Your browser is old and dusty. Try Google Chrome!

Details for sll0594

ORF sll0594
Accession NP_442540.1
Symbol
Category transcriptional regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -205 -191 10.4227 0.28
NP_442272.1_1 Forward -160 -142 15.1852 0.237
NP_441453.1_4 Reverse -31 -39 6.80426 0.121
NP_441453.1_4 Forward -40 -32 6.11594 0.121
NP_441623.1_1 Reverse -90 -108 0.117479 0.228
NP_441960.1_5 Reverse -128 -147 26.9412 0.00435
NP_442151.1_6 Reverse -31 -45 9.93102 0.137
NP_441818.1_6 Reverse -24 -38 9.04604 0.274
NP_441818.1_9 Forward -259 -240 -6.78538 0.265
NP_441818.1_9 Forward -210 -191 -6.98204 0.268
NP_441818.1_9 Forward -126 -107 -9.63698 0.291
NP_440226.1_1 Forward -40 -21 11.1109 0.0569
NP_442173.1_1 Forward -39 -31 12.0158 0.0316
NP_442173.1_1 Reverse -32 -40 4.83764 0.241
NP_442173.1_3 Reverse -140 -150 16.2046 0.196
NP_442752.1_4 Reverse -31 -38 13.8055 0.0199
NP_440074.1_6 Reverse -164 -183 10.815 0.268
NP_440784.1_7 Reverse -32 -39 6.23397 0.241
NP_440784.1_7 Forward -39 -32 6.13563 0.241
NP_441250.1_3 Forward -228 -209 9.14423 0.197
NP_440110.1_8 Forward -126 -107 -3.54046 0.3
NP_441476.1_5 Reverse -191 -210 -1.47551 0.205
NP_440878.1_9 Forward -390 -371 -2.26216 0.258
NP_442062.1_3 Reverse -145 -164 3.44104 0.208
NP_441581.1_6 Reverse -343 -362 10.8438 0.283
NP_441492.1_1 Forward -73 -54 8.65258 0.263
NP_440370.1_10 Forward -49 -30 16.6174 0.0713
NP_442742.1_9 Forward -345 -326 -2.85214 0.204
NP_441082.1_10 Reverse -178 -191 13.294 0.236
NP_441925.1_4 Reverse -185 -204 -15.9309 0.275
NP_441083.1_5 Forward -40 -30 8.73149 0.0307
NP_441083.1_5 Reverse -31 -41 7.05986 0.067
NP_441083.1_5 Reverse -99 -109 4.60159 0.136
NP_441434.1_3 Reverse -95 -114 -1.96717 0.262
NP_441738.1_2 Forward -38 -31 15.28 0.0102
NP_440209.1_1 Reverse -31 -39 8.57422 0.0425
NP_440209.1_1 Forward -40 -32 5.52596 0.0821
NP_440447.1_6 Reverse -277 -295 0.412472 0.291
NP_440053.1_2 Forward -118 -99 15.9291 0.152
NP_442570.1_3 Forward -150 -131 -6.29373 0.257
NP_442570.1_3 Forward -161 -142 -8.06369 0.279
NP_439953.1_2 Reverse -330 -348 11.9172 0.266
NP_442111.1_3 Reverse -148 -161 13.3352 0.261
NP_442111.1_4 Forward -41 -27 10.816 0.0518
NP_441624.1_7 Reverse -271 -285 10.7177 0.217
NP_441163.1_1 Forward -264 -247 5.74131 0.27
NP_440906.1_5 Reverse -32 -39 6.23397 0.234
NP_440906.1_5 Forward -39 -32 6.13563 0.241
NP_440747.1_10 Reverse -28 -40 -2.32097 0.0331
NP_440747.1_10 Forward -145 -133 -12.4491 0.282
NP_441130.1_10 Forward -42 -28 5.80112 0.214
NP_441012.1_4 Reverse -110 -123 6.50913 0.278
NP_443018.1_3 Forward -39 -32 11.7405 0.0655
NP_443018.1_3 Reverse -32 -39 5.44732 0.193
NP_441316.1_7 Forward -42 -27 8.33803 0.101
NP_441634.1_8 Forward -213 -199 -3.63866 0.295
NP_440376.1_1 Reverse -31 -40 5.99792 0.111
NP_440376.1_1 Forward -40 -31 -0.196935 0.285
NP_442687.1_7 Forward -41 -31 5.97822 0.179
NP_442687.1_7 Reverse -370 -380 4.20827 0.262
NP_441846.1_10 Forward -142 -123 -20.7484 0.256
NP_441846.1_10 Forward -109 -90 -22.715 0.264
NP_442296.1_9 Reverse -190 -209 -0.787193 0.197
NP_442658.1_1 Forward -287 -277 9.81266 0.145
NP_442544.1_6 Reverse -24 -43 -6.78538 0.298
NP_441414.1_9 Reverse -31 -50 -4.42544 0.153
NP_442937.1_5 Reverse -221 -240 10.2259 0.168
NP_442321.1_1 Forward -382 -363 -6.29373 0.238
NP_441958.1_5 Reverse -30 -40 9.81313 0.0174
NP_441958.1_5 Forward -41 -31 0.865012 0.12
NP_441127.1_1 Reverse -150 -164 8.45605 0.295
NP_442911.1_2 Forward -356 -337 -6.68705 0.19
NP_442002.1_1 Forward -142 -124 -7.749 0.254
NP_441646.1_1 Reverse -219 -238 -0.590531 0.269
NP_442431.1_7 Reverse -315 -334 9.24257 0.231
NP_441000.1_6 Forward -41 -27 -3.73699 0.225
NP_440147.1_3 Forward -225 -206 3.24438 0.268
NP_440147.1_4 Reverse -29 -42 -0.570702 0.291
NP_441550.1_8 Reverse -29 -39 14.5325 0.0141
NP_441550.1_8 Forward -42 -32 10.796 0.0625
NP_441916.1_7 Forward -40 -30 1.06167 0.294
NP_440465.1_10 Reverse -96 -115 -0.39387 0.29
NP_441041.1_7 Reverse -28 -40 8.77809 0.131
NP_441041.1_7 Reverse -130 -142 4.98816 0.282
NP_441725.1_4 Reverse -26 -40 4.91554 0.278
NP_441725.1_5 Reverse -32 -42 9.32148 0.0553
NP_439966.1_7 Forward -42 -32 8.82935 0.13
NP_439966.1_7 Reverse -29 -39 4.60114 0.265
NP_439966.1_9 Forward -33 -24 4.42462 0.253
NP_442941.1_3 Forward -39 -29 9.41981 0.0319
NP_440289.1_2 Forward -43 -30 5.62415 0.0623
NP_440289.1_2 Reverse -28 -41 -4.9956 0.294
NP_440983.1_5 Reverse -102 -121 5.40766 0.179
NP_440260.1_8 Forward -207 -189 -5.97904 0.282
NP_442281.1_1 Forward -45 -31 9.6354 0.0684
NP_442847.1_4 Reverse -270 -289 11.1109 0.247
NP_440647.1_9 Reverse -369 -387 4.83737 0.23
NP_441087.1_6 Forward -352 -334 0.411736 0.258
NP_441644.1_6 Forward -40 -30 16.1058 0.0048
NP_441644.1_6 Forward -351 -341 7.64939 0.121
NP_443049.1_6 Reverse -30 -40 12.3241 0.24
NP_440929.1_8 Forward -40 -31 7.07956 0.0713
NP_440780.1_1 Reverse -6 -25 7.30471 0.276
NP_441751.2_8 Forward -39 -25 4.12949 0.0534
NP_442554.1_8 Forward -39 -29 7.45319 0.092
NP_442554.1_8 Reverse -32 -42 2.92996 0.249
NP_442075.1_10 Reverse -31 -50 13.9625 0.282
NP_442313.1_8 Reverse -293 -312 8.65258 0.292
NP_442142.1_4 Forward -43 -30 8.57349 0.112
NP_442292.1_1 Forward -39 -30 7.66954 0.0634
NP_443009.1_5 Forward -257 -246 11.2679 0.066
NP_443009.1_5 Reverse -336 -347 4.97473 0.222
NP_441715.1_4 Forward -39 -29 6.96153 0.121
NP_440357.1_3 Forward -348 -329 1.17943 0.275
NP_440357.1_7 Forward -351 -332 17.5024 0.0811
NP_440183.1_9 Reverse -194 -213 -16.3235 0.276
NP_441198.1_8 Reverse -335 -345 12.2947 0.144
NP_441468.1_1 Reverse -32 -39 6.13563 0.209
NP_441468.1_1 Forward -39 -32 6.0373 0.223
NP_439939.1_4 Forward -163 -144 2.94938 0.199
NP_441673.1_1 Reverse -31 -40 1.37636 0.114
NP_441673.1_1 Forward -40 -31 1.1797 0.163
NP_441731.1_3 Reverse -23 -42 -3.14714 0.284
NP_441826.1_2 Forward -46 -32 1.37622 0.154
NP_441826.1_5 Forward -357 -338 3.6377 0.261
NP_441764.1_8 Reverse -148 -158 12.842 0.284
NP_442868.1_6 Reverse -335 -345 0.865012 0.205
NP_442868.1_6 Reverse -29 -39 0.668351 0.213
NP_442719.1_2 Reverse -124 -142 4.73828 0.148
NP_442808.1_1 Forward -41 -31 9.71433 0.0481
NP_442808.1_1 Reverse -107 -117 4.20782 0.203
NP_441101.1_5 Forward -127 -109 16.7948 0.237
NP_442775.1_6 Forward -97 -78 16.3224 0.236
NP_442542.1_2 Reverse -29 -42 7.49244 0.179
NP_442050.1_5 Forward -42 -32 12.6642 0.0534
NP_440334.1_2 Reverse -145 -158 13.884 0.287
NP_441114.1_3 Reverse -71 -80 7.37455 0.239
NP_441114.1_3 Reverse -134 -143 7.27622 0.247
NP_441114.1_3 Reverse -49 -58 6.39124 0.277
NP_440558.1_2 Reverse -333 -352 4.71934 0.149
NP_440558.1_2 Forward -349 -330 3.6377 0.154
NP_440162.1_2 Forward -208 -189 6.58763 0.282
NP_441048.1_6 Reverse -300 -314 15.2903 0.296
NP_441878.1_6 Forward -41 -31 0.57002 0.14
NP_441557.1_5 Reverse -31 -40 1.08137 0.0794
NP_441557.1_5 Forward -40 -31 0.589713 0.134
NP_441557.1_8 Reverse -125 -135 12.3692 0.236
NP_442830.1_5 Reverse -131 -145 0.785655 0.291
NP_442183.1_1 Reverse -31 -45 8.25939 0.119
NP_440676.1_3 Forward -37 -18 6.98095 0.278
NP_440932.1_5 Reverse -97 -116 10.5209 0.162
NP_440136.1_2 Reverse -32 -39 6.23397 0.171
NP_440136.1_2 Forward -39 -32 6.13563 0.193
NP_442998.1_5 Reverse -96 -106 12.1731 0.176
NP_442998.1_10 Forward -38 -31 15.5754 0.0102
NP_441799.1_1 Forward -44 -30 7.27547 0.147
NP_441007.1_10 Forward -213 -200 3.06754 0.183
NP_441007.1_10 Reverse -26 -39 1.10092 0.209
NP_441007.1_10 Forward -45 -32 -0.865694 0.295
NP_440256.1_1 Reverse -28 -47 -6.98204 0.225
NP_440087.1_1 Reverse -22 -41 -7.57203 0.276
NP_441118.1_2 Forward -140 -121 13.6675 0.12
NP_441559.1_8 Reverse -128 -142 4.42448 0.119
NP_441559.1_8 Reverse -139 -153 -1.47537 0.183
NP_441559.1_8 Reverse -129 -143 -2.65535 0.192
NP_441559.1_8 Forward -350 -336 -6.29359 0.276
NP_441559.1_8 Forward -147 -133 -7.47356 0.294
NP_440915.1_6 Reverse -27 -41 7.17775 0.074
NP_442158.1_4 Reverse -328 -338 11.0914 0.282
NP_441866.1_3 Forward -280 -267 11.9173 0.236
NP_442866.1_1 Reverse -26 -45 -1.96717 0.205
NP_441417.1_2 Forward -354 -335 15.1424 0.0174
NP_442386.1_9 Reverse -6 -15 8.84908 0.182
NP_442386.1_9 Forward -41 -32 4.52254 0.297
NP_440570.1_5 Forward -191 -172 1.0811 0.247
NP_441340.1_5 Reverse -32 -39 13.5105 0.0314
NP_441340.1_5 Forward -39 -32 5.84064 0.208
NP_442791.1_5 Reverse -278 -297 -8.45701 0.279
NP_440168.1_9 Reverse -88 -107 0.0977854 0.273
NP_440168.1_9 Forward -42 -23 -5.31042 0.296
NP_440161.1_3 Forward -42 -23 8.16093 0.276
NP_440586.1_1 Forward -212 -193 -0.590531 0.237
NP_440586.1_1 Forward -355 -336 -4.91709 0.278
NP_440586.1_8 Forward -39 -32 9.47853 0.146
NP_440586.1_8 Reverse -32 -39 5.74197 0.283
NP_441262.1_3 Reverse -31 -38 14.7888 0.0223
NP_440027.1_3 Reverse -336 -354 3.36165 0.273
NP_443051.1_1 Reverse -30 -39 16.6177 0.00754
NP_443051.1_1 Forward -41 -32 -1.18024 0.297
NP_439937.1_9 Forward -347 -330 1.31644 0.0948
NP_439937.1_9 Reverse -98 -115 0.431468 0.0979
NP_439937.1_9 Reverse -96 -113 -8.61494 0.176
NP_439937.1_9 Forward -348 -331 -9.89323 0.215
NP_439937.1_9 Reverse -97 -114 -17.3663 0.298
NP_441740.2_3 Reverse -223 -242 11.6017 0.27
NP_441740.2_3 Reverse -330 -349 11.5033 0.27
NP_440439.1_1 Reverse -28 -41 9.65572 0.0447
NP_440372.1_2 Reverse -32 -39 13.8055 0.0214
NP_440372.1_2 Forward -39 -32 6.52896 0.188
NP_440770.1_3 Forward -175 -161 17.3058 0.139
NP_440316.1_10 Reverse -30 -40 12.4681 0.214
NP_442887.1_5 Reverse -212 -231 -13.9635 0.293
NP_442384.1_10 Forward -40 -27 4.93583 0.142
NP_441604.1_4 Reverse -363 -382 -7.08038 0.293
NP_442790.1_4 Reverse -22 -41 -4.03212 0.13
NP_442262.1_10 Forward -39 -32 13.2155 0.0213
NP_441689.1_5 Reverse -29 -39 5.78111 0.197
NP_440531.1_1 Reverse -337 -356 3.73603 0.247
NP_440189.1_2 Reverse -116 -135 -0.590531 0.289
NP_441335.1_8 Forward -220 -201 10.5209 0.204
NP_441965.1_10 Forward -43 -27 6.35172 0.179
NP_440297.1_9 Reverse -32 -42 0.865012 0.282
NP_442187.1_3 Reverse -30 -40 13.4514 0.245
NP_440894.1_10 Reverse -36 -55 7.07928 0.209
NP_443036.1_3 Forward -261 -244 16.2635 0.188
NP_442078.1_3 Reverse -287 -306 -1.08295 0.274
NP_440999.1_9 Reverse -345 -359 -2.85201 0.279
NP_440888.1_2 Reverse -124 -138 7.86545 0.179
NP_440888.1_2 Reverse -307 -321 5.89884 0.258
NP_440888.1_2 Forward -40 -26 5.70218 0.267
NP_440803.1_3 Forward -221 -202 4.71934 0.259
NP_442147.1_6 Forward -42 -28 15.7319 0.232
NP_440491.1_1 Reverse -80 -99 7.59921 0.263
NP_442277.1_7 Reverse -153 -169 -1.52107 0.278
NP_442033.1_10 Reverse -131 -150 -3.54046 0.171
NP_441949.1_4 Forward -353 -334 12.3892 0.174
NP_441543.1_2 Forward -39 -30 6.09625 0.153
NP_441551.1_5 Forward -44 -28 7.13767 0.249
NP_441223.1_5 Reverse -147 -161 17.0077 0.162
NP_442578.1_7 Reverse -32 -39 6.0373 0.18
NP_441462.1_2 Reverse -31 -41 16.1063 0.00406
NP_441462.1_2 Forward -40 -30 0.57002 0.144
NP_440519.1_8 Reverse -322 -338 12.4482 0.177
NP_442204.1_1 Reverse -27 -38 11.2684 0.0565
NP_442204.1_1 Reverse -140 -151 1.23864 0.277
NP_440255.1_7 Forward -266 -249 9.28195 0.277
NP_440516.1_2 Reverse -280 -298 -2.3408 0.299
NP_440516.1_8 Reverse -31 -40 18.9776 0.00442
NP_440516.1_8 Forward -40 -31 5.01461 0.118
NP_440516.1_8 Forward -108 -99 -0.590259 0.283
NP_442428.1_5 Reverse -32 -39 6.13563 0.209
NP_442428.1_5 Forward -39 -32 6.0373 0.212
NP_441443.1_10 Reverse -71 -89 -0.178247 0.293
NP_440673.1_3 Forward -38 -31 12.4288 0.0426
NP_441714.1_3 Reverse -63 -81 13.3914 0.243
NP_441052.1_2 Forward -40 -30 1.16001 0.25
NP_441052.1_2 Reverse -133 -143 -0.41329 0.277
NP_441884.1_9 Forward -111 -92 -22.8133 0.284
NP_441719.1_4 Reverse -32 -39 6.82395 0.0855
NP_441719.1_4 Forward -39 -32 6.52896 0.188
NP_441733.1_10 Reverse -28 -41 4.73917 0.244
NP_441004.1_1 Forward -223 -204 -10.0303 0.218
NP_441004.1_1 Forward -363 -344 -12.8819 0.251
NP_441004.1_1 Forward -126 -107 -14.6519 0.269
NP_441004.1_1 Forward -294 -275 -16.1268 0.283
NP_441004.1_1 Forward -33 -14 -18.0934 0.297
NP_441004.1_4 Forward -101 -91 17.188 0.152
NP_441004.1_5 Forward -102 -88 8.35772 0.274
NP_442694.1_9 Forward -58 -39 11.7008 0.207
NP_442206.1_1 Reverse -247 -266 -4.6221 0.19
NP_442206.1_1 Forward -346 -327 -13.6686 0.257
NP_442206.1_10 Forward -40 -25 10.3046 0.132
NP_440328.1_4 Forward -46 -27 0.392778 0.252
NP_442312.1_1 Reverse -257 -276 11.4058 0.275
NP_441683.1_7 Forward -143 -124 -8.45701 0.284
NP_441982.1_6 Forward -320 -311 11.3395 0.288
NP_442709.1_3 Forward -47 -28 8.35759 0.121
NP_441409.1_6 Forward -46 -27 -12.6852 0.23
NP_440432.1_9 Forward -39 -24 -4.93665 0.228
NP_442843.1_1 Reverse -318 -337 -7.57203 0.249
NP_442450.1_5 Forward -42 -32 10.0098 0.115
NP_442335.1_7 Forward -39 -25 17.3052 0.146
NP_441570.1_1 Reverse -31 -49 -17.3854 0.273
NP_441078.1_4 Reverse -31 -40 0.196389 0.205
NP_441078.1_4 Forward -40 -31 -0.000272808 0.205
NP_442729.1_7 Forward -112 -94 5.82068 0.286
NP_441663.1_8 Reverse -25 -44 4.62101 0.163
NP_442348.1_2 Reverse -247 -256 11.0128 0.247
NP_442348.1_2 Forward -310 -301 6.5879 0.299
NP_442443.1_1 Forward -353 -334 4.42435 0.157
NP_442443.1_1 Forward -209 -190 1.27776 0.206
NP_442443.1_1 Forward -114 -95 -2.26216 0.254
NP_442443.1_1 Reverse -240 -259 -4.42544 0.272
NP_440526.1_3 Reverse -338 -349 4.8764 0.264
NP_441432.1_8 Reverse -30 -39 14.0611 0.0258
NP_441432.1_8 Reverse -225 -234 5.50626 0.151
NP_441432.1_8 Forward -295 -286 3.24465 0.252
NP_441333.1_1 Forward -163 -153 11.9712 0.241
NP_442540.1_1 Forward -161 -143 21.335 0.138
NP_442540.1_6 Forward -47 -28 22.3206 0.0561
NP_442540.1_10 Forward -399 -385 18.1908 0.296
NP_440629.1_6 Reverse -25 -44 14.2621 0.183
NP_441805.1_1 Reverse -139 -158 -5.50708 0.286
NP_440913.1_1 Reverse -29 -47 11.2289 0.168
NP_442727.1_9 Reverse -9 -28 16.5191 0.191
NP_443011.1_4 Forward -389 -370 5.80098 0.298
NP_442489.1_7 Forward -40 -31 0.688044 0.152
NP_442489.1_7 Reverse -31 -40 0.688044 0.152
NP_441830.1_2 Forward -141 -122 -5.21209 0.281
NP_440559.1_1 Reverse -32 -41 6.39124 0.134
NP_441659.2_8 Forward -40 -30 8.23984 0.0462
NP_441659.2_8 Reverse -31 -41 0.275027 0.27
NP_441092.1_6 Forward -210 -191 8.06259 0.233
NP_442913.1_10 Forward -49 -30 -4.81876 0.248
NP_441040.1_2 Forward -353 -334 -5.99873 0.181
NP_441040.1_2 Reverse -268 -287 -14.8485 0.286
NP_439956.1_7 Forward -138 -119 0.982764 0.292
NP_442346.1_5 Forward -41 -31 4.3066 0.291
NP_440545.1_3 Reverse -333 -350 -2.12444 0.179
NP_440545.1_3 Forward -350 -333 -4.28772 0.223
NP_440025.1_3 Reverse -129 -143 11.4821 0.29
NP_440025.1_3 Forward -260 -246 9.64265 0.294
NP_440831.1_3 Reverse -187 -206 5.7076 0.28
NP_440459.1_2 Reverse -29 -46 8.39697 0.264
NP_442551.1_4 Forward -348 -333 -0.708419 0.245
NP_442551.1_4 Reverse -334 -349 -2.97003 0.278
NP_442551.1_4 Reverse -67 -82 -3.16669 0.287
NP_442311.1_5 Forward -145 -126 -0.197208 0.285
NP_442603.1_7 Reverse -31 -45 9.93039 0.137
NP_442603.1_7 Forward -108 -94 6.68548 0.232
NP_441585.1_5 Reverse -91 -110 0.686995 0.291
NP_441833.1_4 Forward -39 -32 6.52896 0.0924
NP_441833.1_4 Reverse -32 -39 6.23397 0.163
NP_441895.1_10 Forward -146 -127 -27.5332 0.282
NP_442162.1_9 Forward -39 -32 12.9205 0.0282
NP_442162.1_9 Reverse -32 -39 12.9205 0.0282
NP_442404.1_9 Reverse -102 -116 12.192 0.263
NP_442404.1_9 Forward -343 -329 10.6187 0.263
NP_442404.1_9 Forward -235 -221 7.96378 0.296
NP_443026.1_5 Reverse -317 -336 -6.1954 0.298
NP_441609.1_1 Forward -117 -98 7.7676 0.152
NP_442778.1_4 Forward -333 -314 15.9291 0.139
NP_440875.1_9 Forward -38 -28 16.5483 0.0145
NP_442547.1_5 Forward -65 -46 18.7025 0.193
NP_441813.1_5 Forward -42 -32 12.9597 0.0182
NP_441813.1_5 Reverse -29 -39 8.4365 0.0432
NP_441813.1_7 Reverse -108 -122 8.3571 0.285
NP_441227.1_5 Forward -119 -100 15.0441 0.207
NP_439901.1_1 Forward -64 -45 4.62101 0.235
NP_442497.1_10 Forward -39 -30 7.76787 0.0731
NP_442497.1_10 Reverse -32 -41 1.08137 0.115
NP_440821.1_4 Forward -42 -32 7.64985 0.0679
NP_441239.1_9 Forward -42 -30 10.1671 0.0861
NP_442044.1_1 Forward -351 -332 5.11266 0.131
NP_442270.1_9 Reverse -221 -240 -8.45701 0.219
NP_442643.1_1 Forward -211 -192 -12.8819 0.289
NP_441017.1_6 Reverse -135 -149 11.897 0.24
NP_442482.1_2 Forward -152 -133 11.7008 0.296
NP_440876.1_5 Forward -157 -138 6.09597 0.283
NP_440546.1_4 Reverse -31 -41 14.9908 0.0459
NP_440546.1_4 Forward -40 -30 8.20381 0.199
NP_441656.1_6 Reverse -83 -102 8.45592 0.226
NP_440462.1_6 Reverse -29 -39 9.22315 0.049
NP_440462.1_6 Forward -42 -32 3.91327 0.224
NP_440868.1_4 Reverse -27 -39 14.4936 0.0176
NP_442402.1_10 Reverse -102 -112 10.206 0.299
NP_441848.1_4 Reverse -158 -174 9.65149 0.275
NP_440696.1_6 Forward -110 -91 3.93269 0.288
NP_442039.1_4 Reverse -32 -39 11.6422 0.0747
NP_442039.1_10 Forward -341 -323 17.8162 0.209
NP_442837.1_3 Forward -39 -32 6.0373 0.25
NP_442837.1_3 Reverse -32 -39 6.0373 0.25
NP_440160.1_2 Reverse -96 -115 1.47442 0.217
NP_440160.1_2 Reverse -336 -355 0.58944 0.228
NP_440160.1_2 Forward -111 -92 -9.24366 0.293
NP_442053.1_1 Forward -40 -31 14.4544 0.0114
NP_442053.1_1 Reverse -31 -40 7.86621 0.0863
NP_440505.1_3 Reverse -29 -39 15.6147 0.0106
NP_440505.1_3 Forward -144 -134 12.8614 0.0427
NP_440505.1_3 Reverse -245 -255 7.05986 0.165
NP_442360.1_5 Forward -116 -106 14.6313 0.201
NP_440914.1_1 Forward -40 -30 11.8356 0.0767
NP_441011.1_8 Reverse -32 -41 9.24284 0.131
NP_441011.1_8 Forward -39 -30 6.78456 0.184
NP_442533.1_6 Forward -40 -31 4.42462 0.179
NP_442232.1_9 Reverse -292 -311 11.11 0.3
NP_442322.1_4 Reverse -116 -133 -9.30325 0.29
NP_441482.1_7 Reverse -25 -39 4.42448 0.0493
NP_441482.1_7 Forward -46 -32 -11.0135 0.229
NP_442269.1_10 Forward -128 -109 7.37428 0.194
NP_442269.1_10 Forward -91 -72 5.40766 0.238
NP_442202.1_10 Forward -41 -27 3.34284 0.278
NP_440116.1_8 Reverse -32 -51 -3.04881 0.145
NP_440115.1_6 Reverse -28 -38 14.0414 0.0615
NP_440115.1_6 Reverse -334 -344 4.89658 0.28
NP_440007.1_9 Reverse -27 -41 4.12949 0.267
NP_441680.1_2 Reverse -236 -251 15.5162 0.278
NP_441972.1_3 Forward -144 -125 11.6025 0.284
NP_441972.1_5 Forward -105 -86 -8.65367 0.27
NP_441106.1_1 Reverse -30 -39 8.75118 0.0469
NP_441286.1_1 Reverse -30 -42 4.07055 0.0373
NP_440670.1_8 Reverse -31 -40 8.75118 0.0606
NP_440670.1_8 Forward -40 -31 6.19458 0.124
NP_441930.1_2 Forward -142 -132 14.6313 0.203
NP_440886.1_7 Forward -41 -31 6.76441 0.114
NP_442614.1_2 Reverse -31 -45 17.1092 0.061
NP_442717.1_2 Reverse -319 -338 -1.57384 0.217
NP_440767.1_2 Forward -274 -255 -3.44213 0.272
NP_442072.1_9 Reverse -30 -48 -23.187 0.284
NP_442213.1_6 Forward -150 -131 8.55425 0.246
NP_440907.2_8 Forward -39 -29 7.84605 0.117
NP_441463.1_6 Reverse -245 -259 7.96207 0.25
NP_441626.1_2 Reverse -32 -39 12.2322 0.0511
NP_441626.1_2 Forward -39 -32 5.93897 0.231
NP_441174.1_1 Forward -141 -126 11.9763 0.247
NP_440114.1_10 Reverse -31 -45 14.8476 0.0344
NP_442437.1_9 Reverse -96 -110 18.2892 0.268
NP_440293.1_3 Forward -354 -335 0.687771 0.214
NP_441237.1_9 Forward -345 -335 11.7798 0.156
NP_440457.1_1 Reverse -27 -39 2.89058 0.205
NP_442940.1_2 Reverse -99 -118 -1.27885 0.298
NP_440801.1_9 Forward -155 -141 12.0596 0.294
NP_442509.1_9 Reverse -31 -41 13.1559 0.061
NP_442509.1_9 Reverse -195 -205 6.66608 0.259
NP_440554.1_4 Forward -39 -29 15.0247 0.02
NP_441885.1_5 Reverse -31 -41 -0.0199663 0.186
NP_442341.1_9 Reverse -29 -43 21.1401 0.0056
NP_442341.1_9 Reverse -199 -213 4.8172 0.291
NP_442395.2_4 Forward -206 -187 2.45694 0.223
NP_443000.1_7 Reverse -29 -39 10.5998 0.0345
NP_440507.2_3 Forward -355 -336 8.35677 0.253
NP_441842.1_1 Forward -344 -331 12.0151 0.23
NP_440275.1_3 Reverse -29 -39 13.5497 0.0268
NP_441190.1_1 Forward -187 -168 5.11266 0.241
NP_439951.1_3 Forward -122 -105 11.5436 0.242
NP_439962.1_4 Reverse -188 -207 10.7175 0.134
NP_442495.1_5 Reverse -185 -204 5.80098 0.291
NP_440216.1_1 Forward -40 -26 -4.81863 0.115
NP_440216.1_1 Reverse -31 -45 -11.2101 0.169
NP_440172.1_1 Reverse -31 -41 7.55152 0.0761
NP_440172.1_1 Forward -40 -30 4.79825 0.166
NP_441226.1_7 Reverse -32 -39 12.7234 0.0312
NP_441226.1_7 Forward -39 -32 11.5435 0.0757
NP_442446.1_7 Reverse -199 -218 6.29264 0.294
NP_441111.1_7 Forward -39 -31 8.86921 0.0589
NP_441766.1_2 Forward -40 -31 14.7494 0.00772
NP_441766.1_2 Reverse -99 -108 1.1797 0.299
NP_441766.1_9 Reverse -23 -42 -3.14714 0.296
NP_442417.1_5 Forward -40 -26 5.60446 0.255
NP_440416.1_9 Reverse -116 -135 -17.6018 0.243
NP_443052.1_8 Forward -50 -31 -11.5053 0.231
NP_442154.1_1 Forward -207 -189 -18.1721 0.278
NP_442154.1_1 Forward -219 -201 -18.3687 0.281
NP_442046.1_8 Reverse -190 -209 11.0125 0.293
NP_440261.1_5 Forward -39 -26 -3.12731 0.115
NP_440261.1_5 Forward -345 -332 -4.89726 0.178
NP_440261.1_5 Reverse -100 -113 -5.29059 0.19
NP_440261.1_5 Reverse -32 -45 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCAGGAAATCTTGCTTTGAAGCTACTACCCAGAGGTGGTTTGTACGTTGCCGGTGGTATTGCCCCCAAAATTATCCCTTTACTGGAAAAGGGCAGTTTTATGCAAGGCTTTAGCGACAAAGGCAGGATGCAAAGCTTAATGGGGACAATTCCCGTACAGGTGGTACTCAACGCCAAAGTTGGCCTAATTGGCGCGGCGGTTTGTGCGGCCCAGTCTTAGGAAGTGGACATTTTTAGTTGTTAACTTTGCCTTTACCTGGGAATTGCGGGGAAGGGTTATGCTGACTTTGGGGGAGATCTGGCCCAATGGGAGTCATGCTTGGGTAATGCAAACAAGATGCTTGACCAATGGGAACTAAGCCCGATCGCCTGGATTGATTTTTGAGGGTTGCCTGATTTT

CDS

ATGTTTGTGAACAGTTCCCCGATCGCCGATGGTTTAAGTGCCTTAGTAGGCTTAGACTCCCAGCCCCTCCAATTCTATGAAAGGGGTGACGTTGTTCCGCCCAAAGACCAGGGGTGTTGGCAAATTTACCGGGGGATTTTACAGGTCAGTCAATGGACCTTGGGAGGCGATGAGGTGCTGATGGGTTGGGCCCAACCCGGTAGTTTTGTGGGCTTAGATTTTAGTGCCCATCAACGGGAAACCTACCAAATTCGAGCTTTGACGGATGTATATCTGCGGGGTTATTCCCTGGAAATGATTACCAACAACGCTAATTTATGTCGCTTGGTGCTTGACCAGACCCTACAGCAGGTGAGGCAGAGGGAAGCTCTACTGGCGATCGCCGGTTATAAACGGGTGGACGAAAGACTCCAAGGCCTACTGAACTTACTAGGACAGGAATTGGGGCAACCAGGGACCGGGGGCATGCGTTTATCGGTGCGGCTCACCCATCAAATGTTAGCCAATGCCATTGGCACCACCAGGGTAACAGTCACCCGTCTGCTGGGGGAATTCCAAACCCAGGGAAAGGTCAGTTTAGACGGCGATCGCCATTTGGTCATTGCCTTGGGAAACTAG

Protein

MFVNSSPIADGLSALVGLDSQPLQFYERGDVVPPKDQGCWQIYRGILQVSQWTLGGDEVLMGWAQPGSFVGLDFSAHQRETYQIRALTDVYLRGYSLEMITNNANLCRLVLDQTLQQVRQREALLAIAGYKRVDERLQGLLNLLGQELGQPGTGGMRLSVRLTHQMLANAIGTTRVTVTRLLGEFQTQGKVSLDGDRHLVIALGN