Your browser is old and dusty. Try Google Chrome!

Details for sll0554

ORF sll0554
Accession NP_442409.1
Symbol ftrC
Category Thioredoxin, glutaredoxin, and glutathione
Definition ferredoxin-thioredoxin reductase, catalytic chain
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -121 -140 -2.45882 0.289
NP_441418.1_6 Reverse -206 -225 -28.4182 0.205
NP_440815.1_5 Reverse -364 -383 3.04771 0.289
NP_442291.1_5 Forward -216 -200 1.73016 0.14
NP_440897.1_6 Reverse -206 -225 0.490334 0.18
NP_441453.1_4 Reverse -206 -214 14.8674 0.00947
NP_441453.1_4 Forward -215 -207 6.80426 0.121
NP_441623.1_1 Reverse -29 -47 8.57394 0.108
NP_441818.1_9 Reverse -335 -354 -2.45882 0.203
NP_440348.1_6 Forward -292 -273 4.52268 0.251
NP_442173.1_1 Forward -214 -206 13.8841 0.0225
NP_442173.1_1 Reverse -207 -215 12.0158 0.0316
NP_442752.1_4 Forward -215 -208 13.8055 0.0199
NP_442752.1_4 Forward -307 -300 5.44732 0.202
NP_443027.1_4 Reverse -362 -372 6.07655 0.294
NP_442975.1_10 Forward -258 -244 8.94708 0.0821
NP_440784.1_7 Forward -214 -207 6.23397 0.241
NP_440784.1_7 Reverse -207 -214 6.13563 0.241
NP_441250.1_3 Reverse -36 -55 4.03102 0.252
NP_441476.1_5 Reverse -177 -196 1.27776 0.189
NP_442062.1_8 Forward -215 -205 7.94484 0.0848
NP_442062.1_8 Reverse -206 -216 7.15819 0.107
NP_442062.1_8 Forward -307 -297 5.97822 0.143
NP_442062.1_8 Reverse -364 -374 5.48657 0.168
NP_441859.1_3 Forward -39 -20 3.9319 0.23
NP_441859.1_3 Forward -195 -176 1.17865 0.293
NP_441802.1_1 Reverse -269 -288 10.4225 0.197
NP_441802.1_1 Forward -120 -101 6.39097 0.269
NP_440304.1_4 Forward -309 -299 5.97822 0.185
NP_441781.1_7 Reverse -229 -248 0.392778 0.246
NP_441200.1_4 Forward -122 -103 10.3242 0.201
NP_441925.1_4 Forward -359 -340 -16.5208 0.284
NP_441083.1_5 Forward -215 -205 6.96153 0.0717
NP_441083.1_5 Reverse -298 -308 4.99491 0.126
NP_441083.1_5 Reverse -358 -368 2.63497 0.193
NP_441083.1_5 Reverse -206 -216 0.865012 0.218
NP_442827.1_8 Forward -223 -204 -1.67294 0.253
NP_441434.1_7 Reverse -208 -222 3.44117 0.242
NP_441738.1_2 Reverse -208 -215 15.28 0.0102
NP_441738.1_2 Reverse -300 -307 9.77352 0.143
NP_441558.1_5 Reverse -204 -223 15.1424 0.0438
NP_440209.1_1 Forward -215 -207 8.57422 0.0425
NP_442570.1_3 Forward -301 -282 -9.14533 0.296
NP_442570.1_8 Reverse -167 -185 11.9172 0.218
NP_441327.1_1 Reverse -154 -173 6.90443 0.245
NP_441327.1_5 Reverse -218 -227 13.9627 0.261
NP_442111.1_4 Reverse -205 -219 16.2242 0.0166
NP_442111.1_4 Reverse -134 -148 2.06454 0.291
NP_440906.1_5 Forward -214 -207 6.23397 0.234
NP_440906.1_5 Reverse -207 -214 6.13563 0.241
NP_440747.1_10 Forward -362 -350 -12.0557 0.199
NP_440747.1_10 Reverse -242 -254 -12.0557 0.199
NP_440747.1_10 Reverse -203 -215 -12.1541 0.227
NP_440747.1_10 Forward -218 -206 -12.3507 0.27
NP_441486.1_1 Reverse -361 -375 1.08123 0.119
NP_442330.1_4 Forward -119 -100 12.7991 0.286
NP_442848.1_4 Forward -88 -74 7.57108 0.282
NP_443018.1_3 Reverse -207 -214 11.7405 0.0655
NP_443018.1_3 Forward -214 -207 5.44732 0.193
NP_440376.1_1 Reverse -135 -144 5.99792 0.111
NP_440376.1_1 Forward -215 -206 5.89959 0.116
NP_440376.1_1 Forward -359 -350 5.80125 0.119
NP_440376.1_1 Reverse -245 -254 5.3096 0.137
NP_440376.1_1 Reverse -182 -191 1.57302 0.246
NP_440376.1_1 Reverse -206 -215 -0.0986038 0.285
NP_441588.1_4 Reverse -31 -41 6.46988 0.193
NP_440580.1_1 Reverse -333 -352 10.8159 0.172
NP_442687.1_7 Forward -216 -206 12.5664 0.0712
NP_442687.1_7 Forward -145 -135 6.56821 0.159
NP_442687.1_7 Reverse -28 -38 3.61828 0.299
NP_441388.1_3 Reverse -20 -39 8.75009 0.21
NP_442658.1_1 Reverse -27 -37 7.45273 0.214
NP_442658.1_1 Forward -217 -207 7.35439 0.214
NP_442658.1_1 Reverse -204 -214 5.48612 0.265
NP_441487.1_9 Reverse -28 -47 -2.55715 0.293
NP_442937.1_5 Forward -43 -24 12.0942 0.119
NP_441958.1_5 Forward -216 -206 8.73149 0.0255
NP_441958.1_5 Reverse -205 -215 0.963343 0.12
NP_441958.1_5 Forward -308 -298 -0.314959 0.198
NP_441127.1_5 Reverse -333 -352 14.6387 0.274
NP_439905.1_1 Reverse -207 -220 8.57408 0.232
NP_441097.1_2 Reverse -214 -231 13.6085 0.142
NP_441338.2_5 Reverse -212 -231 9.0459 0.247
NP_442911.1_2 Reverse -288 -307 -11.0136 0.296
NP_442536.1_4 Forward -361 -343 5.72234 0.3
NP_440993.1_3 Reverse -235 -254 -2.36125 0.299
NP_440496.1_1 Forward -121 -102 0.58944 0.289
NP_440602.1_8 Forward -215 -201 10.521 0.269
NP_441429.1_4 Reverse -282 -301 9.04509 0.237
NP_440615.1_7 Forward -190 -171 11.9103 0.299
NP_441129.1_3 Forward -349 -330 -9.63698 0.214
NP_441099.1_5 Reverse -196 -215 -8.06369 0.187
NP_441099.1_5 Reverse -85 -104 -8.26035 0.191
NP_442002.1_9 Forward -216 -209 10.7572 0.185
NP_441294.1_7 Forward -195 -181 8.48272 0.298
NP_442438.1_10 Reverse -12 -26 5.21113 0.137
NP_442438.1_10 Reverse -293 -307 -0.983719 0.287
NP_441000.1_6 Forward -216 -202 3.53951 0.111
NP_441000.1_6 Reverse -205 -219 -2.65535 0.22
NP_441000.1_6 Forward -308 -294 -5.31028 0.273
NP_441110.1_10 Forward -100 -81 11.8975 0.249
NP_441674.1_6 Forward -358 -339 16.7157 0.063
NP_440147.1_4 Forward -217 -204 14.0806 0.0279
NP_440147.1_4 Reverse -204 -217 5.03416 0.139
NP_441550.1_8 Reverse -204 -214 12.3692 0.0336
NP_441550.1_8 Forward -217 -207 7.55106 0.154
NP_441916.1_7 Reverse -206 -216 9.51814 0.0338
NP_441916.1_7 Forward -215 -205 5.09324 0.146
NP_441041.1_7 Reverse -295 -307 14.8031 0.034
NP_441041.1_7 Reverse -203 -215 9.65268 0.108
NP_441725.1_4 Forward -286 -272 8.55376 0.198
NP_441725.1_5 Reverse -299 -309 -0.806614 0.271
NP_439966.1_7 Forward -217 -207 8.23937 0.14
NP_439966.1_9 Reverse -391 -400 4.71961 0.253
NP_439966.1_9 Forward -217 -208 0.884706 0.253
NP_442941.1_3 Reverse -207 -217 0.963343 0.16
NP_440289.1_2 Reverse -295 -308 0.904263 0.144
NP_440289.1_2 Reverse -203 -216 -3.52063 0.267
NP_440289.1_2 Forward -218 -205 -5.09393 0.297
NP_440983.1_5 Forward -356 -337 -8.55534 0.295
NP_440983.1_5 Reverse -20 -39 -8.65367 0.295
NP_442281.1_1 Reverse -201 -215 10.8154 0.0537
NP_442281.1_1 Reverse -293 -307 6.19383 0.133
NP_442901.1_4 Forward -253 -234 0.0977854 0.284
NP_441058.2_6 Forward -252 -233 11.7008 0.268
NP_440437.1_1 Forward -217 -198 -3.63879 0.242
NP_439983.1_7 Forward -105 -87 17.2271 0.137
NP_442049.1_6 Reverse -36 -55 6.09597 0.23
NP_441644.1_6 Reverse -206 -216 7.45273 0.124
NP_440587.1_5 Reverse -164 -182 20.1816 0.104
NP_440867.1_10 Reverse -335 -354 0.687771 0.299
NP_442029.1_6 Forward -134 -115 6.09597 0.244
NP_440253.1_2 Forward -307 -289 5.32902 0.0936
NP_440253.1_2 Reverse -350 -368 1.78911 0.152
NP_440253.1_2 Reverse -206 -224 1.19912 0.166
NP_440929.1_8 Reverse -206 -215 7.17789 0.0713
NP_442933.1_10 Reverse -206 -215 8.06287 0.0885
NP_442933.1_10 Forward -215 -206 7.96454 0.0937
NP_441751.2_8 Reverse -299 -313 -0.688726 0.129
NP_442554.1_8 Reverse -299 -309 4.50326 0.184
NP_442554.1_8 Reverse -207 -217 4.3066 0.189
NP_442554.1_8 Forward -214 -204 3.12662 0.239
NP_441762.1_7 Reverse -205 -217 3.48056 0.0676
NP_441762.1_7 Forward -308 -296 -6.05754 0.268
NP_441762.1_7 Reverse -297 -309 -6.05754 0.268
NP_442142.1_4 Reverse -314 -327 2.18201 0.299
NP_442292.1_1 Reverse -207 -216 -0.196935 0.239
NP_440919.1_1 Forward -109 -90 -6.68705 0.258
NP_441525.1_1 Reverse -202 -215 13.4906 0.241
NP_440511.1_1 Forward -117 -99 8.57394 0.228
NP_443009.1_5 Forward -308 -297 8.31797 0.112
NP_443009.1_5 Reverse -205 -216 6.94134 0.144
NP_443009.1_5 Reverse -244 -255 5.17139 0.214
NP_441715.1_4 Reverse -207 -217 9.02648 0.105
NP_440183.1_9 Reverse -208 -227 -14.5535 0.266
NP_440464.1_10 Forward -387 -377 12.3397 0.233
NP_441468.1_1 Forward -214 -207 6.13563 0.209
NP_441468.1_1 Reverse -207 -214 6.0373 0.223
NP_441020.2_6 Forward -309 -292 10.8552 0.133
NP_441673.1_1 Forward -215 -206 1.27803 0.155
NP_441673.1_1 Reverse -206 -215 1.27803 0.155
NP_441673.1_1 Reverse -350 -359 -7.86675 0.187
NP_441673.1_1 Forward -359 -350 -7.96508 0.206
NP_441637.1_9 Forward -282 -264 4.24738 0.245
NP_441637.1_9 Forward -239 -221 -3.42244 0.296
NP_441764.1_8 Forward -49 -39 11.3107 0.284
NP_442868.1_6 Forward -361 -351 0.57002 0.217
NP_442868.1_6 Forward -217 -207 0.57002 0.217
NP_442868.1_6 Reverse -204 -214 -0.118297 0.264
NP_442227.1_2 Forward -354 -335 6.4893 0.198
NP_442227.1_2 Forward -222 -203 -0.885524 0.26
NP_442361.1_3 Forward -285 -272 7.78743 0.288
NP_442808.1_1 Forward -192 -182 5.58445 0.146
NP_442808.1_1 Reverse -244 -254 3.32285 0.244
NP_442692.1_1 Reverse -85 -104 -4.72043 0.274
NP_440145.1_3 Reverse -340 -359 -6.09707 0.288
NP_442820.1_4 Forward -396 -379 13.7068 0.265
NP_442542.1_2 Forward -217 -204 12.409 0.114
NP_442542.1_9 Forward -222 -208 15.2402 0.0838
NP_442050.1_5 Reverse -204 -214 10.5993 0.141
NP_440558.1_2 Forward -329 -310 -5.31042 0.256
NP_440162.1_2 Reverse -335 -354 15.7324 0.151
NP_440111.2_4 Reverse -201 -220 10.9142 0.215
NP_441878.1_6 Reverse -205 -215 0.668351 0.139
NP_441878.1_6 Reverse -134 -144 -6.60814 0.193
NP_441036.1_8 Forward -216 -206 12.5664 0.0744
NP_441036.1_8 Reverse -297 -307 6.17489 0.242
NP_441557.1_5 Forward -215 -206 8.94785 0.0289
NP_441557.1_5 Reverse -206 -215 0.688044 0.128
NP_441557.1_5 Forward -307 -298 -0.885252 0.26
NP_441433.1_8 Forward -254 -235 -1.37718 0.258
NP_442777.1_1 Reverse -328 -347 6.1935 0.268
NP_442183.1_1 Reverse -298 -312 5.80112 0.203
NP_441116.1_9 Reverse -10 -24 14.6509 0.229
NP_440440.1_1 Forward -353 -334 14.8466 0.11
NP_441574.1_1 Reverse -323 -342 -4.03212 0.249
NP_442347.1_2 Forward -190 -181 11.6028 0.056
NP_442347.1_2 Reverse -207 -216 8.94785 0.0718
NP_442347.1_2 Reverse -138 -147 3.93297 0.284
NP_442645.1_2 Reverse -198 -217 -21.535 0.29
NP_441633.1_3 Forward -217 -204 -4.40561 0.195
NP_440136.1_2 Forward -214 -207 6.23397 0.171
NP_440136.1_2 Reverse -207 -214 6.13563 0.193
NP_442998.1_5 Reverse -219 -229 12.7631 0.159
NP_442998.1_5 Reverse -380 -390 9.02648 0.256
NP_442998.1_10 Reverse -208 -215 15.5754 0.0102
NP_440299.1_1 Forward -219 -206 9.06515 0.0797
NP_441799.1_1 Reverse -202 -216 11.4053 0.0589
NP_442333.2_5 Reverse -195 -214 -15.3402 0.291
NP_440256.1_1 Reverse -203 -222 8.06259 0.0239
NP_440256.1_1 Reverse -242 -261 -3.73712 0.138
NP_440256.1_1 Forward -218 -199 -8.85033 0.268
NP_441559.1_8 Reverse -115 -129 1.37622 0.156
NP_440915.1_6 Forward -219 -205 10.521 0.0311
NP_440915.1_6 Reverse -294 -308 -0.000409212 0.179
NP_440915.1_6 Reverse -202 -216 -1.27871 0.229
NP_442158.1_4 Forward -316 -306 10.8948 0.283
NP_440657.1_3 Reverse -307 -324 1.12048 0.277
NP_441464.1_10 Forward -95 -81 12.4876 0.201
NP_441939.1_3 Forward -214 -195 11.6025 0.112
NP_442386.1_9 Forward -350 -341 6.58748 0.219
NP_442386.1_9 Forward -216 -207 5.9975 0.23
NP_442386.1_9 Forward -185 -176 5.30919 0.257
NP_442386.1_9 Reverse -297 -306 4.62087 0.294
NP_441340.1_5 Forward -214 -207 13.5105 0.0314
NP_441340.1_5 Reverse -207 -214 5.84064 0.208
NP_440327.1_6 Reverse -335 -354 5.99764 0.249
NP_441132.1_8 Reverse -267 -286 11.6025 0.132
NP_442240.1_2 Forward -214 -195 -19.0768 0.295
NP_440161.1_3 Forward -115 -96 8.06259 0.278
NP_440586.1_8 Reverse -207 -214 9.47853 0.146
NP_440586.1_8 Forward -214 -207 5.74197 0.283
NP_442959.1_7 Forward -186 -167 -1.47551 0.247
NP_441262.1_3 Forward -215 -208 14.7888 0.0223
NP_440523.1_10 Reverse -87 -106 6.4893 0.274
NP_443051.1_1 Forward -216 -207 7.47288 0.0571
NP_443051.1_1 Reverse -205 -214 -1.08191 0.281
NP_439937.1_9 Forward -393 -376 3.97136 0.0798
NP_439937.1_9 Reverse -295 -312 -16.8747 0.289
NP_440836.1_6 Forward -96 -82 5.89945 0.297
NP_440439.1_1 Forward -218 -205 10.5407 0.0365
NP_440439.1_1 Reverse -242 -255 -0.0790467 0.207
NP_442239.1_8 Reverse -35 -54 8.16093 0.25
NP_440372.1_2 Forward -214 -207 13.8055 0.0214
NP_440372.1_2 Reverse -207 -214 6.52896 0.188
NP_440819.1_5 Reverse -379 -387 7.8859 0.266
NP_441803.1_2 Forward -151 -132 0.58944 0.249
NP_441803.1_2 Reverse -177 -196 0.196116 0.258
NP_440139.1_1 Forward -221 -202 5.80018 0.152
NP_440267.1_2 Reverse -201 -215 9.73373 0.156
NP_442384.1_10 Reverse -206 -219 15.8506 0.00946
NP_442384.1_10 Forward -191 -178 0.510939 0.289
NP_442114.1_4 Reverse -206 -217 7.43349 0.277
NP_441018.1_7 Forward -219 -200 7.37428 0.272
NP_442262.1_10 Reverse -207 -214 13.2155 0.0213
NP_440344.1_10 Forward -261 -244 -10.2859 0.174
NP_440344.1_10 Reverse -291 -308 -11.8592 0.231
NP_442123.1_3 Reverse -202 -221 10.9142 0.265
NP_441896.1_3 Forward -224 -205 4.62101 0.142
NP_440894.1_10 Forward -196 -177 9.83255 0.155
NP_440888.1_2 Reverse -206 -220 15.7319 0.0092
NP_440888.1_2 Forward -359 -345 11.2087 0.0729
NP_440888.1_2 Forward -307 -293 5.60385 0.272
NP_440803.1_3 Reverse -228 -247 12.9791 0.153
NP_440803.1_3 Forward -257 -238 6.19431 0.23
NP_440052.1_5 Forward -226 -207 -1.18052 0.195
NP_439969.1_3 Forward -220 -201 -0.39387 0.271
NP_442277.1_4 Forward -224 -205 5.2102 0.175
NP_441543.1_2 Reverse -207 -216 8.65285 0.0968
NP_441543.1_5 Forward -222 -203 2.26107 0.2
NP_441469.1_8 Forward -216 -207 6.39124 0.227
NP_441469.1_8 Reverse -297 -306 5.99792 0.241
NP_441548.1_3 Reverse -207 -226 12.3883 0.24
NP_443064.1_6 Forward -215 -205 9.07643 0.247
NP_443064.1_6 Reverse -95 -105 8.97947 0.254
NP_442578.1_7 Forward -214 -207 6.0373 0.18
NP_440710.1_1 Reverse -127 -145 -9.22396 0.296
NP_440148.1_1 Reverse -371 -390 -3.93378 0.219
NP_441462.1_2 Forward -215 -205 17.3846 0.00406
NP_442204.1_1 Forward -219 -208 2.12362 0.266
NP_442204.1_5 Forward -201 -182 11.6025 0.0748
NP_440516.1_8 Forward -215 -206 9.4395 0.0183
NP_440516.1_8 Reverse -206 -215 5.11294 0.118
NP_442428.1_4 Forward -306 -287 3.83436 0.238
NP_442428.1_5 Forward -214 -207 6.13563 0.209
NP_442428.1_5 Reverse -207 -214 6.0373 0.212
NP_442859.1_6 Reverse -22 -41 6.58682 0.253
NP_440673.1_3 Reverse -208 -215 12.4288 0.0426
NP_441052.1_2 Reverse -137 -147 3.71661 0.175
NP_440436.1_4 Reverse -207 -216 8.55409 0.0997
NP_440436.1_4 Forward -214 -205 5.11253 0.222
NP_441884.1_9 Forward -197 -178 -20.945 0.218
NP_441884.1_9 Forward -310 -291 -22.6167 0.281
NP_441884.1_9 Reverse -203 -222 -24.0916 0.284
NP_441719.1_4 Forward -214 -207 6.82395 0.0855
NP_441719.1_4 Reverse -207 -214 6.52896 0.188
NP_441733.1_10 Forward -310 -297 18.1122 0.0292
NP_441733.1_10 Reverse -295 -308 5.91914 0.203
NP_441733.1_10 Forward -218 -205 5.32916 0.218
NP_441004.1_1 Forward -122 -103 -6.29373 0.184
NP_441004.1_2 Forward -154 -135 -3.24547 0.274
NP_442366.1_3 Forward -212 -194 -2.0458 0.219
NP_439949.1_7 Forward -164 -150 11.2093 0.291
NP_441851.1_10 Forward -308 -298 7.94484 0.127
NP_441851.1_10 Forward -216 -206 7.55152 0.137
NP_441542.1_4 Reverse -376 -390 5.80112 0.264
NP_442856.1_5 Reverse -235 -254 16.4658 0.282
NP_442515.1_1 Reverse -134 -148 5.40779 0.107
NP_442515.1_1 Forward -145 -131 -4.03198 0.298
NP_440593.1_3 Reverse -177 -196 -2.65548 0.227
NP_440463.1_7 Forward -352 -338 14.6509 0.296
NP_440432.1_9 Forward -214 -199 -0.0201027 0.163
NP_440432.1_9 Reverse -207 -222 -2.77337 0.175
NP_440432.1_9 Forward -143 -128 -2.77337 0.175
NP_442843.1_1 Forward -343 -324 -9.047 0.264
NP_441477.1_5 Reverse -225 -244 5.99764 0.292
NP_440040.1_6 Reverse -238 -257 9.14423 0.181
NP_442006.1_2 Reverse -335 -352 -15.6941 0.228
NP_441078.1_4 Forward -254 -245 5.70292 0.111
NP_441078.1_4 Reverse -206 -215 0.0980582 0.205
NP_441078.1_4 Forward -215 -206 0.0980582 0.205
NP_441078.1_4 Forward -144 -135 -1.18024 0.237
NP_441078.1_4 Reverse -135 -144 -1.96689 0.282
NP_442729.1_7 Reverse -228 -246 6.80398 0.277
NP_442443.1_1 Forward -289 -270 -1.37718 0.233
NP_442443.1_1 Reverse -214 -233 -4.91709 0.28
NP_440526.1_3 Reverse -299 -310 10.5796 0.0646
NP_441432.1_8 Reverse -175 -184 9.53783 0.0755
NP_441432.1_8 Forward -216 -207 5.50626 0.151
NP_443024.1_3 Reverse -274 -284 11.6814 0.289
NP_442320.1_8 Forward -221 -207 -4.22864 0.151
NP_442320.1_8 Reverse -292 -306 -5.70361 0.245
NP_441732.1_2 Reverse -292 -308 -16.9527 0.223
NP_441131.1_5 Reverse -175 -194 2.65439 0.261
NP_441945.1_10 Forward -326 -307 6.88262 0.291
NP_441328.2_8 Forward -375 -356 17.3048 0.268
NP_442010.1_1 Forward -294 -276 15.948 0.164
NP_442400.1_1 Forward -214 -195 -5.70374 0.299
NP_440713.1_4 Reverse -335 -354 10.0292 0.133
NP_442489.1_7 Reverse -206 -215 0.786375 0.152
NP_442489.1_7 Forward -215 -206 0.589713 0.17
NP_440559.1_1 Forward -214 -205 14.651 0.0144
NP_441659.2_8 Reverse -206 -216 6.56821 0.0714
NP_441659.2_8 Forward -29 -19 1.74999 0.227
NP_441659.2_8 Forward -215 -205 0.176696 0.271
NP_441022.1_1 Reverse -163 -172 13.8484 0.188
NP_442913.1_10 Forward -138 -119 -5.50708 0.268
NP_441968.1_1 Forward -65 -57 14.3753 0.286
NP_440779.1_5 Reverse -298 -315 -15.0058 0.3
NP_442346.1_5 Reverse -205 -215 5.97822 0.219
NP_440545.1_5 Reverse -178 -195 5.64371 0.23
NP_440025.1_3 Forward -289 -275 12.1598 0.269
NP_440459.1_2 Reverse -204 -221 7.31533 0.296
NP_441653.1_2 Forward -226 -207 5.26902 0.248
NP_440010.1_10 Forward -41 -22 10.6192 0.209
NP_442551.1_4 Reverse -132 -147 -3.75668 0.295
NP_441888.1_7 Forward -220 -206 4.32615 0.225
NP_441888.1_7 Reverse -114 -128 3.53951 0.225
NP_440946.1_6 Reverse -324 -343 8.55425 0.294
NP_440449.1_6 Forward -199 -181 7.18594 0.229
NP_441948.1_4 Reverse -199 -217 -3.02911 0.181
NP_441833.1_4 Reverse -207 -214 6.52896 0.0924
NP_441833.1_4 Forward -214 -207 6.23397 0.163
NP_442162.1_9 Forward -214 -207 12.9205 0.0282
NP_442162.1_9 Reverse -207 -214 12.9205 0.0282
NP_442140.1_3 Reverse -207 -217 12.1731 0.0637
NP_440875.1_9 Reverse -187 -197 8.5667 0.233
NP_440875.1_9 Reverse -208 -218 8.46937 0.233
NP_441813.1_5 Reverse -204 -214 14.4347 0.0152
NP_441813.1_5 Forward -217 -207 9.7148 0.0241
NP_440590.1_4 Reverse -207 -220 10.5407 0.0262
NP_440590.1_4 Reverse -183 -196 1.10092 0.133
NP_442497.1_10 Forward -214 -205 8.25953 0.047
NP_442497.1_10 Reverse -207 -216 0.589713 0.153
NP_442497.1_10 Reverse -299 -308 0.29472 0.199
NP_440821.1_4 Forward -309 -299 6.56821 0.0853
NP_440821.1_4 Forward -217 -207 0.471689 0.174
NP_441239.1_9 Reverse -204 -216 12.3303 0.0477
NP_441239.1_9 Reverse -296 -308 4.07055 0.264
NP_441239.1_9 Forward -217 -205 3.87389 0.272
NP_441239.1_9 Forward -328 -316 3.77555 0.276
NP_441892.1_1 Reverse -355 -372 -4.18939 0.256
NP_442044.1_1 Forward -151 -132 -14.7502 0.299
NP_442643.1_3 Forward -259 -240 -8.06369 0.295
NP_442643.1_3 Forward -122 -103 -8.55534 0.295
NP_441874.1_1 Forward -317 -303 8.75105 0.294
NP_440354.1_7 Forward -221 -203 15.2604 0.167
NP_440354.1_7 Forward -217 -199 12.0155 0.224
NP_440354.1_7 Reverse -169 -187 7.29564 0.269
NP_440546.1_4 Forward -215 -205 15.4756 0.0459
NP_440546.1_4 Reverse -206 -216 10.046 0.109
NP_440546.1_4 Reverse -335 -345 7.13728 0.257
NP_440546.1_4 Forward -307 -297 6.65249 0.288
NP_440462.1_6 Forward -217 -207 7.74818 0.0699
NP_440462.1_6 Reverse -204 -214 6.07655 0.129
NP_440868.1_4 Forward -219 -207 0.923956 0.196
NP_440401.1_9 Forward -187 -180 14.5917 0.287
NP_441249.1_3 Reverse -204 -223 1.86774 0.278
NP_441474.1_1 Forward -354 -335 5.11187 0.212
NP_442402.1_4 Reverse -112 -131 0.981987 0.177
NP_442402.1_4 Reverse -101 -120 -3.34455 0.214
NP_442402.1_4 Reverse -226 -245 -4.62285 0.228
NP_442402.1_4 Reverse -100 -119 -9.83437 0.293
NP_442402.1_6 Forward -246 -237 13.7661 0.276
NP_442402.1_6 Forward -166 -157 13.7661 0.276
NP_442402.1_10 Reverse -235 -245 14.0409 0.182
NP_442402.1_10 Reverse -155 -165 12.9592 0.204
NP_441848.1_7 Forward -231 -212 -4.1312 0.287
NP_441843.2_9 Reverse -208 -226 12.4373 0.205
NP_442039.1_4 Forward -214 -207 11.6422 0.0747
NP_442039.1_4 Reverse -299 -306 7.80726 0.24
NP_442679.1_1 Reverse -81 -100 -1.96717 0.24
NP_442409.1_8 Forward -342 -324 20.5703 0.17
NP_442837.1_3 Forward -214 -207 6.0373 0.25
NP_442837.1_3 Reverse -207 -214 6.0373 0.25
NP_440160.1_9 Reverse -310 -329 9.63589 0.235
NP_442053.1_1 Reverse -206 -215 7.17789 0.104
NP_440505.1_3 Forward -217 -207 14.3364 0.0224
NP_440505.1_3 Reverse -243 -253 5.19158 0.241
NP_441203.1_2 Reverse -335 -354 -5.80207 0.265
NP_442009.1_9 Forward -285 -266 13.3725 0.226
NP_440914.1_1 Reverse -29 -39 8.41992 0.191
NP_441011.1_6 Forward -196 -177 15.2408 0.142
NP_441011.1_8 Forward -214 -205 12.0944 0.0517
NP_441011.1_8 Reverse -207 -216 7.07956 0.179
NP_441011.1_8 Forward -143 -134 5.3096 0.271
NP_442101.1_6 Forward -175 -156 14.7491 0.195
NP_442533.1_6 Forward -215 -206 5.40793 0.14
NP_442533.1_6 Reverse -206 -215 4.52295 0.179
NP_442533.1_6 Reverse -317 -326 2.06468 0.275
NP_442322.1_4 Forward -352 -335 -10.0899 0.298
NP_441482.1_7 Reverse -200 -214 -12.0951 0.29
NP_441482.1_7 Forward -221 -207 -12.2918 0.292
NP_441028.1_6 Reverse -235 -245 3.8145 0.281
NP_442664.1_3 Reverse -337 -351 13.0776 0.246
NP_440116.1_8 Forward -214 -195 -2.16383 0.126
NP_440007.1_9 Reverse -172 -186 1.47456 0.285
NP_440007.1_9 Reverse -116 -130 0.687908 0.292
NP_441602.1_3 Forward -220 -201 -4.72043 0.272
NP_441106.1_1 Forward -216 -207 8.45619 0.0548
NP_441106.1_1 Reverse -201 -210 2.35967 0.287
NP_442588.1_6 Reverse -333 -352 -1.47551 0.268
NP_441286.1_1 Forward -39 -27 1.31728 0.088
NP_440670.1_8 Forward -215 -206 8.65285 0.0627
NP_440670.1_8 Reverse -206 -215 6.29291 0.124
NP_440886.1_7 Forward -255 -245 10.5993 0.0805
NP_442614.1_2 Forward -215 -201 13.2743 0.132
NP_442072.1_9 Forward -216 -198 -4.60241 0.0476
NP_442072.1_9 Reverse -134 -152 -13.7472 0.121
NP_442072.1_9 Reverse -205 -223 -22.9903 0.271
NP_440907.2_8 Reverse -299 -309 8.92768 0.117
NP_440907.2_8 Reverse -207 -217 6.17443 0.178
NP_441021.1_1 Forward -214 -195 -7.27704 0.182
NP_441626.1_2 Forward -214 -207 12.2322 0.0511
NP_441626.1_2 Reverse -207 -214 5.93897 0.231
NP_442211.1_3 Reverse -210 -229 10.2926 0.257
NP_442615.1_1 Forward -316 -298 -3.81576 0.17
NP_441962.1_4 Forward -118 -99 -14.8485 0.294
NP_441193.1_6 Reverse -258 -277 9.93088 0.149
NP_440143.1_1 Forward -194 -175 17.109 0.205
NP_440114.1_10 Forward -215 -201 13.8643 0.0481
NP_442323.1_7 Reverse -240 -259 1.37531 0.281
NP_440287.1_6 Forward -379 -360 0.491109 0.29
NP_440766.1_4 Forward -219 -205 2.2612 0.191
NP_440766.1_5 Forward -119 -107 8.80169 0.277
NP_442743.1_4 Forward -203 -184 -7.4737 0.279
NP_439910.1_2 Reverse -198 -215 -14.0225 0.177
NP_439910.1_2 Reverse -290 -307 -21.889 0.195
NP_442867.1_8 Forward -372 -353 7.66927 0.242
NP_440457.1_1 Forward -219 -207 8.59377 0.101
NP_440457.1_1 Reverse -202 -214 -0.649339 0.271
NP_442680.1_5 Reverse -23 -42 0.462991 0.266
NP_440801.1_8 Forward -54 -35 4.81767 0.195
NP_440142.1_9 Forward -287 -273 12.192 0.289
NP_441984.1_3 Reverse -202 -220 5.82068 0.276
NP_442509.1_9 Forward -144 -134 7.25606 0.229
NP_440554.1_4 Reverse -207 -217 13.5497 0.0245
NP_441885.1_5 Forward -215 -205 7.84651 0.0419
NP_441885.1_5 Forward -254 -244 -1.69159 0.277
NP_442341.1_7 Reverse -181 -195 6.19444 0.134
NP_441756.1_5 Forward -354 -335 -4.13045 0.292
NP_441173.1_9 Reverse -236 -244 12.0154 0.214
NP_443000.1_7 Forward -217 -207 1.84832 0.228
NP_443000.1_7 Reverse -204 -214 1.16001 0.271
NP_440727.1_3 Reverse -307 -326 18.1907 0.138
NP_441842.1_10 Forward -222 -208 7.66941 0.249
NP_440275.1_3 Forward -217 -207 12.8614 0.0299
NP_440091.1_1 Reverse -294 -306 3.08724 0.17
NP_443010.1_10 Reverse -295 -312 13.2072 0.0767
NP_439962.1_4 Forward -223 -204 -8.26035 0.292
NP_439962.1_4 Forward -355 -336 -8.752 0.298
NP_442495.1_4 Forward -125 -115 15.713 0.124
NP_440216.1_1 Forward -215 -201 7.66941 0.00931
NP_440216.1_1 Reverse -206 -220 5.1128 0.0222
NP_440216.1_1 Reverse -202 -216 -11.0135 0.159
NP_440216.1_1 Forward -254 -240 -12.3901 0.264
NP_440216.1_1 Reverse -135 -149 -12.5868 0.288
NP_440172.1_1 Forward -215 -205 8.82982 0.0586
NP_442371.1_1 Forward -245 -235 12.4676 0.249
NP_441226.1_7 Forward -214 -207 12.7234 0.0312
NP_441226.1_7 Reverse -207 -214 11.5435 0.0757
NP_441226.1_7 Reverse -45 -52 9.77352 0.131
NP_441226.1_7 Forward -348 -341 5.34865 0.289
NP_441111.1_7 Reverse -207 -215 8.86921 0.0589
NP_441766.1_2 Forward -215 -206 8.1612 0.0645
NP_441766.1_2 Reverse -206 -215 5.89959 0.103
NP_441766.1_2 Forward -307 -298 4.32629 0.187
NP_442417.1_5 Reverse -206 -220 16.4209 0.0412
NP_440416.1_9 Forward -222 -203 0.687771 0.051
NP_440416.1_9 Reverse -333 -352 -1.37718 0.0652
NP_440072.1_5 Reverse -335 -353 6.31233 0.236
NP_442403.1_8 Reverse -7 -26 -0.688862 0.256
NP_442154.1_1 Reverse -336 -354 1.98577 0.0787
NP_442226.1_7 Reverse -280 -298 20.3728 0.0352
NP_440261.1_5 Reverse -299 -312 -3.32397 0.127
NP_440261.1_5 Forward -193 -180 -6.47056 0.201
NP_440261.1_5 Reverse -207 -220 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAGCCCGGCGCATTTATCCCGAAATTATCGATGCCTATCTGGAGTCCGCCACCCAACCCAGGGCGGAATATGCAGCCCTGTCCTTTGTTAGGGGGGATCTCTGCTTTGATTTGGCCCAATTTATGCCGGATTTAACCGTTACTACGGCTATCCTCTGGGGAGAATATGCCCAATTTACCCCTCCGGCGATCGGTCGTCGTTTAGCGGCGCTGAACCCCAATGCCATTAAAGCTTTTGTGGAAATTAAAGACGTGGGGTTAACGCCCCATTTGGAATTACCTGGGGTAACAATTGGGGTGATTCGTCGGTTTTTGGCTCTGCTCCAATAGTGTGTCAAGATAAATACACCGACGGCAAAATTGGCGTTTGTGCCGACCATCTAAATTCCCTTGAGAATCT

CDS

ATGACCAGCAGTGACACCCAGAACAACAAAACACTGGCCGCAATGAAAAATTTTGCGGAGCAGTATGCTAAACGTACGGATACCTATTTTTGTAGTGATCTTTCCGTCACCGCCGTTGTTATCGAGGGTTTAGCTCGCCATAAAGAGGAATTGGGTTCTCCCCTGTGCCCCTGTCGCCACTACGAAGACAAGGAAGCGGAAGTAAAAAATACCTTTTGGAATTGCCCCTGTGTGCCTATGCGGGAGCGCAAGGAATGTCACTGTATGTTGTTTTTAACCCCAGATAACGATTTTGCTGGGGATGCCCAGGATATTCCCATGGAAACTTTGGAGGAAGTCAAGGCCAGCATGGCCTAG

Protein

MTSSDTQNNKTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHKEELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECHCMLFLTPDNDFAGDAQDIPMETLEEVKASMA