0.0437
NP_443027.1_4 Reverse -95 -105 14.0414 0.0452
NP_443027.1_4 Reverse -303 -313 11.8781 0.0872
NP_443027.1_4 Forward -316 -306 11.0914 0.107
NP_441812.1_3 Reverse -96 -110 16.8142 0.0639
NP_441812.1_3 Forward -315 -301 8.55439 0.251
NP_441812.1_3 Forward -107 -93 8.55439 0.251
NP_442975.1_10 Forward -110 -96 21.6317 0.000774
NP_442975.1_10 Reverse -301 -315 13.4703 0.0459
NP_442975.1_10 Reverse -93 -107 4.71887 0.241
NP_440784.1_7 Forward -313 -306 15.9687 0.0123
NP_440784.1_7 Reverse -306 -313 15.9687 0.0123
NP_440784.1_7 Forward -105 -98 15.9687 0.0123
NP_440784.1_7 Reverse -98 -105 15.9687 0.0123
NP_442909.1_7 Reverse -201 -215 7.3738 0.219
NP_440061.1_9 Reverse -303 -317 12.487 0.0964
NP_440061.1_9 Forward -316 -302 5.30886 0.29
NP_441054.1_4 Forward -324 -306 2.57575 0.169
NP_441054.1_4 Forward -116 -98 0.510803 0.174
NP_439979.1_9 Reverse -168 -186 13.2938 0.227
NP_442062.1_8 Forward -314 -304 19.4496 0.000558
NP_442062.1_8 Reverse -97 -107 19.4496 0.000558
NP_442062.1_8 Reverse -305 -315 17.3846 0.00193
NP_442062.1_8 Forward -106 -96 17.3846 0.00193
NP_441859.1_3 Reverse -96 -115 1.86696 0.272
NP_440304.1_4 Forward -108 -98 10.8948 0.051
NP_440304.1_4 Reverse -95 -105 10.8948 0.051
NP_440304.1_4 Reverse -81 -91 6.56821 0.15
NP_440304.1_4 Forward -316 -306 1.84832 0.299
NP_440304.1_4 Reverse -303 -313 1.84832 0.299
NP_442242.1_4 Forward -313 -306 14.3954 0.0124
NP_442242.1_4 Reverse -306 -313 14.3954 0.0124
NP_442242.1_4 Forward -105 -98 14.3954 0.0124
NP_442242.1_4 Reverse -98 -105 14.3954 0.0124
NP_440044.1_8 Forward -313 -294 0.687771 0.193
NP_440044.1_8 Forward -105 -86 -3.73712 0.29
NP_441200.1_4 Forward -260 -241 14.0608 0.156
NP_442110.1_7 Forward -106 -92 9.14437 0.0755
NP_442110.1_7 Reverse -305 -319 0.196253 0.266
NP_442110.1_7 Reverse -318 -332 -0.000409212 0.27
NP_442110.1_7 Forward -188 -174 -0.295402 0.281
NP_442110.1_7 Forward -92 -78 -0.295402 0.281
NP_441082.1_10 Reverse -122 -135 9.16406 0.256
NP_441083.1_5 Reverse -305 -315 20.3345 0.00053
NP_441083.1_5 Forward -106 -96 20.3345 0.00053
NP_441083.1_5 Forward -314 -304 11.3864 0.0159
NP_441083.1_5 Reverse -97 -107 11.3864 0.0159
NP_441434.1_7 Forward -312 -298 5.21113 0.225
NP_441434.1_7 Reverse -307 -321 4.12949 0.225
NP_441738.1_2 Forward -312 -305 15.28 0.0102
NP_441738.1_2 Reverse -307 -314 15.28 0.0102
NP_441738.1_2 Forward -104 -97 15.28 0.0102
NP_441738.1_2 Reverse -99 -106 15.28 0.0102
NP_440209.1_1 Reverse -305 -313 18.1123 0.00295
NP_440209.1_1 Reverse -97 -105 18.1123 0.00295
NP_440209.1_1 Forward -314 -306 18.1123 0.00295
NP_440209.1_1 Forward -106 -98 18.1123 0.00295
NP_442889.1_8 Reverse -302 -316 14.8469 0.0473
NP_442889.1_8 Forward -109 -95 11.9953 0.0713
NP_442889.1_8 Reverse -32 -46 5.21053 0.235
NP_440447.1_1 Reverse -30 -48 5.91901 0.194
NP_440178.1_7 Forward -107 -88 3.04771 0.02
NP_440178.1_7 Reverse -96 -115 -21.24 0.215
NP_442570.1_3 Reverse -124 -143 6.39097 0.154
NP_441716.1_1 Reverse -97 -111 13.8643 0.0689
NP_441716.1_1 Forward -212 -198 5.1128 0.24
NP_441716.1_1 Forward -106 -92 4.22782 0.256
NP_442111.1_4 Reverse -96 -110 7.9644 0.0826
NP_442111.1_4 Forward -315 -301 3.53951 0.24
NP_440906.1_5 Forward -313 -306 15.8704 0.0124
NP_440906.1_5 Reverse -306 -313 15.8704 0.0124
NP_440906.1_5 Forward -105 -98 15.8704 0.0124
NP_440906.1_5 Reverse -98 -105 15.8704 0.0124
NP_440747.1_10 Forward -317 -305 16.8536 0.00143
NP_440747.1_10 Reverse -94 -106 7.51213 0.00286
NP_440747.1_10 Reverse -302 -314 7.31547 0.00577
NP_440747.1_10 Forward -109 -97 -2.02597 0.0196
NP_441130.1_10 Reverse -303 -317 17.6992 0.0162
NP_441130.1_10 Forward -316 -302 15.5359 0.0312
NP_441130.1_10 Forward -108 -94 10.816 0.11
NP_441130.1_10 Reverse -95 -109 9.2427 0.128
NP_441486.1_1 Forward -109 -95 19.8624 0.00318
NP_441486.1_1 Reverse -94 -108 19.6658 0.00323
NP_441486.1_1 Reverse -302 -316 4.91614 0.0399
NP_441486.1_1 Forward -317 -303 4.62115 0.0425
NP_441486.1_1 Forward -191 -177 -1.8687 0.175
NP_441486.1_1 Reverse -176 -190 -4.32697 0.194
NP_442634.1_4 Reverse -171 -185 -5.80194 0.279
NP_441014.1_5 Reverse -195 -213 9.45892 0.276
NP_441014.1_8 Reverse -292 -311 -4.81876 0.257
NP_441014.1_10 Forward -107 -88 -0.00131823 0.246
NP_442848.1_1 Reverse -91 -105 -2.36035 0.263
NP_442848.1_4 Forward -364 -350 11.0127 0.274
NP_441012.1_4 Reverse -79 -92 9.16406 0.272
NP_441012.1_4 Reverse -175 -188 5.91914 0.286
NP_443018.1_3 Forward -313 -306 14.8871 0.0123
NP_443018.1_3 Reverse -306 -313 14.8871 0.0123
NP_443018.1_3 Forward -105 -98 14.8871 0.0123
NP_443018.1_3 Reverse -98 -105 14.8871 0.0123
NP_441634.1_8 Forward -316 -302 14.8476 0.0248
NP_441634.1_8 Reverse -95 -109 12.586 0.0486
NP_441634.1_8 Reverse -303 -317 -4.4253 0.295
NP_440376.1_1 Forward -314 -305 19.4693 0.000692
NP_440376.1_1 Reverse -305 -314 19.4693 0.000692
NP_440376.1_1 Forward -106 -97 19.4693 0.000692
NP_440376.1_1 Reverse -97 -106 19.4693 0.000692
NP_441857.1_5 Forward -321 -303 6.11567 0.197
NP_441857.1_8 Reverse -241 -260 13.5691 0.288
NP_441588.1_4 Reverse -307 -317 8.73149 0.14
NP_441588.1_4 Forward -104 -94 8.63316 0.14
NP_441588.1_4 Forward -312 -302 7.05986 0.178
NP_442687.1_7 Reverse -304 -314 15.8113 0.0125
NP_442687.1_7 Forward -107 -97 15.8113 0.0125
NP_442687.1_7 Forward -165 -155 10.7964 0.0994
NP_442687.1_7 Forward -315 -305 8.92815 0.0994
NP_442687.1_7 Reverse -96 -106 8.92815 0.0994
NP_442191.1_4 Reverse -266 -280 13.0292 0.17
NP_441846.1_10 Forward -244 -225 -13.1769 0.199
NP_440360.1_10 Forward -180 -166 3.8345 0.227
NP_442658.1_1 Reverse -303 -313 17.0891 0.00615
NP_442658.1_1 Forward -108 -98 15.9091 0.00966
NP_442658.1_1 Forward -316 -306 7.94438 0.199
NP_442658.1_1 Reverse -95 -105 6.76441 0.214
NP_442198.1_3 Forward -323 -304 6.68596 0.251
NP_440141.1_3 Reverse -152 -171 2.85105 0.274
NP_442782.1_2 Reverse -173 -187 6.78443 0.218
NP_442205.1_9 Forward -112 -96 -2.89139 0.276
NP_440656.1_8 Reverse -86 -105 -8.06369 0.272
NP_442544.1_6 Forward -113 -94 4.03102 0.0884
NP_441414.1_9 Forward -106 -87 -3.3438 0.134
NP_441414.1_9 Reverse -305 -324 -4.52377 0.156
NP_441414.1_9 Forward -314 -295 -7.37537 0.217
NP_441487.1_9 Forward -107 -88 4.916 0.14
NP_441487.1_9 Reverse -304 -323 -2.95047 0.298
NP_442937.1_5 Reverse -378 -397 8.25926 0.229
NP_441958.1_5 Forward -315 -305 12.2714 0.00183
NP_441958.1_5 Reverse -304 -314 12.2714 0.00183
NP_441958.1_5 Forward -107 -97 12.2714 0.00183
NP_441958.1_5 Reverse -96 -106 12.2714 0.00183
NP_442836.1_5 Forward -320 -301 12.5858 0.0728
NP_442836.1_5 Reverse -299 -318 8.94757 0.139
NP_440203.1_5 Forward -89 -79 14.9258 0.0886
NP_439905.1_1 Reverse -306 -319 11.524 0.204
NP_439905.1_1 Forward -181 -168 9.75405 0.216
NP_440984.1_7 Forward -319 -305 18.7808 0.0121
NP_440984.1_7 Reverse -92 -106 7.57108 0.166
NP_440984.1_7 Reverse -300 -314 5.80112 0.24
NP_439990.1_5 Forward -319 -306 9.16406 0.15
NP_442690.1_1 Reverse -176 -195 -15.6352 0.28
NP_442911.1_2 Forward -116 -97 5.30933 0.0341
NP_442911.1_2 Reverse -87 -106 -3.3438 0.111
NP_442911.1_2 Forward -324 -305 -6.29373 0.18
NP_442911.1_2 Reverse -295 -314 -8.85033 0.244
NP_440153.1_5 Forward -313 -299 2.75286 0.219
NP_440153.1_5 Reverse -98 -112 1.67122 0.245
NP_442064.1_4 Forward -192 -173 9.34008 0.208
NP_443055.1_6 Reverse -89 -107 1.00172 0.237
NP_443055.1_6 Forward -322 -304 -2.24319 0.291
NP_440993.1_3 Reverse -73 -92 6.09517 0.148
NP_440602.1_8 Forward -106 -92 17.5025 0.0898
NP_442210.1_9 Forward -96 -78 12.4089 0.209
NP_440138.1_7 Reverse -145 -163 15.2807 0.278
NP_441099.1_5 Forward -186 -167 -8.16202 0.189
NP_442002.1_9 Reverse -304 -311 10.7572 0.185
NP_442002.1_9 Forward -107 -100 10.7572 0.185
NP_440809.1_9 Forward -115 -97 1.69077 0.121
NP_442598.1_2 Forward -50 -41 15.7327 0.252
NP_441294.1_7 Reverse -301 -315 18.8495 0.00443
NP_441294.1_7 Forward -110 -96 16.5458 0.0138
NP_441294.1_7 Forward -293 -279 9.15464 0.256
NP_442438.1_10 Reverse -92 -106 7.86607 0.0859
NP_442438.1_10 Forward -111 -97 3.53951 0.161
NP_442438.1_10 Forward -319 -305 -0.197071 0.253
NP_442431.1_10 Reverse -167 -185 3.06741 0.225
NP_441292.1_2 Reverse -161 -180 -7.96535 0.263
NP_441000.1_6 Forward -315 -301 14.8476 0.0396
NP_441000.1_6 Reverse -304 -318 4.91614 0.0933
NP_441000.1_6 Reverse -96 -110 4.32615 0.0957
NP_441000.1_6 Forward -107 -93 3.53951 0.111
NP_441000.1_6 Reverse -226 -240 3.14618 0.118
NP_440147.1_4 Reverse -303 -316 17.6205 0.00602
NP_440147.1_4 Forward -316 -303 15.0639 0.0197
NP_440147.1_4 Forward -108 -95 3.36254 0.188
NP_440147.1_4 Reverse -95 -108 0.805932 0.244
NP_441175.1_7 Forward -63 -44 7.07928 0.239
NP_441550.1_8 Forward -316 -306 15.1225 0.0132
NP_441550.1_8 Reverse -95 -105 12.3692 0.0336
NP_441550.1_8 Reverse -303 -313 8.82935 0.112
NP_441550.1_8 Forward -108 -98 6.0761 0.214
NP_441916.1_7 Forward -314 -304 18.4663 0.00144
NP_441916.1_7 Reverse -97 -107 18.4663 0.00144
NP_441916.1_7 Reverse -305 -315 10.3048 0.0261
NP_441916.1_7 Forward -106 -96 10.3048 0.0261
NP_441916.1_10 Reverse -171 -190 2.45773 0.246
NP_441041.1_4 Reverse -167 -186 4.81767 0.0548
NP_441041.1_4 Reverse -173 -192 -2.55715 0.114
NP_441041.1_4 Reverse -97 -116 -11.7019 0.251
NP_441041.1_4 Forward -106 -87 -11.8003 0.252
NP_441041.1_7 Reverse -302 -314 17.9128 0.00663
NP_441041.1_7 Forward -317 -305 10.8188 0.0864
NP_441725.1_5 Forward -105 -95 11.2881 0.0247
NP_441725.1_5 Reverse -98 -108 11.2881 0.0247
NP_441725.1_5 Forward -313 -303 2.04498 0.115
NP_441725.1_5 Reverse -306 -316 2.04498 0.115
NP_439966.1_7 Forward -108 -98 18.4657 0.00473
NP_439966.1_7 Reverse -303 -313 17.9741 0.00631
NP_439966.1_7 Reverse -95 -105 15.8108 0.0124
NP_439966.1_7 Forward -316 -306 15.3192 0.0152
NP_439966.1_7 Reverse -225 -235 5.78111 0.209
NP_439966.1_9 Forward -108 -99 0.983037 0.253
NP_439966.1_9 Reverse -303 -312 0.884706 0.253
NP_442941.1_3 Forward -105 -95 19.9412 0.00262
NP_442941.1_3 Reverse -306 -316 19.2529 0.00262
NP_442941.1_3 Reverse -98 -108 11.4848 0.0116
NP_442941.1_3 Forward -313 -303 10.7964 0.0116
NP_440289.1_2 Reverse -302 -315 20.6688 0.00313
NP_440289.1_2 Forward -109 -96 11.9173 0.0171
NP_440289.1_2 Reverse -94 -107 6.60746 0.0591
NP_440289.1_2 Forward -317 -304 5.91914 0.0605
NP_440260.1_8 Forward -101 -83 -2.14413 0.243
NP_442281.1_1 Reverse -92 -106 17.2068 0.00633
NP_442281.1_1 Forward -319 -305 15.8302 0.0104
NP_442281.1_1 Reverse -300 -314 11.602 0.0447
NP_442281.1_1 Forward -111 -97 3.44058 0.231
NP_442281.1_1 Reverse -78 -92 1.96562 0.282
NP_442256.1_2 Forward -108 -90 -6.96235 0.214
NP_440437.1_1 Reverse -91 -110 6.09597 0.0788
NP_440437.1_1 Reverse -299 -318 2.26107 0.137
NP_440437.1_1 Forward -112 -93 -5.70374 0.292
NP_442049.1_10 Forward -322 -303 2.26107 0.289
NP_441087.1_6 Reverse -226 -244 -2.9315 0.296
NP_442288.1_3 Reverse -115 -132 15.7718 0.0925
NP_441556.1_4 Forward -173 -154 14.3434 0.165
NP_440498.1_1 Forward -115 -97 -1.84914 0.232
NP_442982.1_5 Reverse -87 -106 3.44104 0.209
NP_442982.1_5 Reverse -73 -92 -0.39387 0.254
NP_441644.1_6 Reverse -305 -315 17.3841 0.00127
NP_441644.1_6 Forward -106 -96 17.3841 0.00127
NP_441644.1_6 Forward -314 -304 10.1076 0.0628
NP_441644.1_6 Reverse -97 -107 10.1076 0.0628
NP_441644.1_6 Reverse -173 -183 5.28945 0.199
NP_441644.1_6 Forward -92 -82 3.51951 0.277
NP_441644.1_6 Reverse -83 -93 3.12618 0.297
NP_442215.1_2 Forward -94 -78 13.6282 0.0225
NP_442215.1_2 Forward -190 -174 11.6616 0.038
NP_442215.1_2 Forward -108 -92 5.95839 0.0749
NP_442215.1_2 Reverse -303 -319 4.97508 0.0812
NP_442215.1_2 Forward -364 -348 -0.629782 0.17
NP_442215.1_2 Reverse -113 -129 -2.30141 0.195
NP_442215.1_2 Reverse -170 -186 -3.28472 0.213
NP_442029.1_6 Forward -97 -78 14.9458 0.0999
NP_440253.1_2 Forward -106 -88 16.8337 0.0126
NP_440253.1_2 Forward -314 -296 16.1454 0.0145
NP_440253.1_2 Reverse -97 -115 12.8022 0.0262
NP_440253.1_2 Reverse -305 -323 4.73903 0.1
NP_440253.1_4 Reverse -171 -190 13.6675 0.263
NP_440929.1_8 Forward -314 -305 19.2726 0.000701
NP_440929.1_8 Reverse -305 -314 19.2726 0.000701
NP_440929.1_8 Forward -106 -97 19.2726 0.000701
NP_440929.1_8 Reverse -97 -106 19.2726 0.000701
NP_442933.1_10 Forward -314 -305 17.601 0.00325
NP_442933.1_10 Reverse -305 -314 17.601 0.00325
NP_442933.1_10 Forward -106 -97 17.601 0.00325
NP_442933.1_10 Reverse -97 -106 17.601 0.00325
NP_441751.2_8 Reverse -306 -320 2.75286 0.0759
NP_441751.2_8 Forward -105 -91 -3.147 0.134
NP_441751.2_8 Forward -313 -299 -5.60527 0.223
NP_442926.1_5 Forward -111 -92 12.8913 0.181
NP_442554.1_8 Reverse -306 -316 16.2046 0.0065
NP_442554.1_8 Forward -105 -95 15.9097 0.00747
NP_442554.1_8 Forward -313 -303 14.1397 0.0144
NP_442554.1_8 Reverse -98 -108 13.8447 0.0145
NP_442554.1_8 Forward -181 -171 5.38824 0.15
NP_441762.1_7 Forward -315 -303 2.98891 0.0676
NP_441762.1_7 Reverse -96 -108 2.89058 0.0676
NP_441762.1_7 Reverse -304 -316 2.39892 0.0676
NP_441762.1_7 Forward -107 -95 2.30059 0.0676
NP_442142.1_4 Reverse -94 -107 16.7349 0.0264
NP_442142.1_4 Forward -317 -304 14.7683 0.0302
NP_442142.1_4 Reverse -302 -315 13.8833 0.0324
NP_442142.1_4 Forward -109 -96 7.98351 0.125
NP_442292.1_1 Forward -105 -96 18.486 0.00229
NP_442292.1_1 Reverse -306 -315 18.486 0.00229
NP_442292.1_1 Forward -313 -304 9.63616 0.0183
NP_442292.1_1 Reverse -98 -107 9.63616 0.0183
NP_442292.1_5 Forward -318 -299 -1.96717 0.273
NP_442476.1_6 Reverse -306 -320 13.6676 0.0414
NP_442381.1_8 Forward -239 -220 -14.6519 0.284
NP_442381.1_8 Reverse -302 -321 -15.1435 0.298
NP_443009.1_5 Forward -315 -304 18.3477 0.00265
NP_443009.1_5 Reverse -96 -107 18.3477 0.00265
NP_443009.1_5 Forward -93 -82 4.8764 0.226
NP_441715.1_4 Forward -313 -303 18.8596 0.00741
NP_441715.1_4 Reverse -306 -316 17.3846 0.0106
NP_441715.1_4 Reverse -98 -108 16.303 0.0117
NP_441715.1_4 Forward -105 -95 14.828 0.0268
NP_440357.1_3 Forward -184 -165 -0.885524 0.296
NP_441448.1_1 Reverse -162 -181 10.0292 0.191
NP_441198.1_8 Forward -143 -133 12.5877 0.12
NP_441468.1_1 Forward -313 -306 15.8704 0.0124
NP_441468.1_1 Reverse -306 -313 15.8704 0.0124
NP_441468.1_1 Forward -105 -98 15.8704 0.0124
NP_441468.1_1 Reverse -98 -105 15.8704 0.0124
NP_441020.2_6 Forward -108 -91 7.61033 0.225
NP_441673.1_1 Forward -314 -305 20.8459 0.000698
NP_441673.1_1 Reverse -305 -314 20.8459 0.000698
NP_441673.1_1 Forward -106 -97 20.8459 0.000698
NP_441673.1_1 Reverse -97 -106 20.8459 0.000698
NP_440265.1_7 Reverse -173 -187 15.3386 0.23
NP_441826.1_2 Reverse -91 -105 6.29277 0.0944
NP_441826.1_2 Forward -320 -306 -2.36035 0.271
NP_441826.1_2 Reverse -173 -187 -2.75368 0.275
NP_441826.1_5 Reverse -167 -186 5.70265 0.239
NP_441330.1_5 Forward -178 -159 18.289 0.0437
NP_441330.1_7 Forward -154 -135 28.2204 0.00184
NP_442868.1_6 Forward -316 -306 19.2529 0.00563
NP_442868.1_6 Reverse -303 -313 10.3048 0.038
NP_442868.1_6 Reverse -95 -105 9.91146 0.038
NP_442868.1_6 Forward -108 -98 0.963343 0.205
NP_441056.1_1 Forward -106 -87 -0.295539 0.16
NP_441612.1_2 Reverse -305 -315 8.54929 0.21
NP_441612.1_2 Forward -106 -96 8.54929 0.21
NP_442361.1_3 Reverse -91 -104 9.85238 0.272
NP_442427.1_8 Forward -323 -304 8.94757 0.192
NP_442427.1_8 Forward -115 -96 5.70265 0.256
NP_442808.1_1 Reverse -304 -314 18.4657 0.00201
NP_442808.1_1 Forward -107 -97 18.4657 0.00201
NP_442808.1_1 Reverse -96 -106 8.63269 0.0481
NP_442808.1_1 Forward -315 -305 8.63269 0.0481
NP_442692.1_1 Forward -186 -167 -5.11376 0.274
NP_440145.1_3 Reverse -87 -106 0.884433 0.133
NP_442542.1_2 Reverse -303 -316 15.6539 0.0793
NP_442542.1_2 Forward -108 -95 11.4257 0.114
NP_442050.1_5 Reverse -95 -105 16.4991 0.00812
NP_442050.1_5 Forward -316 -306 14.3359 0.0206
NP_442050.1_5 Forward -108 -98 9.12434 0.193
NP_442050.1_5 Reverse -303 -313 6.96107 0.27
NP_441114.1_3 Reverse -84 -93 7.66954 0.231
NP_440558.1_2 Forward -191 -172 5.30933 0.145
NP_440558.1_2 Forward -185 -166 0.294447 0.193
NP_440558.1_2 Reverse -169 -188 -4.13045 0.243
NP_441518.1_3 Reverse -87 -106 7.47261 0.05
NP_441878.1_6 Forward -315 -305 10.4031 0.0176
NP_441878.1_6 Reverse -304 -314 10.4031 0.0176
NP_441878.1_6 Forward -107 -97 10.4031 0.0176
NP_441878.1_6 Reverse -96 -106 10.4031 0.0176
NP_441878.1_6 Reverse -82 -92 -7.39479 0.222
NP_441036.1_8 Reverse -304 -314 17.7779 0.000554
NP_441036.1_8 Forward -107 -97 17.7779 0.000554
NP_441036.1_8 Forward -315 -305 8.33817 0.174
NP_441036.1_8 Reverse -96 -106 8.33817 0.174
NP_442650.1_2 Reverse -167 -181 3.24451 0.211
NP_441557.1_5 Forward -314 -305 19.9609 0.000699
NP_441557.1_5 Reverse -305 -314 19.9609 0.000699
NP_441557.1_5 Forward -106 -97 19.9609 0.000699
NP_441557.1_5 Reverse -97 -106 19.9609 0.000699
NP_441445.1_1 Forward -115 -96 21.1406 0.021
NP_441445.1_1 Reverse -88 -107 3.24438 0.218
NP_441445.1_1 Reverse -296 -315 2.16274 0.24
NP_442066.2_9 Forward -318 -305 17.9155 0.0209
NP_442066.2_9 Reverse -301 -314 8.77074 0.185
NP_441308.1_8 Forward -108 -98 10.1081 0.22
NP_441458.1_10 Reverse -296 -315 5.89931 0.21
NP_442183.1_1 Reverse -97 -111 8.16106 0.121
NP_442183.1_1 Forward -106 -92 7.37441 0.143
NP_441407.1_5 Reverse -87 -106 10.3242 0.147
NP_441116.1_9 Forward -119 -105 10.9143 0.295
NP_441549.1_9 Reverse -169 -187 -7.84733 0.214
NP_442170.1_5 Forward -106 -87 5.01433 0.154
NP_442347.1_2 Reverse -306 -315 12.4878 0.056
NP_442347.1_2 Forward -105 -96 12.4878 0.056
NP_442347.1_2 Forward -313 -304 11.1111 0.056
NP_442347.1_2 Reverse -98 -107 11.1111 0.056
NP_442645.1_2 Reverse -89 -108 -4.32711 0.0562
NP_442645.1_2 Forward -322 -303 -11.9969 0.144
NP_442645.1_2 Forward -329 -310 -20.1584 0.288
NP_442888.1_6 Forward -325 -306 5.01433 0.228
NP_441037.1_4 Forward -108 -98 7.02532 0.237
NP_441037.1_4 Reverse -303 -313 6.92787 0.237
NP_441633.1_3 Forward -316 -303 10.8357 0.0286
NP_441633.1_3 Reverse -303 -316 5.72248 0.0481
NP_441633.1_3 Reverse -95 -108 1.29759 0.109
NP_441633.1_3 Forward -108 -95 -3.81562 0.177
NP_441633.1_10 Forward -293 -274 19.174 0.0981
NP_440136.1_2 Forward -313 -306 15.9687 0.0123
NP_440136.1_2 Reverse -306 -313 15.9687 0.0123
NP_440136.1_2 Forward -105 -98 15.9687 0.0123
NP_440136.1_2 Reverse -98 -105 15.9687 0.0123
NP_442590.1_10 Forward -194 -175 8.06259 0.215
NP_442998.1_10 Forward -312 -305 15.5754 0.0102
NP_442998.1_10 Reverse -307 -314 15.5754 0.0102
NP_442998.1_10 Forward -104 -97 15.5754 0.0102
NP_442998.1_10 Reverse -99 -106 15.5754 0.0102
NP_440899.1_2 Forward -325 -306 16.0265 0.0666
NP_440299.1_1 Forward -110 -97 8.18017 0.0964
NP_440299.1_1 Reverse -93 -106 4.44361 0.207
NP_440299.1_1 Forward -318 -305 2.28034 0.292
NP_441799.1_1 Forward -318 -304 16.1252 0.0153
NP_441799.1_1 Reverse -93 -107 12.5853 0.0421
NP_441799.1_1 Forward -110 -96 12.487 0.043
NP_441799.1_1 Reverse -301 -315 10.0287 0.0797
NP_441799.1_4 Forward -181 -162 -5.40875 0.219
NP_441007.1_10 Forward -319 -306 10.1474 0.0738
NP_441007.1_10 Reverse -92 -105 0.805932 0.216
NP_441007.1_10 Reverse -168 -181 0.117615 0.25
NP_440256.1_1 Forward -317 -298 16.4207 0.0061
NP_440256.1_1 Reverse -94 -113 12.1925 0.0125
NP_440256.1_1 Reverse -302 -321 2.16274 0.0669
NP_440256.1_1 Forward -95 -76 -8.85033 0.268
NP_441559.1_8 Reverse -300 -314 3.53951 0.143
NP_441559.1_8 Forward -111 -97 2.5562 0.143
NP_441559.1_8 Reverse -78 -92 -6.88358 0.281
NP_440915.1_6 Reverse -301 -315 3.63784 0.101
NP_440915.1_6 Forward -318 -304 1.67122 0.132
NP_440915.1_6 Forward -231 -217 -1.18038 0.224
NP_442855.1_3 Forward -238 -219 12.6841 0.237
NP_441866.1_6 Forward -94 -75 7.17681 0.285
NP_441704.1_8 Forward -117 -98 7.86512 0.225
NP_442866.1_1 Reverse -167 -186 -6.88371 0.261
NP_442866.1_1 Forward -97 -78 -7.96535 0.274
NP_442993.1_1 Reverse -97 -113 1.33684 0.0555
NP_442993.1_1 Forward -314 -298 1.33684 0.0555
NP_442993.1_1 Forward -106 -90 -7.61128 0.146
NP_442386.1_9 Reverse -304 -313 15.7322 0.0144
NP_442386.1_9 Forward -107 -98 15.7322 0.0144
NP_442386.1_9 Reverse -96 -105 13.8639 0.0289
NP_442386.1_9 Forward -315 -306 13.8639 0.0289
NP_441750.1_4 Forward -110 -91 4.22769 0.22
NP_441340.1_5 Forward -313 -306 15.6737 0.0124
NP_441340.1_5 Reverse -306 -313 15.6737 0.0124
NP_441340.1_5 Forward -105 -98 15.6737 0.0124
NP_441340.1_5 Reverse -98 -105 15.6737 0.0124
NP_442484.1_2 Forward -325 -306 9.43923 0.131
NP_440161.1_3 Forward -316 -297 14.1591 0.123
NP_442714.1_7 Reverse -306 -325 -2.0655 0.292
NP_440586.1_8 Forward -313 -306 13.2151 0.026
NP_440586.1_8 Forward -105 -98 13.2151 0.026
NP_440586.1_8 Reverse -306 -313 13.2151 0.026
NP_440586.1_8 Reverse -98 -105 13.2151 0.026
NP_440586.1_8 Forward -201 -194 7.02027 0.279
NP_442251.1_6 Forward -313 -306 15.2804 0.0124
NP_442251.1_6 Reverse -306 -313 15.2804 0.0124
NP_442251.1_6 Forward -105 -98 15.2804 0.0124
NP_442251.1_6 Reverse -98 -105 15.2804 0.0124
NP_441262.1_3 Reverse -305 -312 14.7888 0.0223
NP_441262.1_3 Reverse -97 -104 14.7888 0.0223
NP_441262.1_3 Forward -314 -307 14.7888 0.0223
NP_441262.1_3 Forward -106 -99 14.7888 0.0223
NP_440027.1_3 Reverse -217 -235 4.04996 0.262
NP_440027.1_8 Forward -191 -172 7.17681 0.269
NP_443051.1_1 Reverse -304 -313 10.4228 0.00754
NP_443051.1_1 Reverse -96 -105 10.4228 0.00754
NP_443051.1_1 Forward -315 -306 10.4228 0.00754
NP_443051.1_1 Forward -107 -98 10.4228 0.00754
NP_439996.1_1 Reverse -167 -186 7.86593 0.263
NP_439937.1_9 Reverse -96 -113 2.69307 0.0798
NP_439937.1_9 Forward -315 -298 -16.5797 0.287
NP_440439.1_1 Forward -109 -96 10.639 0.0362
NP_440439.1_1 Reverse -302 -315 3.06754 0.121
NP_440439.1_1 Forward -317 -304 1.9859 0.138
NP_440439.1_1 Reverse -94 -107 0.117615 0.202
NP_440372.1_2 Forward -313 -306 16.3621 0.0124
NP_440372.1_2 Reverse -306 -313 16.3621 0.0124
NP_440372.1_2 Forward -105 -98 16.3621 0.0124
NP_440372.1_2 Reverse -98 -105 16.3621 0.0124
NP_440574.1_3 Forward -111 -92 2.16274 0.173
NP_441789.1_7 Reverse -226 -245 -1.77127 0.254
NP_441803.1_2 Forward -332 -313 -0.983855 0.293
NP_440139.1_1 Forward -112 -93 2.06362 0.24
NP_441572.1_7 Forward -320 -301 -2.85214 0.203
NP_440267.1_2 Reverse -92 -106 8.45543 0.162
NP_442384.1_10 Reverse -305 -318 11.6223 0.0341
NP_442384.1_10 Reverse -97 -110 8.37742 0.0656
NP_442384.1_10 Forward -314 -301 2.87088 0.21
NP_442384.1_10 Forward -106 -93 1.10092 0.268
NP_442114.1_4 Forward -314 -303 9.20345 0.17
NP_441631.1_6 Forward -322 -303 18.289 0.238
NP_441018.1_7 Reverse -169 -188 9.24257 0.23
NP_441018.1_7 Reverse -122 -141 8.55425 0.242
NP_441018.1_7 Forward -192 -173 8.45592 0.246
NP_442262.1_10 Forward -313 -306 14.1988 0.0123
NP_442262.1_10 Reverse -306 -313 14.1988 0.0123
NP_442262.1_10 Forward -105 -98 14.1988 0.0123
NP_442262.1_10 Reverse -98 -105 14.1988 0.0123
NP_441689.1_5 Reverse -95 -105 15.3192 0.0403
NP_441689.1_5 Forward -108 -98 8.53436 0.132
NP_441689.1_5 Forward -316 -306 5.78111 0.197
NP_440163.1_10 Reverse -94 -104 11.3864 0.169
NP_440344.1_10 Forward -113 -96 12.0352 0.006
NP_440344.1_10 Reverse -298 -315 3.48043 0.0268
NP_440344.1_10 Forward -321 -304 -8.81095 0.134
NP_440344.1_10 Reverse -90 -107 -9.00761 0.137
NP_440344.1_10 Reverse -193 -210 -12.9408 0.269
NP_440282.1_3 Forward -193 -174 -4.13045 0.298
NP_440531.1_6 Forward -322 -303 16.2241 0.0353
NP_441335.1_8 Forward -22 -3 11.4058 0.204
NP_441965.1_10 Reverse -302 -318 8.90832 0.123
NP_441965.1_10 Reverse -94 -110 2.71347 0.284
NP_440297.1_8 Forward -362 -344 12.4089 0.241
NP_440297.1_9 Forward -105 -95 9.32148 0.0917
NP_440297.1_9 Reverse -98 -108 9.32148 0.0917
NP_440297.1_9 Forward -187 -177 3.91327 0.253
NP_440297.1_9 Forward -313 -303 -0.118297 0.282
NP_440297.1_9 Reverse -306 -316 -0.118297 0.282
NP_441896.1_3 Forward -323 -304 2.85105 0.183
NP_441896.1_3 Reverse -204 -223 -0.000545616 0.231
NP_443036.1_10 Reverse -323 -342 3.04771 0.287
NP_440999.1_9 Reverse -301 -315 11.406 0.0448
NP_440999.1_9 Forward -110 -96 2.65453 0.146
NP_440999.1_9 Forward -318 -304 -0.983719 0.223
NP_440888.1_2 Forward -106 -92 18.0918 0.00261
NP_440888.1_2 Reverse -305 -319 16.4202 0.00685
NP_440888.1_2 Reverse -97 -111 15.2402 0.0118
NP_440888.1_2 Forward -314 -300 14.8469 0.0144
NP_440888.1_2 Forward -92 -78 11.5037 0.0657
NP_440888.1_2 Forward -188 -174 6.88214 0.217
NP_440491.1_1 Forward -109 -90 12.0823 0.157
NP_442033.1_10 Reverse -303 -322 -11.1119 0.25
NP_441543.1_2 Forward -313 -304 18.486 0.00236
NP_441543.1_2 Reverse -98 -107 18.486 0.00236
NP_441543.1_2 Forward -105 -96 16.9127 0.00359
NP_441543.1_2 Reverse -306 -315 16.9127 0.00359
NP_442845.1_2 Forward -320 -306 6.3911 0.21
NP_442845.1_2 Reverse -91 -105 5.01447 0.247
NP_441551.1_5 Forward -110 -94 6.84268 0.256
NP_441469.1_8 Reverse -304 -313 16.126 0.00797
NP_441469.1_8 Forward -107 -98 16.126 0.00797
NP_441469.1_8 Forward -315 -306 6.48957 0.227
NP_441469.1_8 Reverse -96 -105 6.48957 0.227
NP_442315.1_3 Reverse -173 -192 7.37428 0.233
NP_443064.1_6 Forward -209 -199 14.0213 0.0796
NP_443064.1_6 Reverse -305 -315 12.5669 0.0796
NP_443064.1_6 Forward -106 -96 12.5669 0.0796
NP_442337.1_8 Reverse -121 -140 -1.37718 0.28
NP_442578.1_7 Forward -313 -306 14.5921 0.026
NP_442578.1_7 Forward -105 -98 14.5921 0.026
NP_442578.1_7 Reverse -306 -313 14.5921 0.026
NP_442578.1_7 Reverse -98 -105 14.5921 0.026
NP_440071.1_1 Reverse -165 -182 8.00291 0.295
NP_441462.1_2 Forward -314 -304 11.5831 0.00406
NP_441462.1_2 Reverse -305 -315 11.5831 0.00406
NP_441462.1_2 Forward -106 -96 11.5831 0.00406
NP_441462.1_2 Reverse -97 -107 11.5831 0.00406
NP_443062.1_1 Forward -106 -88 8.05839 0.16
NP_443062.1_1 Forward -314 -296 6.59578 0.195
NP_443062.1_6 Reverse -297 -316 4.12936 0.221
NP_443062.1_6 Forward -322 -303 0.982764 0.283
NP_440889.1_4 Forward -66 -47 11.6025 0.108
NP_442204.1_1 Reverse -79 -90 0.746988 0.281
NP_442204.1_1 Reverse -141 -152 0.451995 0.281
NP_442600.1_4 Reverse -217 -236 21.0313 0.0487
NP_440516.1_2 Reverse -299 -317 3.85406 0.143
NP_440516.1_6 Reverse -225 -239 9.6354 0.236
NP_440516.1_8 Forward -314 -305 16.9127 0.00442
NP_440516.1_8 Reverse -305 -314 16.9127 0.00442
NP_440516.1_8 Forward -106 -97 16.9127 0.00442
NP_440516.1_8 Reverse -97 -106 16.9127 0.00442
NP_442428.1_5 Forward -313 -306 15.8704 0.0124
NP_442428.1_5 Reverse -306 -313 15.8704 0.0124
NP_442428.1_5 Forward -105 -98 15.8704 0.0124
NP_442428.1_5 Reverse -98 -105 15.8704 0.0124
NP_441443.1_1 Forward -293 -274 -1.86883 0.252
NP_442120.1_10 Reverse -167 -186 -9.34199 0.242
NP_440603.1_9 Forward -221 -202 3.83436 0.278
NP_440673.1_3 Forward -312 -305 12.4288 0.0426
NP_440673.1_3 Forward -104 -97 12.4288 0.0426
NP_440673.1_3 Reverse -307 -314 12.4288 0.0426
NP_440673.1_3 Reverse -99 -106 12.4288 0.0426
NP_440673.1_3 Forward -90 -83 6.72562 0.277
NP_440673.1_7 Reverse -307 -326 6.39097 0.155
NP_440865.1_9 Forward -124 -105 -7.37537 0.244
NP_441052.1_2 Reverse -305 -315 19.9412 0.00106
NP_441052.1_2 Forward -106 -96 19.9412 0.00106
NP_441052.1_2 Forward -314 -304 10.5014 0.0285
NP_441052.1_2 Reverse -97 -107 10.5014 0.0285
NP_441052.1_2 Reverse -83 -93 4.3066 0.161
NP_441052.1_2 Reverse -35 -45 0.57002 0.256
NP_442219.1_8 Forward -110 -91 11.4526 0.177
NP_442219.1_9 Forward -105 -96 17.7976 0.00718
NP_442219.1_9 Reverse -306 -315 17.7976 0.00718
NP_442219.1_9 Forward -313 -304 8.35786 0.0681
NP_442219.1_9 Reverse -98 -107 8.35786 0.0681
NP_440436.1_4 Forward -313 -304 18.1905 0.00233
NP_440436.1_4 Reverse -98 -107 18.1905 0.00233
NP_440436.1_4 Forward -105 -96 17.2072 0.00233
NP_440436.1_4 Reverse -306 -315 17.2072 0.00233
NP_441884.1_9 Reverse -302 -321 -5.21209 0.0594
NP_441884.1_9 Forward -109 -90 -22.715 0.284
NP_440314.1_9 Reverse -306 -325 -6.39206 0.228
NP_442907.1_9 Reverse -173 -192 -5.40875 0.284
NP_441719.1_4 Forward -313 -306 16.3621 0.0124
NP_441719.1_4 Reverse -306 -313 16.3621 0.0124
NP_441719.1_4 Forward -105 -98 16.3621 0.0124
NP_441719.1_4 Reverse -98 -105 16.3621 0.0124
NP_441733.1_10 Reverse -94 -107 9.95071 0.106
NP_441733.1_10 Forward -317 -304 9.85238 0.106
NP_441004.1_1 Reverse -167 -186 -10.3253 0.219
NP_441004.1_2 Reverse -162 -181 -3.54046 0.282
NP_441577.1_10 Reverse -93 -112 10.8159 0.198
NP_442366.1_3 Forward -107 -89 9.16393 0.0578
NP_442366.1_3 Reverse -171 -189 4.54237 0.0961
NP_442366.1_3 Forward -315 -297 -2.0458 0.219
NP_443054.1_2 Forward -316 -302 10.6193 0.0761
NP_443054.1_2 Forward -108 -94 3.34284 0.24
NP_443054.1_2 Reverse -95 -109 2.94952 0.24
NP_443054.1_2 Reverse -303 -317 1.47456 0.245
NP_441851.1_10 Reverse -304 -314 16.008 0.00552
NP_441851.1_10 Forward -107 -97 16.008 0.00552
NP_441851.1_10 Forward -315 -305 15.8113 0.00552
NP_441851.1_10 Reverse -96 -106 15.8113 0.00552
NP_441501.1_6 Forward -101 -82 14.4541 0.272
NP_442515.1_1 Reverse -96 -110 9.83269 0.0596
NP_442515.1_1 Forward -315 -301 3.04785 0.125
NP_442515.1_1 Reverse -304 -318 2.2612 0.14
NP_442515.1_1 Forward -107 -93 0.687908 0.183
NP_441396.1_5 Reverse -194 -203 8.35786 0.224
NP_440593.1_3 Forward -186 -167 -2.45882 0.226
NP_440593.1_3 Reverse -174 -193 -7.57203 0.297
NP_442689.1_8 Reverse -180 -197 -6.35267 0.281
NP_441349.1_10 Reverse -295 -314 14.3558 0.0159
NP_441349.1_10 Forward -116 -97 -6.88371 0.238
NP_441349.1_10 Reverse -87 -106 -8.16202 0.269
NP_441409.1_6 Forward -112 -93 10.7175 0.024
NP_441409.1_6 Forward -320 -301 -7.17871 0.145
NP_440389.1_2 Forward -142 -123 12.8808 0.264
NP_440432.1_9 Forward -105 -90 7.64971 0.0427
NP_440432.1_9 Reverse -306 -321 4.50312 0.0691
NP_440432.1_9 Forward -313 -298 -3.36336 0.179
NP_442843.1_1 Forward -260 -241 -8.06369 0.253
NP_439960.1_10 Forward -321 -303 3.75572 0.163
NP_440474.1_8 Reverse -98 -112 11.012 0.119
NP_440474.1_8 Forward -105 -91 5.70218 0.244
NP_442450.1_5 Reverse -95 -105 9.32148 0.115
NP_442450.1_5 Forward -108 -98 9.32148 0.115
NP_440588.1_2 Forward -371 -352 -6.49039 0.283
NP_440040.1_6 Reverse -138 -157 8.75091 0.181
NP_440943.1_5 Forward -94 -80 12.8809 0.244
NP_443047.1_7 Forward -105 -86 4.12936 0.271
NP_440483.1_1 Forward -241 -222 -7.27704 0.258
NP_442243.1_1 Reverse -77 -95 2.08335 0.204
NP_441570.1_1 Forward -106 -88 -1.65248 0.0583
NP_441570.1_1 Reverse -305 -323 -16.5988 0.249
NP_441078.1_4 Forward -314 -305 19.6659 0.0007
NP_441078.1_4 Reverse -305 -314 19.6659 0.0007
NP_441078.1_4 Forward -106 -97 19.6659 0.0007
NP_441078.1_4 Reverse -97 -106 19.6659 0.0007
NP_441078.1_4 Reverse -83 -92 -1.37691 0.254
NP_441528.1_2 Reverse -163 -182 5.99684 0.297
NP_442443.1_1 Forward -259 -240 -5.11376 0.281
NP_440526.1_3 Reverse -306 -317 10.2846 0.0646
NP_440526.1_3 Forward -105 -94 10.1862 0.0646
NP_440526.1_3 Forward -313 -302 2.02482 0.267
NP_441432.1_8 Reverse -96 -105 16.8143 0.00595
NP_441432.1_8 Forward -315 -306 16.8143 0.00595
NP_441432.1_8 Reverse -178 -187 12.2911 0.0444
NP_441432.1_8 Reverse -82 -91 11.9961 0.0519
NP_441432.1_8 Reverse -304 -313 8.25953 0.0755
NP_441432.1_8 Forward -107 -98 8.25953 0.0755
NP_441432.1_8 Reverse -172 -181 5.21127 0.185
NP_441432.1_8 Reverse -34 -43 2.94966 0.28
NP_442320.1_8 Reverse -91 -105 11.8976 0.0175
NP_442320.1_8 Forward -112 -98 6.98109 0.0223
NP_442320.1_8 Forward -320 -306 4.91614 0.0442
NP_442320.1_8 Reverse -299 -313 -1.96703 0.0847
NP_441732.1_2 Forward -186 -170 -7.21796 0.076
NP_441732.1_2 Forward -110 -94 -7.90627 0.0983
NP_441732.1_2 Reverse -93 -109 -16.2644 0.165
NP_441732.1_2 Forward -168 -152 -16.6577 0.186
NP_441732.1_2 Reverse -79 -95 -16.6577 0.186
NP_440760.1_1 Reverse -305 -324 -4.91709 0.0475
NP_440760.1_1 Forward -106 -87 -20.4534 0.222
NP_442797.1_6 Reverse -331 -350 6.86764 0.299
NP_440199.1_10 Reverse -94 -104 16.7946 0.0381
NP_440199.1_10 Forward -109 -99 13.2547 0.108
NP_440199.1_10 Forward -317 -307 7.25653 0.231
NP_441945.1_10 Reverse -154 -173 12.9791 0.203
NP_442353.1_4 Reverse -299 -318 7.17681 0.167
NP_442489.1_2 Reverse -294 -313 3.24438 0.242
NP_442489.1_2 Forward -117 -98 1.76941 0.285
NP_442489.1_7 Forward -314 -305 20.1576 0.000695
NP_442489.1_7 Reverse -305 -314 20.1576 0.000695
NP_442489.1_7 Forward -106 -97 20.1576 0.000695
NP_442489.1_7 Reverse -97 -106 20.1576 0.000695
NP_442489.1_7 Reverse -83 -92 -1.57357 0.213
NP_442489.1_7 Forward -92 -83 -2.06522 0.288
NP_441706.1_10 Forward -317 -298 10.6192 0.215
NP_441706.1_10 Reverse -94 -113 9.63589 0.245
NP_440559.1_1 Forward -105 -96 17.4043 0.00658
NP_440559.1_1 Reverse -306 -315 17.4043 0.00658
NP_440559.1_1 Reverse -98 -107 8.75118 0.0586
NP_440559.1_1 Forward -313 -304 8.75118 0.0586
NP_441659.2_8 Reverse -305 -315 18.1713 0.00133
NP_441659.2_8 Forward -106 -96 18.1713 0.00133
NP_441659.2_8 Forward -314 -304 11.9764 0.0147
NP_441659.2_8 Reverse -97 -107 11.9764 0.0147
NP_442913.1_10 Reverse -88 -107 2.16274 0.131
NP_442913.1_10 Reverse -296 -315 -3.93378 0.221
NP_441040.1_5 Forward -147 -128 3.6377 0.269
NP_441807.1_5 Forward -325 -306 7.96426 0.262
NP_440779.1_5 Forward -106 -89 -14.5141 0.246
NP_440779.1_5 Forward -314 -297 -14.9075 0.287
NP_442346.1_5 Forward -315 -305 16.6963 0.00248
NP_442346.1_5 Reverse -96 -106 16.6963 0.00248
NP_442346.1_5 Reverse -82 -92 9.41981 0.118
NP_442346.1_5 Forward -107 -97 9.02648 0.118
NP_442346.1_5 Reverse -304 -314 9.02648 0.118
NP_442346.1_5 Reverse -385 -395 4.3066 0.291
NP_440545.1_3 Forward -293 -276 -5.76269 0.259
NP_440545.1_3 Reverse -93 -110 -5.86102 0.262
NP_440545.1_3 Reverse -169 -186 -6.54933 0.283
NP_441856.1_3 Reverse -302 -321 0.58944 0.213
NP_441856.1_3 Forward -109 -90 -1.27885 0.236
NP_440025.1_1 Forward -110 -91 9.53756 0.192
NP_440025.1_3 Reverse -239 -253 15.8387 0.181
NP_440459.1_2 Reverse -303 -320 10.5603 0.196
NP_440459.1_2 Forward -190 -173 8.49531 0.259
NP_440459.1_2 Reverse -68 -85 7.90532 0.276
NP_440459.1_5 Forward -251 -233 15.5554 0.278
NP_440010.1_3 Forward -238 -219 -6.88371 0.26
NP_442900.1_1 Forward -27 -8 -6.29373 0.238
NP_442603.1_7 Reverse -200 -214 13.6669 0.0819
NP_442603.1_7 Reverse -305 -319 9.83206 0.139
NP_441585.1_5 Forward -171 -152 3.53858 0.255
NP_441888.1_7 Reverse -300 -314 2.5562 0.225
NP_441948.1_4 Reverse -298 -316 14.4738 0.0318
NP_441948.1_4 Forward -113 -95 -1.55415 0.146
NP_441948.1_4 Forward -321 -303 -2.24246 0.163
NP_441948.1_4 Reverse -90 -108 -3.6191 0.201
NP_441833.1_4 Forward -313 -306 15.9687 0.0124
NP_441833.1_4 Reverse -306 -313 15.9687 0.0124
NP_441833.1_4 Forward -105 -98 15.9687 0.0124
NP_441833.1_4 Reverse -98 -105 15.9687 0.0124
NP_442162.1_9 Forward -313 -306 16.2637 0.0124
NP_442162.1_9 Reverse -306 -313 16.2637 0.0124
NP_442162.1_9 Forward -105 -98 16.2637 0.0124
NP_442162.1_9 Reverse -98 -105 16.2637 0.0124
NP_440788.1_8 Forward -343 -324 13.6675 0.265
NP_440671.1_4 Forward -112 -98 7.37441 0.219
NP_440671.1_4 Forward -188 -174 7.17775 0.226
NP_440671.1_4 Reverse -91 -105 6.48943 0.245
NP_440671.1_4 Reverse -299 -313 5.01447 0.297
NP_440671.1_7 Reverse -233 -252 18.4857 0.235
NP_440224.1_1 Forward -325 -306 5.89931 0.132
NP_442045.1_5 Reverse -88 -107 1.37609 0.261
NP_442199.1_5 Forward -114 -95 -6.39206 0.273
NP_442140.1_3 Forward -313 -303 14.238 0.0486
NP_442140.1_3 Reverse -306 -316 10.3048 0.0902
NP_442140.1_3 Reverse -98 -108 8.33817 0.119
NP_442140.1_3 Forward -105 -95 4.40493 0.243
NP_442021.1_3 Forward -225 -206 -7.17871 0.265
NP_440875.1_9 Forward -312 -302 16.6457 0.0145
NP_440875.1_9 Reverse -307 -317 7.69067 0.255
NP_441813.1_5 Reverse -303 -313 19.4496 0.00647
NP_441813.1_5 Forward -316 -306 18.1713 0.00743
NP_441813.1_5 Forward -108 -98 17.188 0.00979
NP_441813.1_5 Reverse -95 -105 15.9097 0.01
NP_440590.1_4 Forward -313 -300 13.884 0.0119
NP_440590.1_4 Reverse -306 -319 11.3273 0.0209
NP_440590.1_4 Reverse -98 -111 5.52582 0.0585
NP_440590.1_4 Forward -105 -92 2.57589 0.0845
NP_440590.1_4 Reverse -201 -214 -5.68391 0.286
NP_440567.1_1 Reverse -306 -320 7.9644 0.0637
NP_440567.1_1 Forward -105 -91 6.29277 0.085
NP_440567.1_1 Reverse -98 -112 2.75286 0.164
NP_442497.1_10 Forward -313 -304 10.4228 0.0087
NP_442497.1_10 Forward -105 -96 10.4228 0.0087
NP_442497.1_10 Reverse -306 -315 10.4228 0.0087
NP_442497.1_10 Reverse -98 -107 10.4228 0.0087
NP_440821.1_4 Forward -108 -98 19.0562 0.00399
NP_440821.1_4 Reverse -95 -105 18.2696 0.00448
NP_440821.1_4 Reverse -303 -313 10.2065 0.0163
NP_440821.1_4 Forward -316 -306 9.41981 0.0286
NP_441239.1_9 Reverse -303 -315 14.1986 0.0288
NP_441239.1_9 Forward -108 -96 13.3137 0.037
NP_441239.1_9 Forward -316 -304 7.80712 0.148
NP_441239.1_9 Reverse -95 -107 6.92215 0.173
NP_441951.1_9 Reverse -310 -329 -1.27885 0.289
NP_440706.1_1 Forward -318 -299 4.62101 0.102
NP_442044.1_1 Forward -187 -168 -14.1602 0.283
NP_441508.1_4 Reverse -41 -55 13.1895 0.297
NP_442643.1_5 Forward -60 -41 -6.29373 0.293
NP_441017.1_6 Reverse -93 -107 11.7987 0.242
NP_441017.1_6 Forward -110 -96 10.8154 0.298
NP_442629.1_3 Forward -223 -204 2.45773 0.275
NP_442216.1_4 Reverse -134 -142 8.1805 0.255
NP_440354.1_5 Reverse -128 -147 5.99764 0.19
NP_440354.1_5 Forward -95 -76 2.45773 0.253
NP_440354.1_7 Reverse -91 -109 5.72234 0.297
NP_442138.1_10 Forward -106 -87 -7.57203 0.29
NP_440546.1_4 Forward -314 -304 11.8882 0.0679
NP_440546.1_4 Reverse -97 -107 11.8882 0.0679
NP_440546.1_4 Reverse -305 -315 10.046 0.109
NP_440546.1_4 Forward -106 -96 10.046 0.109
NP_440462.1_6 Reverse -303 -313 17.2863 0.00752
NP_440462.1_6 Forward -108 -98 15.418 0.0142
NP_440462.1_6 Forward -316 -306 9.61647 0.0429
NP_440462.1_6 Reverse -95 -105 7.74818 0.0699
NP_440868.1_4 Forward -110 -98 18.0335 0.0124
NP_440868.1_4 Reverse -301 -313 10.3637 0.0388
NP_440868.1_4 Forward -318 -306 10.0687 0.0405
NP_440868.1_4 Reverse -93 -105 5.93884 0.0879
NP_442402.1_4 Reverse -75 -94 -9.14605 0.285
NP_442402.1_10 Reverse -135 -145 10.5993 0.287
NP_441084.1_6 Reverse -81 -95 14.192 0.106
NP_440653.1_10 Forward -187 -168 1.96607 0.29
NP_442358.1_1 Reverse -89 -107 14.2771 0.246
NP_442039.1_4 Forward -313 -306 15.1821 0.0124
NP_442039.1_4 Reverse -306 -313 15.1821 0.0124
NP_442039.1_4 Forward -105 -98 15.1821 0.0124
NP_442039.1_4 Reverse -98 -105 15.1821 0.0124
NP_442039.1_7 Forward -84 -74 11.8781 0.257
NP_442039.1_7 Forward -179 -169 7.35486 0.277
NP_442039.1_7 Reverse -181 -191 6.76487 0.299
NP_442829.1_2 Forward -285 -269 9.39733 0.287
NP_441926.1_3 Forward -106 -90 5.6634 0.17
NP_442837.1_3 Forward -313 -306 15.7721 0.0124
NP_442837.1_3 Reverse -306 -313 15.7721 0.0124
NP_442837.1_3 Forward -105 -98 15.7721 0.0124
NP_442837.1_3 Reverse -98 -105 15.7721 0.0124
NP_440160.1_2 Forward -245 -226 -0.4922 0.232
NP_442053.1_1 Forward -314 -305 18.3876 0.0007
NP_442053.1_1 Reverse -305 -314 18.3876 0.0007
NP_442053.1_1 Forward -106 -97 18.3876 0.0007
NP_442053.1_1 Reverse -97 -106 18.3876 0.0007
NP_440505.1_3 Forward -316 -306 18.3679 0.00213
NP_440505.1_3 Reverse -95 -105 16.303 0.00696
NP_440505.1_3 Reverse -303 -313 15.9097 0.00857
NP_440505.1_3 Forward -108 -98 13.8447 0.0247
NP_440505.1_7 Forward -51 -32 0.687771 0.257
NP_441701.1_3 Reverse -163 -180 16.2635 0.163
NP_441252.1_6 Forward -246 -239 11.9372 0.25
NP_442532.1_3 Forward -58 -39 17.4694 0.202
NP_440548.1_5 Forward -349 -330 17.7965 0.223
NP_440914.1_1 Reverse -305 -315 17.5935 0.000537
NP_440914.1_1 Forward -106 -96 17.5935 0.000537
NP_440914.1_1 Reverse -83 -93 12.6163 0.0518
NP_440914.1_1 Reverse -173 -183 9.00547 0.186
NP_440914.1_1 Forward -314 -304 8.6151 0.186
NP_440914.1_1 Reverse -97 -107 8.6151 0.186
NP_440914.1_1 Forward -187 -177 8.41992 0.191
NP_440914.1_1 Reverse -54 -64 6.3705 0.283
NP_441011.1_8 Forward -313 -304 16.9127 0.00602
NP_441011.1_8 Reverse -98 -107 16.9127 0.00602
NP_441011.1_8 Reverse -306 -315 8.25953 0.144
NP_441011.1_8 Forward -105 -96 8.25953 0.144
NP_442101.1_10 Reverse -89 -108 0.58944 0.0913
NP_442101.1_10 Forward -100 -81 -5.80207 0.177
NP_442533.1_1 Forward -250 -231 -14.9469 0.248
NP_442533.1_6 Forward -314 -305 17.2076 0.00137
NP_442533.1_6 Reverse -305 -314 17.2076 0.00137
NP_442533.1_6 Forward -106 -97 17.2076 0.00137
NP_442533.1_6 Reverse -97 -106 17.2076 0.00137
NP_442533.1_6 Reverse -83 -92 5.11294 0.155
NP_442541.1_10 Forward -182 -168 3.8339 0.252
NP_441482.1_7 Reverse -299 -313 -10.2268 0.209
NP_441482.1_7 Forward -188 -174 -12.0951 0.29
NP_439944.1_9 Forward -105 -95 19.0562 0.00329
NP_439944.1_9 Reverse -306 -316 10.5014 0.0887
NP_439944.1_9 Reverse -98 -108 10.3048 0.0887
NP_440115.1_6 Forward -317 -307 6.8632 0.167
NP_440007.1_9 Reverse -163 -177 8.45605 0.178
NP_439965.1_1 Forward -323 -304 -9.63698 0.292
NP_441680.1_4 Forward -180 -161 -1.18052 0.259
NP_441170.1_4 Reverse -124 -142 4.9357 0.228
NP_441170.1_4 Reverse -123 -141 4.24738 0.251
NP_441972.1_5 Reverse -84 -103 -7.17871 0.244
NP_441972.1_5 Reverse -306 -325 -8.35868 0.263
NP_441106.1_1 Reverse -304 -313 18.191 0.0028
NP_441106.1_1 Forward -107 -98 18.191 0.0028
NP_441106.1_1 Forward -315 -306 9.63616 0.0311
NP_441106.1_1 Reverse -96 -105 9.63616 0.0311
NP_440429.1_2 Reverse -98 -117 10.1275 0.267
NP_439903.1_6 Forward -197 -178 3.53858 0.209
NP_442588.1_6 Forward -60 -41 2.45773 0.23
NP_440302.1_4 Forward -181 -162 13.3725 0.283
NP_442306.1_10 Forward -319 -300 -19.9617 0.201
NP_440797.1_8 Forward -74 -55 14.3777 0.268
NP_441286.1_1 Reverse -96 -108 14.4936 0.00418
NP_441286.1_1 Forward -107 -95 11.8387 0.0114
NP_441286.1_1 Forward -315 -303 6.03717 0.0258
NP_441286.1_1 Reverse -304 -316 3.38223 0.0467
NP_440670.1_8 Forward -314 -305 18.3876 0.000699
NP_440670.1_8 Reverse -305 -314 18.3876 0.000699
NP_440670.1_8 Forward -106 -97 18.3876 0.000699
NP_440670.1_8 Reverse -97 -106 18.3876 0.000699
NP_441930.1_2 Reverse -82 -92 11.3864 0.294
NP_440886.1_7 Reverse -304 -314 17.7774 0.0011
NP_440886.1_7 Forward -107 -97 17.7774 0.0011
NP_440886.1_7 Forward -315 -305 7.94438 0.0805
NP_440886.1_7 Reverse -96 -106 7.94438 0.0805
NP_442614.1_2 Reverse -305 -319 14.9459 0.0852
NP_442614.1_2 Forward -106 -92 5.80112 0.297
NP_441399.1_9 Reverse -226 -245 19.5673 0.159
NP_442072.1_9 Forward -107 -89 -20.4337 0.204
NP_442072.1_9 Forward -315 -297 -23.3836 0.292
NP_441753.1_10 Forward -115 -96 2.85105 0.226
NP_440907.2_8 Forward -313 -303 7.94438 0.117
NP_440907.2_8 Reverse -98 -108 7.84605 0.117
NP_442264.1_2 Forward -192 -175 6.23369 0.265
NP_441021.1_8 Reverse -92 -110 12.4089 0.11
NP_440326.1_5 Forward -94 -81 18.9972 0.179
NP_441463.1_3 Forward -116 -97 2.0644 0.123
NP_441463.1_6 Reverse -95 -109 12.3106 0.224
NP_441463.1_6 Reverse -216 -230 7.09237 0.265
NP_441626.1_2 Forward -313 -306 15.7721 0.0124
NP_441626.1_2 Reverse -306 -313 15.7721 0.0124
NP_441626.1_2 Forward -105 -98 15.7721 0.0124
NP_441626.1_2 Reverse -98 -105 15.7721 0.0124
NP_442211.1_3 Reverse -167 -186 9.61179 0.257
NP_442912.1_4 Forward -210 -191 20.649 0.23
NP_442209.1_4 Forward -277 -258 6.58763 0.299
NP_442615.1_1 Reverse -296 -314 10.4422 0.0211
NP_442615.1_1 Reverse -88 -106 -5.19239 0.206
NP_440387.1_1 Forward -106 -90 -3.08806 0.155
NP_441431.1_2 Reverse -302 -316 8.25877 0.221
NP_441836.1_2 Forward -246 -227 -3.14714 0.234
NP_441993.1_1 Forward -106 -87 6.52718 0.179
NP_441993.1_1 Forward -320 -301 1.06957 0.285
NP_441993.1_4 Forward -314 -295 12.3883 0.244
NP_440814.1_8 Forward -339 -320 0.491109 0.269
NP_440114.1_10 Forward -314 -300 14.1593 0.0429
NP_440114.1_10 Reverse -97 -111 12.291 0.0866
NP_440114.1_10 Forward -106 -92 10.4227 0.148
NP_440114.1_10 Reverse -305 -319 9.83269 0.16
NP_441510.2_7 Reverse -91 -105 9.6354 0.281
NP_440287.1_5 Reverse -320 -339 6.98015 0.286
NP_440766.1_4 Reverse -93 -107 8.06273 0.0871
NP_441237.1_6 Forward -251 -234 6.52869 0.187
NP_442743.1_4 Forward -313 -294 -1.18052 0.191
NP_439910.1_2 Forward -114 -97 -2.81276 0.0305
NP_439910.1_2 Reverse -297 -314 -3.99273 0.0691
NP_439910.1_2 Reverse -89 -106 -12.1542 0.0788
NP_442867.1_8 Reverse -228 -247 4.916 0.277
NP_440457.1_1 Forward -110 -98 1.90727 0.223
NP_440457.1_1 Reverse -93 -105 0.0389777 0.25
NP_440457.1_1 Reverse -301 -313 -0.649339 0.271
NP_440457.1_1 Forward -318 -306 -0.74767 0.273
NP_440798.1_6 Reverse -98 -111 4.8375 0.143
NP_440142.1_7 Forward -338 -319 18.6823 0.059
NP_441984.1_3 Reverse -301 -319 8.96727 0.217
NP_440473.1_1 Reverse -32 -51 11.2574 0.28
NP_442509.1_9 Forward -314 -304 16.2041 0.00739
NP_442509.1_9 Reverse -97 -107 16.2041 0.00739
NP_442509.1_9 Reverse -305 -315 8.14104 0.192
NP_442509.1_9 Forward -106 -96 8.14104 0.192
NP_441253.1_1 Reverse -88 -107 6.39097 0.236
NP_442587.1_10 Forward -95 -76 18.1213 0.297
NP_442936.1_10 Forward -55 -41 8.30683 0.269
NP_442514.1_10 Forward -194 -175 5.89931 0.273
NP_441610.1_2 Forward -326 -307 7.37428 0.186
NP_440554.1_4 Forward -313 -303 16.4996 0.0189
NP_440554.1_4 Reverse -98 -108 14.6313 0.02
NP_440554.1_4 Reverse -306 -316 8.92815 0.0646
NP_440554.1_4 Forward -105 -95 7.05986 0.106
NP_441885.1_5 Reverse -305 -315 20.9245 0.000538
NP_441885.1_5 Forward -106 -96 20.9245 0.000538
NP_441885.1_5 Forward -314 -304 11.4848 0.00668
NP_441885.1_5 Reverse -97 -107 11.4848 0.00668
NP_440478.1_10 Reverse -303 -317 9.04604 0.257
NP_441428.1_8 Reverse -165 -184 14.0608 0.0995
NP_442341.1_7 Reverse -96 -110 9.63603 0.0726
NP_442341.1_7 Forward -107 -93 8.35772 0.0881
NP_442341.1_7 Reverse -304 -318 7.47274 0.105
NP_442341.1_7 Forward -315 -301 3.14618 0.234
NP_442341.1_9 Forward -108 -94 14.2569 0.0695
NP_442341.1_9 Reverse -303 -317 9.34041 0.155
NP_440409.1_1 Forward -322 -303 -1.37718 0.232
NP_440423.1_6 Forward -322 -303 -5.99873 0.138
NP_440423.1_6 Forward -244 -225 -21.0434 0.279
NP_440423.1_10 Forward -321 -302 11.4058 0.237
NP_443000.1_7 Forward -316 -306 19.9412 0.00223
NP_443000.1_7 Reverse -95 -105 17.0896 0.00865
NP_443000.1_7 Reverse -303 -313 11.5831 0.0344
NP_443000.1_7 Forward -108 -98 8.73149 0.0437
NP_440507.2_3 Forward -115 -96 7.96345 0.263
NP_442513.1_5 Reverse -89 -108 11.995 0.266
NP_441842.1_10 Forward -113 -99 6.98109 0.27
NP_440275.1_3 Reverse -303 -313 15.418 0.0178
NP_440275.1_3 Forward -316 -306 15.123 0.0182
NP_440275.1_3 Forward -108 -98 8.4365 0.0602
NP_440275.1_3 Reverse -95 -105 8.1415 0.0602
NP_440091.1_1 Reverse -93 -105 16.4603 0.0153
NP_440091.1_1 Forward -110 -98 15.8703 0.0161
NP_440091.1_1 Reverse -301 -313 10.7571 0.0429
NP_440091.1_1 Forward -318 -306 1.31728 0.198
NP_443060.1_5 Forward -322 -303 12.29 0.134
NP_442354.1_8 Reverse -323 -342 10.0292 0.266
NP_442354.1_8 Reverse -233 -252 6.58763 0.266
NP_442354.1_8 Reverse -278 -297 6.19431 0.266
NP_440679.1_10 Reverse -157 -176 -14.7502 0.245
NP_443010.1_10 Forward -109 -92 7.60248 0.167
NP_443010.1_10 Reverse -302 -319 3.54386 0.253
NP_442451.1_2 Forward -322 -303 0.0977854 0.153
NP_442451.1_2 Reverse -310 -329 -9.44032 0.259
NP_439962.1_4 Forward -244 -225 -7.37537 0.288
NP_440175.1_7 Reverse -169 -187 12.5836 0.215
NP_440149.1_8 Reverse -97 -116 -3.04881 0.18
NP_440149.1_8 Forward -106 -87 -6.39206 0.25
NP_441105.1_3 Forward -193 -174 -4.91709 0.209
NP_441105.1_3 Reverse -294 -313 -5.31042 0.216
NP_440216.1_1 Forward -314 -300 16.2242 0.00307
NP_440216.1_1 Reverse -305 -319 9.93102 0.00589
NP_440216.1_1 Forward -106 -92 7.9644 0.00737
NP_440216.1_1 Reverse -97 -111 6.6861 0.0139
NP_440216.1_9 Forward -129 -120 11.6028 0.254
NP_440216.1_9 Reverse -79 -88 7.37455 0.286
NP_440216.1_9 Forward -128 -119 5.80125 0.289
NP_440216.1_9 Forward -84 -75 5.3096 0.298
NP_440172.1_1 Reverse -305 -315 15.0247 0.00945
NP_440172.1_1 Forward -106 -96 15.0247 0.00945
NP_440172.1_1 Forward -314 -304 8.73149 0.0586
NP_440172.1_1 Reverse -97 -107 8.73149 0.0586
NP_440172.1_1 Reverse -83 -93 6.17489 0.11
NP_440172.1_1 Reverse -173 -183 2.04498 0.286
NP_440172.1_1 Reverse -179 -189 1.74999 0.299
NP_442371.1_1 Forward -145 -135 13.4509 0.206
NP_442015.1_10 Forward -110 -97 9.85238 0.0433
NP_442015.1_10 Reverse -301 -314 3.16588 0.185
NP_442015.1_10 Forward -318 -305 2.77255 0.187
NP_442015.1_10 Reverse -93 -106 0.60927 0.221
NP_441226.1_7 Forward -313 -306 14.4934 0.0123
NP_441226.1_7 Reverse -306 -313 14.4934 0.0123
NP_441226.1_7 Forward -105 -98 14.4934 0.0123
NP_441226.1_7 Reverse -98 -105 14.4934 0.0123
NP_441226.1_7 Reverse -228 -235 5.93863 0.266
NP_441111.1_7 Forward -313 -305 18.7023 0.00294
NP_441111.1_7 Forward -105 -97 18.7023 0.00294
NP_441111.1_7 Reverse -306 -314 18.7023 0.00294
NP_441111.1_7 Reverse -98 -106 18.7023 0.00294
NP_442379.1_10 Reverse -90 -107 5.9387 0.121
NP_441766.1_2 Forward -314 -305 17.5026 0.00297
NP_441766.1_2 Reverse -305 -314 17.5026 0.00297
NP_441766.1_2 Forward -106 -97 17.5026 0.00297
NP_441766.1_2 Reverse -97 -106 17.5026 0.00297
NP_441766.1_2 Reverse -227 -236 2.16301 0.262
NP_440416.1_9 Reverse -90 -109 -8.16202 0.111
NP_440416.1_9 Forward -189 -170 -14.7502 0.18
NP_440416.1_9 Forward -321 -302 -18.4868 0.259
NP_443052.1_8 Reverse -87 -106 0.786102 0.0636
NP_443052.1_8 Forward -116 -97 -9.83364 0.197
NP_443052.1_9 Forward -180 -161 -7.27704 0.295
NP_442552.1_1 Reverse -237 -256 1.96607 0.243
NP_442309.1_1 Forward -376 -360 17.5614 0.145
NP_442154.1_1 Reverse -153 -171 -17.8771 0.272
NP_440261.1_5 Reverse -306 -319 6.80412 0.0316
NP_440261.1_5 Forward -313 -300 -4.60227 0.158
NP_440261.1_5 Reverse -98 -111 -4.60227 0.158
NP_440261.1_5 Forward -105 -92 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGGAAATGATTACCAACAACGCTAATTTATGTCGCTTGGTGCTTGACCAGACCCTACAGCAGGTGAGGCAGAGGGAAGCTCTACTGGCGATCGCCGGTTATAAACGGGTGGACGAAAGACTCCAAGGCCTACTGAACTTACTAGGACAGGAATTGGGGCAACCAGGGACCGGGGGCATGCGTTTATCGGTGCGGCTCACCCATCAAATGTTAGCCAATGCCATTGGCACCACCAGGGTAACAGTCACCCGTCTGCTGGGGGAATTCCAAACCCAGGGAAAGGTCAGTTTAGACGGCGATCGCCATTTGGTCATTGCCTTGGGAAACTAGGTGTGAACCGGATTGGCAAGGTTTTTTTTGATAGCCTGGACTCAGTTGTTGTGCAGTTGAGGAAATAGTT

CDS

ATGGTCTGGGCAAACCTTGGGCACTGTTGTCGATGGCTTGGGGCTTTGACAGTAGCAACGACTTTGCTGGCCCCCATCCCATTAAAAGCTGGTAGTGCAACGGCGATCGCCTCTCCGCTAACTGGGTTACAAACATTACCATCCCAATTGTTACTAGCGGAAATTATTCGAGGTTGTCCCAGGGCGGAAGTGGTGGAAGCCTATGAAACCAAAACTTATCTAGCCTATATTTGCCAAACCTACGACGGACAAATTTTCTACCGGGGCGTTAATAAAAACAATGGCGACCAGATTAATGTGATGGATGTGCTAATCACCGACAGCGGCACCTACTACGCCACCAATGGAGCCTATACCTATTGGGTGGACCGGCAACAGTTACGGGTAACCAAGAATGGTAAAACTATTTTCTCTGAACCTGTTTTAAGGTAG

Protein

MVWANLGHCCRWLGALTVATTLLAPIPLKAGSATAIASPLTGLQTLPSQLLLAEIIRGCPRAEVVEAYETKTYLAYICQTYDGQIFYRGVNKNNGDQINVMDVLITDSGTYYATNGAYTYWVDRQQLRVTKNGKTIFSEPVLR